|
|
/** |
|
|
* @license |
|
|
* Lodash (Custom Build) <https://lodash.com/> |
|
|
* Build: `lodash core plus="debounce,throttle,get,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference"` |
|
|
* Copyright JS Foundation and other contributors <https://js.foundation/> |
|
|
* Released under MIT license <https://lodash.com/license> |
|
|
* Based on Underscore.js 1.8.3 <http://underscorejs.org/LICENSE> |
|
|
* Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors |
|
|
*/ |
|
|
;(function() { |
|
|
|
|
|
/** Used as a safe reference for `undefined` in pre-ES5 environments. */ |
|
|
var undefined; |
|
|
|
|
|
/** Used as the semantic version number. */ |
|
|
var VERSION = '4.17.5'; |
|
|
|
|
|
/** Used as the size to enable large array optimizations. */ |
|
|
var LARGE_ARRAY_SIZE = 200; |
|
|
|
|
|
/** Error message constants. */ |
|
|
var FUNC_ERROR_TEXT = 'Expected a function'; |
|
|
|
|
|
/** Used to stand-in for `undefined` hash values. */ |
|
|
var HASH_UNDEFINED = '__lodash_hash_undefined__'; |
|
|
|
|
|
/** Used as the maximum memoize cache size. */ |
|
|
var MAX_MEMOIZE_SIZE = 500; |
|
|
|
|
|
/** Used as the internal argument placeholder. */ |
|
|
var PLACEHOLDER = '__lodash_placeholder__'; |
|
|
|
|
|
/** Used to compose bitmasks for cloning. */ |
|
|
var CLONE_DEEP_FLAG = 1, |
|
|
CLONE_FLAT_FLAG = 2, |
|
|
CLONE_SYMBOLS_FLAG = 4; |
|
|
|
|
|
/** Used to compose bitmasks for value comparisons. */ |
|
|
var COMPARE_PARTIAL_FLAG = 1, |
|
|
COMPARE_UNORDERED_FLAG = 2; |
|
|
|
|
|
/** Used to compose bitmasks for function metadata. */ |
|
|
var WRAP_BIND_FLAG = 1, |
|
|
WRAP_BIND_KEY_FLAG = 2, |
|
|
WRAP_CURRY_BOUND_FLAG = 4, |
|
|
WRAP_CURRY_FLAG = 8, |
|
|
WRAP_CURRY_RIGHT_FLAG = 16, |
|
|
WRAP_PARTIAL_FLAG = 32, |
|
|
WRAP_PARTIAL_RIGHT_FLAG = 64, |
|
|
WRAP_ARY_FLAG = 128, |
|
|
WRAP_REARG_FLAG = 256, |
|
|
WRAP_FLIP_FLAG = 512; |
|
|
|
|
|
/** Used to detect hot functions by number of calls within a span of milliseconds. */ |
|
|
var HOT_COUNT = 800, |
|
|
HOT_SPAN = 16; |
|
|
|
|
|
/** Used to indicate the type of lazy iteratees. */ |
|
|
var LAZY_FILTER_FLAG = 1, |
|
|
LAZY_MAP_FLAG = 2, |
|
|
LAZY_WHILE_FLAG = 3; |
|
|
|
|
|
/** Used as references for various `Number` constants. */ |
|
|
var INFINITY = 1 / 0, |
|
|
MAX_SAFE_INTEGER = 9007199254740991, |
|
|
MAX_INTEGER = 1.7976931348623157e+308, |
|
|
NAN = 0 / 0; |
|
|
|
|
|
/** Used as references for the maximum length and index of an array. */ |
|
|
var MAX_ARRAY_LENGTH = 4294967295; |
|
|
|
|
|
/** Used to associate wrap methods with their bit flags. */ |
|
|
var wrapFlags = [ |
|
|
['ary', WRAP_ARY_FLAG], |
|
|
['bind', WRAP_BIND_FLAG], |
|
|
['bindKey', WRAP_BIND_KEY_FLAG], |
|
|
['curry', WRAP_CURRY_FLAG], |
|
|
['curryRight', WRAP_CURRY_RIGHT_FLAG], |
|
|
['flip', WRAP_FLIP_FLAG], |
|
|
['partial', WRAP_PARTIAL_FLAG], |
|
|
['partialRight', WRAP_PARTIAL_RIGHT_FLAG], |
|
|
['rearg', WRAP_REARG_FLAG] |
|
|
]; |
|
|
|
|
|
/** `Object#toString` result references. */ |
|
|
var argsTag = '[object Arguments]', |
|
|
arrayTag = '[object Array]', |
|
|
asyncTag = '[object AsyncFunction]', |
|
|
boolTag = '[object Boolean]', |
|
|
dateTag = '[object Date]', |
|
|
errorTag = '[object Error]', |
|
|
funcTag = '[object Function]', |
|
|
genTag = '[object GeneratorFunction]', |
|
|
mapTag = '[object Map]', |
|
|
numberTag = '[object Number]', |
|
|
nullTag = '[object Null]', |
|
|
objectTag = '[object Object]', |
|
|
promiseTag = '[object Promise]', |
|
|
proxyTag = '[object Proxy]', |
|
|
regexpTag = '[object RegExp]', |
|
|
setTag = '[object Set]', |
|
|
stringTag = '[object String]', |
|
|
symbolTag = '[object Symbol]', |
|
|
undefinedTag = '[object Undefined]', |
|
|
weakMapTag = '[object WeakMap]'; |
|
|
|
|
|
var arrayBufferTag = '[object ArrayBuffer]', |
|
|
dataViewTag = '[object DataView]', |
|
|
float32Tag = '[object Float32Array]', |
|
|
float64Tag = '[object Float64Array]', |
|
|
int8Tag = '[object Int8Array]', |
|
|
int16Tag = '[object Int16Array]', |
|
|
int32Tag = '[object Int32Array]', |
|
|
uint8Tag = '[object Uint8Array]', |
|
|
uint8ClampedTag = '[object Uint8ClampedArray]', |
|
|
uint16Tag = '[object Uint16Array]', |
|
|
uint32Tag = '[object Uint32Array]'; |
|
|
|
|
|
/** Used to match HTML entities and HTML characters. */ |
|
|
var reUnescapedHtml = /[&<>"']/g, |
|
|
reHasUnescapedHtml = RegExp(reUnescapedHtml.source); |
|
|
|
|
|
/** Used to match property names within property paths. */ |
|
|
var reIsDeepProp = /\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/, |
|
|
reIsPlainProp = /^\w*$/, |
|
|
rePropName = /[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g; |
|
|
|
|
|
/** |
|
|
* Used to match `RegExp` |
|
|
* [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns). |
|
|
*/ |
|
|
var reRegExpChar = /[\\^$.*+?()[\]{}|]/g; |
|
|
|
|
|
/** Used to match leading and trailing whitespace. */ |
|
|
var reTrim = /^\s+|\s+$/g; |
|
|
|
|
|
/** Used to match wrap detail comments. */ |
|
|
var reWrapComment = /\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/, |
|
|
reWrapDetails = /\{\n\/\* \[wrapped with (.+)\] \*/, |
|
|
reSplitDetails = /,? & /; |
|
|
|
|
|
/** Used to match backslashes in property paths. */ |
|
|
var reEscapeChar = /\\(\\)?/g; |
|
|
|
|
|
/** Used to match `RegExp` flags from their coerced string values. */ |
|
|
var reFlags = /\w*$/; |
|
|
|
|
|
/** Used to detect bad signed hexadecimal string values. */ |
|
|
var reIsBadHex = /^[-+]0x[0-9a-f]+$/i; |
|
|
|
|
|
/** Used to detect binary string values. */ |
|
|
var reIsBinary = /^0b[01]+$/i; |
|
|
|
|
|
/** Used to detect host constructors (Safari). */ |
|
|
var reIsHostCtor = /^\[object .+?Constructor\]$/; |
|
|
|
|
|
/** Used to detect octal string values. */ |
|
|
var reIsOctal = /^0o[0-7]+$/i; |
|
|
|
|
|
/** Used to detect unsigned integer values. */ |
|
|
var reIsUint = /^(?:0|[1-9]\d*)$/; |
|
|
|
|
|
/** Used to compose unicode character classes. */ |
|
|
var rsAstralRange = '\\ud800-\\udfff', |
|
|
rsComboMarksRange = '\\u0300-\\u036f', |
|
|
reComboHalfMarksRange = '\\ufe20-\\ufe2f', |
|
|
rsComboSymbolsRange = '\\u20d0-\\u20ff', |
|
|
rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange, |
|
|
rsVarRange = '\\ufe0e\\ufe0f'; |
|
|
|
|
|
/** Used to compose unicode capture groups. */ |
|
|
var rsAstral = '[' + rsAstralRange + ']', |
|
|
rsCombo = '[' + rsComboRange + ']', |
|
|
rsFitz = '\\ud83c[\\udffb-\\udfff]', |
|
|
rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')', |
|
|
rsNonAstral = '[^' + rsAstralRange + ']', |
|
|
rsRegional = '(?:\\ud83c[\\udde6-\\uddff]){2}', |
|
|
rsSurrPair = '[\\ud800-\\udbff][\\udc00-\\udfff]', |
|
|
rsZWJ = '\\u200d'; |
|
|
|
|
|
/** Used to compose unicode regexes. */ |
|
|
var reOptMod = rsModifier + '?', |
|
|
rsOptVar = '[' + rsVarRange + ']?', |
|
|
rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*', |
|
|
rsSeq = rsOptVar + reOptMod + rsOptJoin, |
|
|
rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')'; |
|
|
|
|
|
/** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */ |
|
|
var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g'); |
|
|
|
|
|
/** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */ |
|
|
var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange + rsComboRange + rsVarRange + ']'); |
|
|
|
|
|
/** Used to identify `toStringTag` values of typed arrays. */ |
|
|
var typedArrayTags = {}; |
|
|
typedArrayTags[float32Tag] = typedArrayTags[float64Tag] = |
|
|
typedArrayTags[int8Tag] = typedArrayTags[int16Tag] = |
|
|
typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] = |
|
|
typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] = |
|
|
typedArrayTags[uint32Tag] = true; |
|
|
typedArrayTags[argsTag] = typedArrayTags[arrayTag] = |
|
|
typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] = |
|
|
typedArrayTags[dataViewTag] = typedArrayTags[dateTag] = |
|
|
typedArrayTags[errorTag] = typedArrayTags[funcTag] = |
|
|
typedArrayTags[mapTag] = typedArrayTags[numberTag] = |
|
|
typedArrayTags[objectTag] = typedArrayTags[regexpTag] = |
|
|
typedArrayTags[setTag] = typedArrayTags[stringTag] = |
|
|
typedArrayTags[weakMapTag] = false; |
|
|
|
|
|
/** Used to identify `toStringTag` values supported by `_.clone`. */ |
|
|
var cloneableTags = {}; |
|
|
cloneableTags[argsTag] = cloneableTags[arrayTag] = |
|
|
cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] = |
|
|
cloneableTags[boolTag] = cloneableTags[dateTag] = |
|
|
cloneableTags[float32Tag] = cloneableTags[float64Tag] = |
|
|
cloneableTags[int8Tag] = cloneableTags[int16Tag] = |
|
|
cloneableTags[int32Tag] = cloneableTags[mapTag] = |
|
|
cloneableTags[numberTag] = cloneableTags[objectTag] = |
|
|
cloneableTags[regexpTag] = cloneableTags[setTag] = |
|
|
cloneableTags[stringTag] = cloneableTags[symbolTag] = |
|
|
cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] = |
|
|
cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true; |
|
|
cloneableTags[errorTag] = cloneableTags[funcTag] = |
|
|
cloneableTags[weakMapTag] = false; |
|
|
|
|
|
/** Used to map characters to HTML entities. */ |
|
|
var htmlEscapes = { |
|
|
'&': '&', |
|
|
'<': '<', |
|
|
'>': '>', |
|
|
'"': '"', |
|
|
"'": ''' |
|
|
}; |
|
|
|
|
|
/** Built-in method references without a dependency on `root`. */ |
|
|
var freeParseFloat = parseFloat, |
|
|
freeParseInt = parseInt; |
|
|
|
|
|
/** Detect free variable `global` from Node.js. */ |
|
|
var freeGlobal = typeof global == 'object' && global && global.Object === Object && global; |
|
|
|
|
|
/** Detect free variable `self`. */ |
|
|
var freeSelf = typeof self == 'object' && self && self.Object === Object && self; |
|
|
|
|
|
/** Used as a reference to the global object. */ |
|
|
var root = freeGlobal || freeSelf || Function('return this')(); |
|
|
|
|
|
/** Detect free variable `exports`. */ |
|
|
var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports; |
|
|
|
|
|
/** Detect free variable `module`. */ |
|
|
var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module; |
|
|
|
|
|
/** Detect the popular CommonJS extension `module.exports`. */ |
|
|
var moduleExports = freeModule && freeModule.exports === freeExports; |
|
|
|
|
|
/** Detect free variable `process` from Node.js. */ |
|
|
var freeProcess = moduleExports && freeGlobal.process; |
|
|
|
|
|
/** Used to access faster Node.js helpers. */ |
|
|
var nodeUtil = (function() { |
|
|
try { |
|
|
return freeProcess && freeProcess.binding && freeProcess.binding('util'); |
|
|
} catch (e) {} |
|
|
}()); |
|
|
|
|
|
/* Node.js helper references. */ |
|
|
var nodeIsDate = nodeUtil && nodeUtil.isDate, |
|
|
nodeIsMap = nodeUtil && nodeUtil.isMap, |
|
|
nodeIsRegExp = nodeUtil && nodeUtil.isRegExp, |
|
|
nodeIsSet = nodeUtil && nodeUtil.isSet, |
|
|
nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray; |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* A faster alternative to `Function#apply`, this function invokes `func` |
|
|
* with the `this` binding of `thisArg` and the arguments of `args`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to invoke. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {Array} args The arguments to invoke `func` with. |
|
|
* @returns {*} Returns the result of `func`. |
|
|
*/ |
|
|
function apply(func, thisArg, args) { |
|
|
switch (args.length) { |
|
|
case 0: return func.call(thisArg); |
|
|
case 1: return func.call(thisArg, args[0]); |
|
|
case 2: return func.call(thisArg, args[0], args[1]); |
|
|
case 3: return func.call(thisArg, args[0], args[1], args[2]); |
|
|
} |
|
|
return func.apply(thisArg, args); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseAggregator` for arrays. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform keys. |
|
|
* @param {Object} accumulator The initial aggregated object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function arrayAggregator(array, setter, iteratee, accumulator) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
setter(accumulator, value, iteratee(value), array); |
|
|
} |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.forEach` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function arrayEach(array, iteratee) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (iteratee(array[index], index, array) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.every` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function arrayEvery(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (!predicate(array[index], index, array)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.filter` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
*/ |
|
|
function arrayFilter(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (predicate(value, index, array)) { |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.includes` for arrays without support for |
|
|
* specifying an index to search from. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to inspect. |
|
|
* @param {*} target The value to search for. |
|
|
* @returns {boolean} Returns `true` if `target` is found, else `false`. |
|
|
*/ |
|
|
function arrayIncludes(array, value) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return !!length && baseIndexOf(array, value, 0) > -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like `arrayIncludes` except that it accepts a comparator. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to inspect. |
|
|
* @param {*} target The value to search for. |
|
|
* @param {Function} comparator The comparator invoked per element. |
|
|
* @returns {boolean} Returns `true` if `target` is found, else `false`. |
|
|
*/ |
|
|
function arrayIncludesWith(array, value, comparator) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (comparator(value, array[index])) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.map` for arrays without support for iteratee |
|
|
* shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
*/ |
|
|
function arrayMap(array, iteratee) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
result = Array(length); |
|
|
|
|
|
while (++index < length) { |
|
|
result[index] = iteratee(array[index], index, array); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Appends the elements of `values` to `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to modify. |
|
|
* @param {Array} values The values to append. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function arrayPush(array, values) { |
|
|
var index = -1, |
|
|
length = values.length, |
|
|
offset = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
array[offset + index] = values[index]; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.reduce` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {*} [accumulator] The initial value. |
|
|
* @param {boolean} [initAccum] Specify using the first element of `array` as |
|
|
* the initial value. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
*/ |
|
|
function arrayReduce(array, iteratee, accumulator, initAccum) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
if (initAccum && length) { |
|
|
accumulator = array[++index]; |
|
|
} |
|
|
while (++index < length) { |
|
|
accumulator = iteratee(accumulator, array[index], index, array); |
|
|
} |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.some` for arrays without support for iteratee |
|
|
* shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function arraySome(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (predicate(array[index], index, array)) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of an ASCII `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
var asciiSize = baseProperty('length'); |
|
|
|
|
|
/** |
|
|
* Converts an ASCII `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function asciiToArray(string) { |
|
|
return string.split(''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.findKey` and `_.findLastKey`, |
|
|
* without support for iteratee shorthands, which iterates over `collection` |
|
|
* using `eachFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to inspect. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @param {Function} eachFunc The function to iterate over `collection`. |
|
|
* @returns {*} Returns the found element or its key, else `undefined`. |
|
|
*/ |
|
|
function baseFindKey(collection, predicate, eachFunc) { |
|
|
var result; |
|
|
eachFunc(collection, function(value, key, collection) { |
|
|
if (predicate(value, key, collection)) { |
|
|
result = key; |
|
|
return false; |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.findIndex` and `_.findLastIndex` without |
|
|
* support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function baseFindIndex(array, predicate, fromIndex, fromRight) { |
|
|
var length = array.length, |
|
|
index = fromIndex + (fromRight ? 1 : -1); |
|
|
|
|
|
while ((fromRight ? index-- : ++index < length)) { |
|
|
if (predicate(array[index], index, array)) { |
|
|
return index; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.indexOf` without `fromIndex` bounds checks. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function baseIndexOf(array, value, fromIndex) { |
|
|
return value === value |
|
|
? strictIndexOf(array, value, fromIndex) |
|
|
: baseFindIndex(array, baseIsNaN, fromIndex); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isNaN` without support for number objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `NaN`, else `false`. |
|
|
*/ |
|
|
function baseIsNaN(value) { |
|
|
return value !== value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.property` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {string} key The key of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function baseProperty(key) { |
|
|
return function(object) { |
|
|
return object == null ? undefined : object[key]; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.propertyOf` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function basePropertyOf(object) { |
|
|
return function(key) { |
|
|
return object == null ? undefined : object[key]; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.reduce` and `_.reduceRight`, without support |
|
|
* for iteratee shorthands, which iterates over `collection` using `eachFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {*} accumulator The initial value. |
|
|
* @param {boolean} initAccum Specify using the first or last element of |
|
|
* `collection` as the initial value. |
|
|
* @param {Function} eachFunc The function to iterate over `collection`. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
*/ |
|
|
function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) { |
|
|
eachFunc(collection, function(value, index, collection) { |
|
|
accumulator = initAccum |
|
|
? (initAccum = false, value) |
|
|
: iteratee(accumulator, value, index, collection); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.sortBy` which uses `comparer` to define the |
|
|
* sort order of `array` and replaces criteria objects with their corresponding |
|
|
* values. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to sort. |
|
|
* @param {Function} comparer The function to define sort order. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function baseSortBy(array, comparer) { |
|
|
var length = array.length; |
|
|
|
|
|
array.sort(comparer); |
|
|
while (length--) { |
|
|
array[length] = array[length].value; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.times` without support for iteratee shorthands |
|
|
* or max array length checks. |
|
|
* |
|
|
* @private |
|
|
* @param {number} n The number of times to invoke `iteratee`. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the array of results. |
|
|
*/ |
|
|
function baseTimes(n, iteratee) { |
|
|
var index = -1, |
|
|
result = Array(n); |
|
|
|
|
|
while (++index < n) { |
|
|
result[index] = iteratee(index); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.unary` without support for storing metadata. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to cap arguments for. |
|
|
* @returns {Function} Returns the new capped function. |
|
|
*/ |
|
|
function baseUnary(func) { |
|
|
return function(value) { |
|
|
return func(value); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.values` and `_.valuesIn` which creates an |
|
|
* array of `object` property values corresponding to the property names |
|
|
* of `props`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array} props The property names to get values for. |
|
|
* @returns {Object} Returns the array of property values. |
|
|
*/ |
|
|
function baseValues(object, props) { |
|
|
return arrayMap(props, function(key) { |
|
|
return object[key]; |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a `cache` value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} cache The cache to query. |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function cacheHas(cache, key) { |
|
|
return cache.has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the number of `placeholder` occurrences in `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} placeholder The placeholder to search for. |
|
|
* @returns {number} Returns the placeholder count. |
|
|
*/ |
|
|
function countHolders(array, placeholder) { |
|
|
var length = array.length, |
|
|
result = 0; |
|
|
|
|
|
while (length--) { |
|
|
if (array[length] === placeholder) { |
|
|
++result; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.escape` to convert characters to HTML entities. |
|
|
* |
|
|
* @private |
|
|
* @param {string} chr The matched character to escape. |
|
|
* @returns {string} Returns the escaped character. |
|
|
*/ |
|
|
var escapeHtmlChar = basePropertyOf(htmlEscapes); |
|
|
|
|
|
/** |
|
|
* Gets the value at `key` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {string} key The key of the property to get. |
|
|
* @returns {*} Returns the property value. |
|
|
*/ |
|
|
function getValue(object, key) { |
|
|
return object == null ? undefined : object[key]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `string` contains Unicode symbols. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to inspect. |
|
|
* @returns {boolean} Returns `true` if a symbol is found, else `false`. |
|
|
*/ |
|
|
function hasUnicode(string) { |
|
|
return reHasUnicode.test(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `iterator` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} iterator The iterator to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function iteratorToArray(iterator) { |
|
|
var data, |
|
|
result = []; |
|
|
|
|
|
while (!(data = iterator.next()).done) { |
|
|
result.push(data.value); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `map` to its key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} map The map to convert. |
|
|
* @returns {Array} Returns the key-value pairs. |
|
|
*/ |
|
|
function mapToArray(map) { |
|
|
var index = -1, |
|
|
result = Array(map.size); |
|
|
|
|
|
map.forEach(function(value, key) { |
|
|
result[++index] = [key, value]; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a unary function that invokes `func` with its argument transformed. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {Function} transform The argument transform. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function overArg(func, transform) { |
|
|
return function(arg) { |
|
|
return func(transform(arg)); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Replaces all `placeholder` elements in `array` with an internal placeholder |
|
|
* and returns an array of their indexes. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to modify. |
|
|
* @param {*} placeholder The placeholder to replace. |
|
|
* @returns {Array} Returns the new array of placeholder indexes. |
|
|
*/ |
|
|
function replaceHolders(array, placeholder) { |
|
|
var index = -1, |
|
|
length = array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (value === placeholder || value === PLACEHOLDER) { |
|
|
array[index] = PLACEHOLDER; |
|
|
result[resIndex++] = index; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `set` to an array of its values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} set The set to convert. |
|
|
* @returns {Array} Returns the values. |
|
|
*/ |
|
|
function setToArray(set) { |
|
|
var index = -1, |
|
|
result = Array(set.size); |
|
|
|
|
|
set.forEach(function(value) { |
|
|
result[++index] = value; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.indexOf` which performs strict equality |
|
|
* comparisons of values, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function strictIndexOf(array, value, fromIndex) { |
|
|
var index = fromIndex - 1, |
|
|
length = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (array[index] === value) { |
|
|
return index; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the number of symbols in `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
function stringSize(string) { |
|
|
return hasUnicode(string) |
|
|
? unicodeSize(string) |
|
|
: asciiSize(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function stringToArray(string) { |
|
|
return hasUnicode(string) |
|
|
? unicodeToArray(string) |
|
|
: asciiToArray(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of a Unicode `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
function unicodeSize(string) { |
|
|
var result = reUnicode.lastIndex = 0; |
|
|
while (reUnicode.test(string)) { |
|
|
++result; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts a Unicode `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function unicodeToArray(string) { |
|
|
return string.match(reUnicode) || []; |
|
|
} |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
/** Used for built-in method references. */ |
|
|
var arrayProto = Array.prototype, |
|
|
funcProto = Function.prototype, |
|
|
objectProto = Object.prototype; |
|
|
|
|
|
/** Used to detect overreaching core-js shims. */ |
|
|
var coreJsData = root['__core-js_shared__']; |
|
|
|
|
|
/** Used to resolve the decompiled source of functions. */ |
|
|
var funcToString = funcProto.toString; |
|
|
|
|
|
/** Used to check objects for own properties. */ |
|
|
var hasOwnProperty = objectProto.hasOwnProperty; |
|
|
|
|
|
/** Used to generate unique IDs. */ |
|
|
var idCounter = 0; |
|
|
|
|
|
/** Used to detect methods masquerading as native. */ |
|
|
var maskSrcKey = (function() { |
|
|
var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || ''); |
|
|
return uid ? ('Symbol(src)_1.' + uid) : ''; |
|
|
}()); |
|
|
|
|
|
/** |
|
|
* Used to resolve the |
|
|
* [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring) |
|
|
* of values. |
|
|
*/ |
|
|
var nativeObjectToString = objectProto.toString; |
|
|
|
|
|
/** Used to infer the `Object` constructor. */ |
|
|
var objectCtorString = funcToString.call(Object); |
|
|
|
|
|
/** Used to restore the original `_` reference in `_.noConflict`. */ |
|
|
var oldDash = root._; |
|
|
|
|
|
/** Used to detect if a method is native. */ |
|
|
var reIsNative = RegExp('^' + |
|
|
funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\$&') |
|
|
.replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g, '$1.*?') + '$' |
|
|
); |
|
|
|
|
|
/** Built-in value references. */ |
|
|
var Buffer = moduleExports ? root.Buffer : undefined, |
|
|
Symbol = root.Symbol, |
|
|
Uint8Array = root.Uint8Array, |
|
|
allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined, |
|
|
getPrototype = overArg(Object.getPrototypeOf, Object), |
|
|
objectCreate = Object.create, |
|
|
propertyIsEnumerable = objectProto.propertyIsEnumerable, |
|
|
splice = arrayProto.splice, |
|
|
spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined, |
|
|
symIterator = Symbol ? Symbol.iterator : undefined, |
|
|
symToStringTag = Symbol ? Symbol.toStringTag : undefined; |
|
|
|
|
|
var defineProperty = (function() { |
|
|
try { |
|
|
var func = getNative(Object, 'defineProperty'); |
|
|
func({}, '', {}); |
|
|
return func; |
|
|
} catch (e) {} |
|
|
}()); |
|
|
|
|
|
/* Built-in method references for those with the same name as other `lodash` methods. */ |
|
|
var nativeCeil = Math.ceil, |
|
|
nativeFloor = Math.floor, |
|
|
nativeGetSymbols = Object.getOwnPropertySymbols, |
|
|
nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined, |
|
|
nativeIsFinite = root.isFinite, |
|
|
nativeKeys = overArg(Object.keys, Object), |
|
|
nativeMax = Math.max, |
|
|
nativeMin = Math.min, |
|
|
nativeNow = Date.now, |
|
|
nativeRandom = Math.random, |
|
|
nativeReverse = arrayProto.reverse; |
|
|
|
|
|
/* Built-in method references that are verified to be native. */ |
|
|
var DataView = getNative(root, 'DataView'), |
|
|
Map = getNative(root, 'Map'), |
|
|
Promise = getNative(root, 'Promise'), |
|
|
Set = getNative(root, 'Set'), |
|
|
WeakMap = getNative(root, 'WeakMap'), |
|
|
nativeCreate = getNative(Object, 'create'); |
|
|
|
|
|
/** Used to store function metadata. */ |
|
|
var metaMap = WeakMap && new WeakMap; |
|
|
|
|
|
/** Used to lookup unminified function names. */ |
|
|
var realNames = {}; |
|
|
|
|
|
/** Used to detect maps, sets, and weakmaps. */ |
|
|
var dataViewCtorString = toSource(DataView), |
|
|
mapCtorString = toSource(Map), |
|
|
promiseCtorString = toSource(Promise), |
|
|
setCtorString = toSource(Set), |
|
|
weakMapCtorString = toSource(WeakMap); |
|
|
|
|
|
/** Used to convert symbols to primitives and strings. */ |
|
|
var symbolProto = Symbol ? Symbol.prototype : undefined, |
|
|
symbolValueOf = symbolProto ? symbolProto.valueOf : undefined, |
|
|
symbolToString = symbolProto ? symbolProto.toString : undefined; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` object which wraps `value` to enable implicit method |
|
|
* chain sequences. Methods that operate on and return arrays, collections, |
|
|
* and functions can be chained together. Methods that retrieve a single value |
|
|
* or may return a primitive value will automatically end the chain sequence |
|
|
* and return the unwrapped value. Otherwise, the value must be unwrapped |
|
|
* with `_#value`. |
|
|
* |
|
|
* Explicit chain sequences, which must be unwrapped with `_#value`, may be |
|
|
* enabled using `_.chain`. |
|
|
* |
|
|
* The execution of chained methods is lazy, that is, it's deferred until |
|
|
* `_#value` is implicitly or explicitly called. |
|
|
* |
|
|
* Lazy evaluation allows several methods to support shortcut fusion. |
|
|
* Shortcut fusion is an optimization to merge iteratee calls; this avoids |
|
|
* the creation of intermediate arrays and can greatly reduce the number of |
|
|
* iteratee executions. Sections of a chain sequence qualify for shortcut |
|
|
* fusion if the section is applied to an array and iteratees accept only |
|
|
* one argument. The heuristic for whether a section qualifies for shortcut |
|
|
* fusion is subject to change. |
|
|
* |
|
|
* Chaining is supported in custom builds as long as the `_#value` method is |
|
|
* directly or indirectly included in the build. |
|
|
* |
|
|
* In addition to lodash methods, wrappers have `Array` and `String` methods. |
|
|
* |
|
|
* The wrapper `Array` methods are: |
|
|
* `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift` |
|
|
* |
|
|
* The wrapper `String` methods are: |
|
|
* `replace` and `split` |
|
|
* |
|
|
* The wrapper methods that support shortcut fusion are: |
|
|
* `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`, |
|
|
* `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`, |
|
|
* `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray` |
|
|
* |
|
|
* The chainable wrapper methods are: |
|
|
* `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`, |
|
|
* `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`, |
|
|
* `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`, |
|
|
* `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`, |
|
|
* `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`, |
|
|
* `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`, |
|
|
* `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`, |
|
|
* `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`, |
|
|
* `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`, |
|
|
* `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`, |
|
|
* `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`, |
|
|
* `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`, |
|
|
* `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`, |
|
|
* `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`, |
|
|
* `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`, |
|
|
* `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`, |
|
|
* `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`, |
|
|
* `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`, |
|
|
* `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`, |
|
|
* `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`, |
|
|
* `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`, |
|
|
* `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`, |
|
|
* `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`, |
|
|
* `zipObject`, `zipObjectDeep`, and `zipWith` |
|
|
* |
|
|
* The wrapper methods that are **not** chainable by default are: |
|
|
* `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`, |
|
|
* `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`, |
|
|
* `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`, |
|
|
* `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`, |
|
|
* `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`, |
|
|
* `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`, |
|
|
* `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`, |
|
|
* `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`, |
|
|
* `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`, |
|
|
* `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`, |
|
|
* `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`, |
|
|
* `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`, |
|
|
* `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`, |
|
|
* `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`, |
|
|
* `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`, |
|
|
* `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`, |
|
|
* `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`, |
|
|
* `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`, |
|
|
* `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`, |
|
|
* `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`, |
|
|
* `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`, |
|
|
* `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`, |
|
|
* `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`, |
|
|
* `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`, |
|
|
* `upperFirst`, `value`, and `words` |
|
|
* |
|
|
* @name _ |
|
|
* @constructor |
|
|
* @category Seq |
|
|
* @param {*} value The value to wrap in a `lodash` instance. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* var wrapped = _([1, 2, 3]); |
|
|
* |
|
|
* // Returns an unwrapped value. |
|
|
* wrapped.reduce(_.add); |
|
|
* // => 6 |
|
|
* |
|
|
* // Returns a wrapped value. |
|
|
* var squares = wrapped.map(square); |
|
|
* |
|
|
* _.isArray(squares); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray(squares.value()); |
|
|
* // => true |
|
|
*/ |
|
|
function lodash(value) { |
|
|
if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) { |
|
|
if (value instanceof LodashWrapper) { |
|
|
return value; |
|
|
} |
|
|
if (hasOwnProperty.call(value, '__wrapped__')) { |
|
|
return wrapperClone(value); |
|
|
} |
|
|
} |
|
|
return new LodashWrapper(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.create` without support for assigning |
|
|
* properties to the created object. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} proto The object to inherit from. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
var baseCreate = (function() { |
|
|
function object() {} |
|
|
return function(proto) { |
|
|
if (!isObject(proto)) { |
|
|
return {}; |
|
|
} |
|
|
if (objectCreate) { |
|
|
return objectCreate(proto); |
|
|
} |
|
|
object.prototype = proto; |
|
|
var result = new object; |
|
|
object.prototype = undefined; |
|
|
return result; |
|
|
}; |
|
|
}()); |
|
|
|
|
|
/** |
|
|
* The function whose prototype chain sequence wrappers inherit from. |
|
|
* |
|
|
* @private |
|
|
*/ |
|
|
function baseLodash() { |
|
|
// No operation performed. |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base constructor for creating `lodash` wrapper objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to wrap. |
|
|
* @param {boolean} [chainAll] Enable explicit method chain sequences. |
|
|
*/ |
|
|
function LodashWrapper(value, chainAll) { |
|
|
this.__wrapped__ = value; |
|
|
this.__actions__ = []; |
|
|
this.__chain__ = !!chainAll; |
|
|
this.__index__ = 0; |
|
|
this.__values__ = undefined; |
|
|
} |
|
|
|
|
|
// Ensure wrappers are instances of `baseLodash`. |
|
|
lodash.prototype = baseLodash.prototype; |
|
|
lodash.prototype.constructor = lodash; |
|
|
|
|
|
LodashWrapper.prototype = baseCreate(baseLodash.prototype); |
|
|
LodashWrapper.prototype.constructor = LodashWrapper; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a lazy wrapper object which wraps `value` to enable lazy evaluation. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {*} value The value to wrap. |
|
|
*/ |
|
|
function LazyWrapper(value) { |
|
|
this.__wrapped__ = value; |
|
|
this.__actions__ = []; |
|
|
this.__dir__ = 1; |
|
|
this.__filtered__ = false; |
|
|
this.__iteratees__ = []; |
|
|
this.__takeCount__ = MAX_ARRAY_LENGTH; |
|
|
this.__views__ = []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the lazy wrapper object. |
|
|
* |
|
|
* @private |
|
|
* @name clone |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {Object} Returns the cloned `LazyWrapper` object. |
|
|
*/ |
|
|
function lazyClone() { |
|
|
var result = new LazyWrapper(this.__wrapped__); |
|
|
result.__actions__ = copyArray(this.__actions__); |
|
|
result.__dir__ = this.__dir__; |
|
|
result.__filtered__ = this.__filtered__; |
|
|
result.__iteratees__ = copyArray(this.__iteratees__); |
|
|
result.__takeCount__ = this.__takeCount__; |
|
|
result.__views__ = copyArray(this.__views__); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverses the direction of lazy iteration. |
|
|
* |
|
|
* @private |
|
|
* @name reverse |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {Object} Returns the new reversed `LazyWrapper` object. |
|
|
*/ |
|
|
function lazyReverse() { |
|
|
if (this.__filtered__) { |
|
|
var result = new LazyWrapper(this); |
|
|
result.__dir__ = -1; |
|
|
result.__filtered__ = true; |
|
|
} else { |
|
|
result = this.clone(); |
|
|
result.__dir__ *= -1; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Extracts the unwrapped value from its lazy wrapper. |
|
|
* |
|
|
* @private |
|
|
* @name value |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {*} Returns the unwrapped value. |
|
|
*/ |
|
|
function lazyValue() { |
|
|
var array = this.__wrapped__.value(), |
|
|
dir = this.__dir__, |
|
|
isArr = isArray(array), |
|
|
isRight = dir < 0, |
|
|
arrLength = isArr ? array.length : 0, |
|
|
view = getView(0, arrLength, this.__views__), |
|
|
start = view.start, |
|
|
end = view.end, |
|
|
length = end - start, |
|
|
index = isRight ? end : (start - 1), |
|
|
iteratees = this.__iteratees__, |
|
|
iterLength = iteratees.length, |
|
|
resIndex = 0, |
|
|
takeCount = nativeMin(length, this.__takeCount__); |
|
|
|
|
|
if (!isArr || (!isRight && arrLength == length && takeCount == length)) { |
|
|
return baseWrapperValue(array, this.__actions__); |
|
|
} |
|
|
var result = []; |
|
|
|
|
|
outer: |
|
|
while (length-- && resIndex < takeCount) { |
|
|
index += dir; |
|
|
|
|
|
var iterIndex = -1, |
|
|
value = array[index]; |
|
|
|
|
|
while (++iterIndex < iterLength) { |
|
|
var data = iteratees[iterIndex], |
|
|
iteratee = data.iteratee, |
|
|
type = data.type, |
|
|
computed = iteratee(value); |
|
|
|
|
|
if (type == LAZY_MAP_FLAG) { |
|
|
value = computed; |
|
|
} else if (!computed) { |
|
|
if (type == LAZY_FILTER_FLAG) { |
|
|
continue outer; |
|
|
} else { |
|
|
break outer; |
|
|
} |
|
|
} |
|
|
} |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
// Ensure `LazyWrapper` is an instance of `baseLodash`. |
|
|
LazyWrapper.prototype = baseCreate(baseLodash.prototype); |
|
|
LazyWrapper.prototype.constructor = LazyWrapper; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a hash object. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function Hash(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the hash. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf Hash |
|
|
*/ |
|
|
function hashClear() { |
|
|
this.__data__ = nativeCreate ? nativeCreate(null) : {}; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the hash. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf Hash |
|
|
* @param {Object} hash The hash to modify. |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function hashDelete(key) { |
|
|
var result = this.has(key) && delete this.__data__[key]; |
|
|
this.size -= result ? 1 : 0; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the hash value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function hashGet(key) { |
|
|
var data = this.__data__; |
|
|
if (nativeCreate) { |
|
|
var result = data[key]; |
|
|
return result === HASH_UNDEFINED ? undefined : result; |
|
|
} |
|
|
return hasOwnProperty.call(data, key) ? data[key] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a hash value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function hashHas(key) { |
|
|
var data = this.__data__; |
|
|
return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the hash `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the hash instance. |
|
|
*/ |
|
|
function hashSet(key, value) { |
|
|
var data = this.__data__; |
|
|
this.size += this.has(key) ? 0 : 1; |
|
|
data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `Hash`. |
|
|
Hash.prototype.clear = hashClear; |
|
|
Hash.prototype['delete'] = hashDelete; |
|
|
Hash.prototype.get = hashGet; |
|
|
Hash.prototype.has = hashHas; |
|
|
Hash.prototype.set = hashSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an list cache object. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function ListCache(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the list cache. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf ListCache |
|
|
*/ |
|
|
function listCacheClear() { |
|
|
this.__data__ = []; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the list cache. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function listCacheDelete(key) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
if (index < 0) { |
|
|
return false; |
|
|
} |
|
|
var lastIndex = data.length - 1; |
|
|
if (index == lastIndex) { |
|
|
data.pop(); |
|
|
} else { |
|
|
splice.call(data, index, 1); |
|
|
} |
|
|
--this.size; |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the list cache value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function listCacheGet(key) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
return index < 0 ? undefined : data[index][1]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a list cache value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function listCacheHas(key) { |
|
|
return assocIndexOf(this.__data__, key) > -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the list cache `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the list cache instance. |
|
|
*/ |
|
|
function listCacheSet(key, value) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
if (index < 0) { |
|
|
++this.size; |
|
|
data.push([key, value]); |
|
|
} else { |
|
|
data[index][1] = value; |
|
|
} |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `ListCache`. |
|
|
ListCache.prototype.clear = listCacheClear; |
|
|
ListCache.prototype['delete'] = listCacheDelete; |
|
|
ListCache.prototype.get = listCacheGet; |
|
|
ListCache.prototype.has = listCacheHas; |
|
|
ListCache.prototype.set = listCacheSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a map cache object to store key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function MapCache(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the map. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf MapCache |
|
|
*/ |
|
|
function mapCacheClear() { |
|
|
this.size = 0; |
|
|
this.__data__ = { |
|
|
'hash': new Hash, |
|
|
'map': new (Map || ListCache), |
|
|
'string': new Hash |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the map. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function mapCacheDelete(key) { |
|
|
var result = getMapData(this, key)['delete'](key); |
|
|
this.size -= result ? 1 : 0; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the map value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function mapCacheGet(key) { |
|
|
return getMapData(this, key).get(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a map value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function mapCacheHas(key) { |
|
|
return getMapData(this, key).has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the map `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the map cache instance. |
|
|
*/ |
|
|
function mapCacheSet(key, value) { |
|
|
var data = getMapData(this, key), |
|
|
size = data.size; |
|
|
|
|
|
data.set(key, value); |
|
|
this.size += data.size == size ? 0 : 1; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `MapCache`. |
|
|
MapCache.prototype.clear = mapCacheClear; |
|
|
MapCache.prototype['delete'] = mapCacheDelete; |
|
|
MapCache.prototype.get = mapCacheGet; |
|
|
MapCache.prototype.has = mapCacheHas; |
|
|
MapCache.prototype.set = mapCacheSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* |
|
|
* Creates an array cache object to store unique values. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [values] The values to cache. |
|
|
*/ |
|
|
function SetCache(values) { |
|
|
var index = -1, |
|
|
length = values == null ? 0 : values.length; |
|
|
|
|
|
this.__data__ = new MapCache; |
|
|
while (++index < length) { |
|
|
this.add(values[index]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Adds `value` to the array cache. |
|
|
* |
|
|
* @private |
|
|
* @name add |
|
|
* @memberOf SetCache |
|
|
* @alias push |
|
|
* @param {*} value The value to cache. |
|
|
* @returns {Object} Returns the cache instance. |
|
|
*/ |
|
|
function setCacheAdd(value) { |
|
|
this.__data__.set(value, HASH_UNDEFINED); |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is in the array cache. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf SetCache |
|
|
* @param {*} value The value to search for. |
|
|
* @returns {number} Returns `true` if `value` is found, else `false`. |
|
|
*/ |
|
|
function setCacheHas(value) { |
|
|
return this.__data__.has(value); |
|
|
} |
|
|
|
|
|
// Add methods to `SetCache`. |
|
|
SetCache.prototype.add = SetCache.prototype.push = setCacheAdd; |
|
|
SetCache.prototype.has = setCacheHas; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a stack cache object to store key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function Stack(entries) { |
|
|
var data = this.__data__ = new ListCache(entries); |
|
|
this.size = data.size; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the stack. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf Stack |
|
|
*/ |
|
|
function stackClear() { |
|
|
this.__data__ = new ListCache; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the stack. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function stackDelete(key) { |
|
|
var data = this.__data__, |
|
|
result = data['delete'](key); |
|
|
|
|
|
this.size = data.size; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the stack value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function stackGet(key) { |
|
|
return this.__data__.get(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a stack value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function stackHas(key) { |
|
|
return this.__data__.has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the stack `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the stack cache instance. |
|
|
*/ |
|
|
function stackSet(key, value) { |
|
|
var data = this.__data__; |
|
|
if (data instanceof ListCache) { |
|
|
var pairs = data.__data__; |
|
|
if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) { |
|
|
pairs.push([key, value]); |
|
|
this.size = ++data.size; |
|
|
return this; |
|
|
} |
|
|
data = this.__data__ = new MapCache(pairs); |
|
|
} |
|
|
data.set(key, value); |
|
|
this.size = data.size; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `Stack`. |
|
|
Stack.prototype.clear = stackClear; |
|
|
Stack.prototype['delete'] = stackDelete; |
|
|
Stack.prototype.get = stackGet; |
|
|
Stack.prototype.has = stackHas; |
|
|
Stack.prototype.set = stackSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an array of the enumerable property names of the array-like `value`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @param {boolean} inherited Specify returning inherited property names. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function arrayLikeKeys(value, inherited) { |
|
|
var isArr = isArray(value), |
|
|
isArg = !isArr && isArguments(value), |
|
|
isBuff = !isArr && !isArg && isBuffer(value), |
|
|
isType = !isArr && !isArg && !isBuff && isTypedArray(value), |
|
|
skipIndexes = isArr || isArg || isBuff || isType, |
|
|
result = skipIndexes ? baseTimes(value.length, String) : [], |
|
|
length = result.length; |
|
|
|
|
|
for (var key in value) { |
|
|
if ((inherited || hasOwnProperty.call(value, key)) && |
|
|
!(skipIndexes && ( |
|
|
// Safari 9 has enumerable `arguments.length` in strict mode. |
|
|
key == 'length' || |
|
|
// Node.js 0.10 has enumerable non-index properties on buffers. |
|
|
(isBuff && (key == 'offset' || key == 'parent')) || |
|
|
// PhantomJS 2 has enumerable non-index properties on typed arrays. |
|
|
(isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) || |
|
|
// Skip index properties. |
|
|
isIndex(key, length) |
|
|
))) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Assigns `value` to `key` of `object` if the existing value is not equivalent |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {string} key The key of the property to assign. |
|
|
* @param {*} value The value to assign. |
|
|
*/ |
|
|
function assignValue(object, key, value) { |
|
|
var objValue = object[key]; |
|
|
if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) || |
|
|
(value === undefined && !(key in object))) { |
|
|
baseAssignValue(object, key, value); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the index at which the `key` is found in `array` of key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} key The key to search for. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function assocIndexOf(array, key) { |
|
|
var length = array.length; |
|
|
while (length--) { |
|
|
if (eq(array[length][0], key)) { |
|
|
return length; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Aggregates elements of `collection` on `accumulator` with keys transformed |
|
|
* by `iteratee` and values set by `setter`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform keys. |
|
|
* @param {Object} accumulator The initial aggregated object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function baseAggregator(collection, setter, iteratee, accumulator) { |
|
|
baseEach(collection, function(value, key, collection) { |
|
|
setter(accumulator, value, iteratee(value), collection); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.assign` without support for multiple sources |
|
|
* or `customizer` functions. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseAssign(object, source) { |
|
|
return object && copyObject(source, keys(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.assignIn` without support for multiple sources |
|
|
* or `customizer` functions. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseAssignIn(object, source) { |
|
|
return object && copyObject(source, keysIn(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `assignValue` and `assignMergeValue` without |
|
|
* value checks. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {string} key The key of the property to assign. |
|
|
* @param {*} value The value to assign. |
|
|
*/ |
|
|
function baseAssignValue(object, key, value) { |
|
|
if (key == '__proto__' && defineProperty) { |
|
|
defineProperty(object, key, { |
|
|
'configurable': true, |
|
|
'enumerable': true, |
|
|
'value': value, |
|
|
'writable': true |
|
|
}); |
|
|
} else { |
|
|
object[key] = value; |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.at` without support for individual paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @returns {Array} Returns the picked elements. |
|
|
*/ |
|
|
function baseAt(object, paths) { |
|
|
var index = -1, |
|
|
length = paths.length, |
|
|
result = Array(length), |
|
|
skip = object == null; |
|
|
|
|
|
while (++index < length) { |
|
|
result[index] = skip ? undefined : get(object, paths[index]); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.clamp` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {number} number The number to clamp. |
|
|
* @param {number} [lower] The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the clamped number. |
|
|
*/ |
|
|
function baseClamp(number, lower, upper) { |
|
|
if (number === number) { |
|
|
if (upper !== undefined) { |
|
|
number = number <= upper ? number : upper; |
|
|
} |
|
|
if (lower !== undefined) { |
|
|
number = number >= lower ? number : lower; |
|
|
} |
|
|
} |
|
|
return number; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.clone` and `_.cloneDeep` which tracks |
|
|
* traversed objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to clone. |
|
|
* @param {boolean} bitmask The bitmask flags. |
|
|
* 1 - Deep clone |
|
|
* 2 - Flatten inherited properties |
|
|
* 4 - Clone symbols |
|
|
* @param {Function} [customizer] The function to customize cloning. |
|
|
* @param {string} [key] The key of `value`. |
|
|
* @param {Object} [object] The parent object of `value`. |
|
|
* @param {Object} [stack] Tracks traversed objects and their clone counterparts. |
|
|
* @returns {*} Returns the cloned value. |
|
|
*/ |
|
|
function baseClone(value, bitmask, customizer, key, object, stack) { |
|
|
var result, |
|
|
isDeep = bitmask & CLONE_DEEP_FLAG, |
|
|
isFlat = bitmask & CLONE_FLAT_FLAG, |
|
|
isFull = bitmask & CLONE_SYMBOLS_FLAG; |
|
|
|
|
|
if (customizer) { |
|
|
result = object ? customizer(value, key, object, stack) : customizer(value); |
|
|
} |
|
|
if (result !== undefined) { |
|
|
return result; |
|
|
} |
|
|
if (!isObject(value)) { |
|
|
return value; |
|
|
} |
|
|
var isArr = isArray(value); |
|
|
if (isArr) { |
|
|
result = initCloneArray(value); |
|
|
if (!isDeep) { |
|
|
return copyArray(value, result); |
|
|
} |
|
|
} else { |
|
|
var tag = getTag(value), |
|
|
isFunc = tag == funcTag || tag == genTag; |
|
|
|
|
|
if (isBuffer(value)) { |
|
|
return cloneBuffer(value, isDeep); |
|
|
} |
|
|
if (tag == objectTag || tag == argsTag || (isFunc && !object)) { |
|
|
result = (isFlat || isFunc) ? {} : initCloneObject(value); |
|
|
if (!isDeep) { |
|
|
return isFlat |
|
|
? copySymbolsIn(value, baseAssignIn(result, value)) |
|
|
: copySymbols(value, baseAssign(result, value)); |
|
|
} |
|
|
} else { |
|
|
if (!cloneableTags[tag]) { |
|
|
return object ? value : {}; |
|
|
} |
|
|
result = initCloneByTag(value, tag, isDeep); |
|
|
} |
|
|
} |
|
|
// Check for circular references and return its corresponding clone. |
|
|
stack || (stack = new Stack); |
|
|
var stacked = stack.get(value); |
|
|
if (stacked) { |
|
|
return stacked; |
|
|
} |
|
|
stack.set(value, result); |
|
|
|
|
|
if (isSet(value)) { |
|
|
value.forEach(function(subValue) { |
|
|
result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack)); |
|
|
}); |
|
|
|
|
|
return result; |
|
|
} |
|
|
|
|
|
if (isMap(value)) { |
|
|
value.forEach(function(subValue, key) { |
|
|
result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack)); |
|
|
}); |
|
|
|
|
|
return result; |
|
|
} |
|
|
|
|
|
var keysFunc = isFull |
|
|
? (isFlat ? getAllKeysIn : getAllKeys) |
|
|
: (isFlat ? keysIn : keys); |
|
|
|
|
|
var props = isArr ? undefined : keysFunc(value); |
|
|
arrayEach(props || value, function(subValue, key) { |
|
|
if (props) { |
|
|
key = subValue; |
|
|
subValue = value[key]; |
|
|
} |
|
|
// Recursively populate clone (susceptible to call stack limits). |
|
|
assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack)); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.delay` and `_.defer` which accepts `args` |
|
|
* to provide to `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to delay. |
|
|
* @param {number} wait The number of milliseconds to delay invocation. |
|
|
* @param {Array} args The arguments to provide to `func`. |
|
|
* @returns {number|Object} Returns the timer id or timeout object. |
|
|
*/ |
|
|
function baseDelay(func, wait, args) { |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
return setTimeout(function() { func.apply(undefined, args); }, wait); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.difference` without support |
|
|
* for excluding multiple arrays or iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Array} values The values to exclude. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
*/ |
|
|
function baseDifference(array, values, iteratee, comparator) { |
|
|
var index = -1, |
|
|
includes = arrayIncludes, |
|
|
isCommon = true, |
|
|
length = array.length, |
|
|
result = [], |
|
|
valuesLength = values.length; |
|
|
|
|
|
if (!length) { |
|
|
return result; |
|
|
} |
|
|
if (iteratee) { |
|
|
values = arrayMap(values, baseUnary(iteratee)); |
|
|
} |
|
|
if (comparator) { |
|
|
includes = arrayIncludesWith; |
|
|
isCommon = false; |
|
|
} |
|
|
else if (values.length >= LARGE_ARRAY_SIZE) { |
|
|
includes = cacheHas; |
|
|
isCommon = false; |
|
|
values = new SetCache(values); |
|
|
} |
|
|
outer: |
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
computed = iteratee == null ? value : iteratee(value); |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (isCommon && computed === computed) { |
|
|
var valuesIndex = valuesLength; |
|
|
while (valuesIndex--) { |
|
|
if (values[valuesIndex] === computed) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
else if (!includes(values, computed, comparator)) { |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forEach` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array|Object} Returns `collection`. |
|
|
*/ |
|
|
var baseEach = createBaseEach(baseForOwn); |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.every` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false` |
|
|
*/ |
|
|
function baseEvery(collection, predicate) { |
|
|
var result = true; |
|
|
baseEach(collection, function(value, index, collection) { |
|
|
result = !!predicate(value, index, collection); |
|
|
return result; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.max` and `_.min` which accepts a |
|
|
* `comparator` to determine the extremum value. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @param {Function} iteratee The iteratee invoked per iteration. |
|
|
* @param {Function} comparator The comparator used to compare values. |
|
|
* @returns {*} Returns the extremum value. |
|
|
*/ |
|
|
function baseExtremum(array, iteratee, comparator) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
current = iteratee(value); |
|
|
|
|
|
if (current != null && (computed === undefined |
|
|
? (current === current && !isSymbol(current)) |
|
|
: comparator(current, computed) |
|
|
)) { |
|
|
var computed = current, |
|
|
result = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.filter` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
*/ |
|
|
function baseFilter(collection, predicate) { |
|
|
var result = []; |
|
|
baseEach(collection, function(value, index, collection) { |
|
|
if (predicate(value, index, collection)) { |
|
|
result.push(value); |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.flatten` with support for restricting flattening. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to flatten. |
|
|
* @param {number} depth The maximum recursion depth. |
|
|
* @param {boolean} [predicate=isFlattenable] The function invoked per iteration. |
|
|
* @param {boolean} [isStrict] Restrict to values that pass `predicate` checks. |
|
|
* @param {Array} [result=[]] The initial result value. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
*/ |
|
|
function baseFlatten(array, depth, predicate, isStrict, result) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
predicate || (predicate = isFlattenable); |
|
|
result || (result = []); |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (depth > 0 && predicate(value)) { |
|
|
if (depth > 1) { |
|
|
// Recursively flatten arrays (susceptible to call stack limits). |
|
|
baseFlatten(value, depth - 1, predicate, isStrict, result); |
|
|
} else { |
|
|
arrayPush(result, value); |
|
|
} |
|
|
} else if (!isStrict) { |
|
|
result[result.length] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `baseForOwn` which iterates over `object` |
|
|
* properties returned by `keysFunc` and invokes `iteratee` for each property. |
|
|
* Iteratee functions may exit iteration early by explicitly returning `false`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
var baseFor = createBaseFor(); |
|
|
|
|
|
/** |
|
|
* This function is like `baseFor` except that it iterates over properties |
|
|
* in the opposite order. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
var baseForRight = createBaseFor(true); |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forOwn` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseForOwn(object, iteratee) { |
|
|
return object && baseFor(object, iteratee, keys); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forOwnRight` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseForOwnRight(object, iteratee) { |
|
|
return object && baseForRight(object, iteratee, keys); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.functions` which creates an array of |
|
|
* `object` function property names filtered from `props`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Array} props The property names to filter. |
|
|
* @returns {Array} Returns the function names. |
|
|
*/ |
|
|
function baseFunctions(object, props) { |
|
|
return arrayFilter(props, function(key) { |
|
|
return isFunction(object[key]); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.get` without support for default values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {*} Returns the resolved value. |
|
|
*/ |
|
|
function baseGet(object, path) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = 0, |
|
|
length = path.length; |
|
|
|
|
|
while (object != null && index < length) { |
|
|
object = object[toKey(path[index++])]; |
|
|
} |
|
|
return (index && index == length) ? object : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `getAllKeys` and `getAllKeysIn` which uses |
|
|
* `keysFunc` and `symbolsFunc` to get the enumerable property names and |
|
|
* symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @param {Function} symbolsFunc The function to get the symbols of `object`. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function baseGetAllKeys(object, keysFunc, symbolsFunc) { |
|
|
var result = keysFunc(object); |
|
|
return isArray(object) ? result : arrayPush(result, symbolsFunc(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `getTag` without fallbacks for buggy environments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the `toStringTag`. |
|
|
*/ |
|
|
function baseGetTag(value) { |
|
|
if (value == null) { |
|
|
return value === undefined ? undefinedTag : nullTag; |
|
|
} |
|
|
return (symToStringTag && symToStringTag in Object(value)) |
|
|
? getRawTag(value) |
|
|
: objectToString(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.gt` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if `value` is greater than `other`, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseGt(value, other) { |
|
|
return value > other; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.has` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {Array|string} key The key to check. |
|
|
* @returns {boolean} Returns `true` if `key` exists, else `false`. |
|
|
*/ |
|
|
function baseHas(object, key) { |
|
|
return object != null && hasOwnProperty.call(object, key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.hasIn` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {Array|string} key The key to check. |
|
|
* @returns {boolean} Returns `true` if `key` exists, else `false`. |
|
|
*/ |
|
|
function baseHasIn(object, key) { |
|
|
return object != null && key in Object(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.intersection`, without support |
|
|
* for iteratee shorthands, that accepts an array of arrays to inspect. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} arrays The arrays to inspect. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new array of shared values. |
|
|
*/ |
|
|
function baseIntersection(arrays, iteratee, comparator) { |
|
|
var includes = comparator ? arrayIncludesWith : arrayIncludes, |
|
|
length = arrays[0].length, |
|
|
othLength = arrays.length, |
|
|
othIndex = othLength, |
|
|
caches = Array(othLength), |
|
|
maxLength = Infinity, |
|
|
result = []; |
|
|
|
|
|
while (othIndex--) { |
|
|
var array = arrays[othIndex]; |
|
|
if (othIndex && iteratee) { |
|
|
array = arrayMap(array, baseUnary(iteratee)); |
|
|
} |
|
|
maxLength = nativeMin(array.length, maxLength); |
|
|
caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120)) |
|
|
? new SetCache(othIndex && array) |
|
|
: undefined; |
|
|
} |
|
|
array = arrays[0]; |
|
|
|
|
|
var index = -1, |
|
|
seen = caches[0]; |
|
|
|
|
|
outer: |
|
|
while (++index < length && result.length < maxLength) { |
|
|
var value = array[index], |
|
|
computed = iteratee ? iteratee(value) : value; |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (!(seen |
|
|
? cacheHas(seen, computed) |
|
|
: includes(result, computed, comparator) |
|
|
)) { |
|
|
othIndex = othLength; |
|
|
while (--othIndex) { |
|
|
var cache = caches[othIndex]; |
|
|
if (!(cache |
|
|
? cacheHas(cache, computed) |
|
|
: includes(arrays[othIndex], computed, comparator)) |
|
|
) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
if (seen) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.invert` and `_.invertBy` which inverts |
|
|
* `object` with values transformed by `iteratee` and set by `setter`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform values. |
|
|
* @param {Object} accumulator The initial inverted object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function baseInverter(object, setter, iteratee, accumulator) { |
|
|
baseForOwn(object, function(value, key, object) { |
|
|
setter(accumulator, iteratee(value), key, object); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.invoke` without support for individual |
|
|
* method arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the method to invoke. |
|
|
* @param {Array} args The arguments to invoke the method with. |
|
|
* @returns {*} Returns the result of the invoked method. |
|
|
*/ |
|
|
function baseInvoke(object, path, args) { |
|
|
path = castPath(path, object); |
|
|
object = parent(object, path); |
|
|
var func = object == null ? object : object[toKey(last(path))]; |
|
|
return func == null ? undefined : apply(func, object, args); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isArguments`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an `arguments` object, |
|
|
*/ |
|
|
function baseIsArguments(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == argsTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isDate` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a date object, else `false`. |
|
|
*/ |
|
|
function baseIsDate(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == dateTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isEqual` which supports partial comparisons |
|
|
* and tracks traversed objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @param {boolean} bitmask The bitmask flags. |
|
|
* 1 - Unordered comparison |
|
|
* 2 - Partial comparison |
|
|
* @param {Function} [customizer] The function to customize comparisons. |
|
|
* @param {Object} [stack] Tracks traversed `value` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
*/ |
|
|
function baseIsEqual(value, other, bitmask, customizer, stack) { |
|
|
if (value === other) { |
|
|
return true; |
|
|
} |
|
|
if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) { |
|
|
return value !== value && other !== other; |
|
|
} |
|
|
return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqual` for arrays and objects which performs |
|
|
* deep comparisons and tracks traversed objects enabling objects with circular |
|
|
* references to be compared. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} [stack] Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) { |
|
|
var objIsArr = isArray(object), |
|
|
othIsArr = isArray(other), |
|
|
objTag = objIsArr ? arrayTag : getTag(object), |
|
|
othTag = othIsArr ? arrayTag : getTag(other); |
|
|
|
|
|
objTag = objTag == argsTag ? objectTag : objTag; |
|
|
othTag = othTag == argsTag ? objectTag : othTag; |
|
|
|
|
|
var objIsObj = objTag == objectTag, |
|
|
othIsObj = othTag == objectTag, |
|
|
isSameTag = objTag == othTag; |
|
|
|
|
|
if (isSameTag && isBuffer(object)) { |
|
|
if (!isBuffer(other)) { |
|
|
return false; |
|
|
} |
|
|
objIsArr = true; |
|
|
objIsObj = false; |
|
|
} |
|
|
if (isSameTag && !objIsObj) { |
|
|
stack || (stack = new Stack); |
|
|
return (objIsArr || isTypedArray(object)) |
|
|
? equalArrays(object, other, bitmask, customizer, equalFunc, stack) |
|
|
: equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack); |
|
|
} |
|
|
if (!(bitmask & COMPARE_PARTIAL_FLAG)) { |
|
|
var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'), |
|
|
othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__'); |
|
|
|
|
|
if (objIsWrapped || othIsWrapped) { |
|
|
var objUnwrapped = objIsWrapped ? object.value() : object, |
|
|
othUnwrapped = othIsWrapped ? other.value() : other; |
|
|
|
|
|
stack || (stack = new Stack); |
|
|
return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack); |
|
|
} |
|
|
} |
|
|
if (!isSameTag) { |
|
|
return false; |
|
|
} |
|
|
stack || (stack = new Stack); |
|
|
return equalObjects(object, other, bitmask, customizer, equalFunc, stack); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isMap` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a map, else `false`. |
|
|
*/ |
|
|
function baseIsMap(value) { |
|
|
return isObjectLike(value) && getTag(value) == mapTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isMatch` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @param {Array} matchData The property names, values, and compare flags to match. |
|
|
* @param {Function} [customizer] The function to customize comparisons. |
|
|
* @returns {boolean} Returns `true` if `object` is a match, else `false`. |
|
|
*/ |
|
|
function baseIsMatch(object, source, matchData, customizer) { |
|
|
var index = matchData.length, |
|
|
length = index, |
|
|
noCustomizer = !customizer; |
|
|
|
|
|
if (object == null) { |
|
|
return !length; |
|
|
} |
|
|
object = Object(object); |
|
|
while (index--) { |
|
|
var data = matchData[index]; |
|
|
if ((noCustomizer && data[2]) |
|
|
? data[1] !== object[data[0]] |
|
|
: !(data[0] in object) |
|
|
) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
while (++index < length) { |
|
|
data = matchData[index]; |
|
|
var key = data[0], |
|
|
objValue = object[key], |
|
|
srcValue = data[1]; |
|
|
|
|
|
if (noCustomizer && data[2]) { |
|
|
if (objValue === undefined && !(key in object)) { |
|
|
return false; |
|
|
} |
|
|
} else { |
|
|
var stack = new Stack; |
|
|
if (customizer) { |
|
|
var result = customizer(objValue, srcValue, key, object, source, stack); |
|
|
} |
|
|
if (!(result === undefined |
|
|
? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack) |
|
|
: result |
|
|
)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isNative` without bad shim checks. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a native function, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseIsNative(value) { |
|
|
if (!isObject(value) || isMasked(value)) { |
|
|
return false; |
|
|
} |
|
|
var pattern = isFunction(value) ? reIsNative : reIsHostCtor; |
|
|
return pattern.test(toSource(value)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isRegExp` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a regexp, else `false`. |
|
|
*/ |
|
|
function baseIsRegExp(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == regexpTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isSet` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a set, else `false`. |
|
|
*/ |
|
|
function baseIsSet(value) { |
|
|
return isObjectLike(value) && getTag(value) == setTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isTypedArray` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a typed array, else `false`. |
|
|
*/ |
|
|
function baseIsTypedArray(value) { |
|
|
return isObjectLike(value) && |
|
|
isLength(value.length) && !!typedArrayTags[baseGetTag(value)]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.iteratee`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} [value=_.identity] The value to convert to an iteratee. |
|
|
* @returns {Function} Returns the iteratee. |
|
|
*/ |
|
|
function baseIteratee(value) { |
|
|
// Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9. |
|
|
// See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details. |
|
|
if (typeof value == 'function') { |
|
|
return value; |
|
|
} |
|
|
if (value == null) { |
|
|
return identity; |
|
|
} |
|
|
if (typeof value == 'object') { |
|
|
return isArray(value) |
|
|
? baseMatchesProperty(value[0], value[1]) |
|
|
: baseMatches(value); |
|
|
} |
|
|
return property(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.keys` which doesn't treat sparse arrays as dense. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function baseKeys(object) { |
|
|
if (!isPrototype(object)) { |
|
|
return nativeKeys(object); |
|
|
} |
|
|
var result = []; |
|
|
for (var key in Object(object)) { |
|
|
if (hasOwnProperty.call(object, key) && key != 'constructor') { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function baseKeysIn(object) { |
|
|
if (!isObject(object)) { |
|
|
return nativeKeysIn(object); |
|
|
} |
|
|
var isProto = isPrototype(object), |
|
|
result = []; |
|
|
|
|
|
for (var key in object) { |
|
|
if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.lt` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if `value` is less than `other`, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseLt(value, other) { |
|
|
return value < other; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.map` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
*/ |
|
|
function baseMap(collection, iteratee) { |
|
|
var index = -1, |
|
|
result = isArrayLike(collection) ? Array(collection.length) : []; |
|
|
|
|
|
baseEach(collection, function(value, key, collection) { |
|
|
result[++index] = iteratee(value, key, collection); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.matches` which doesn't clone `source`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function baseMatches(source) { |
|
|
var matchData = getMatchData(source); |
|
|
if (matchData.length == 1 && matchData[0][2]) { |
|
|
return matchesStrictComparable(matchData[0][0], matchData[0][1]); |
|
|
} |
|
|
return function(object) { |
|
|
return object === source || baseIsMatch(object, source, matchData); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.matchesProperty` which doesn't clone `srcValue`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} path The path of the property to get. |
|
|
* @param {*} srcValue The value to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function baseMatchesProperty(path, srcValue) { |
|
|
if (isKey(path) && isStrictComparable(srcValue)) { |
|
|
return matchesStrictComparable(toKey(path), srcValue); |
|
|
} |
|
|
return function(object) { |
|
|
var objValue = get(object, path); |
|
|
return (objValue === undefined && objValue === srcValue) |
|
|
? hasIn(object, path) |
|
|
: baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.orderBy` without param guards. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by. |
|
|
* @param {string[]} orders The sort orders of `iteratees`. |
|
|
* @returns {Array} Returns the new sorted array. |
|
|
*/ |
|
|
function baseOrderBy(collection, iteratees, orders) { |
|
|
var index = -1; |
|
|
iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee)); |
|
|
|
|
|
var result = baseMap(collection, function(value, key, collection) { |
|
|
var criteria = arrayMap(iteratees, function(iteratee) { |
|
|
return iteratee(value); |
|
|
}); |
|
|
return { 'criteria': criteria, 'index': ++index, 'value': value }; |
|
|
}); |
|
|
|
|
|
return baseSortBy(result, function(object, other) { |
|
|
return compareMultiple(object, other, orders); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.pick` without support for individual |
|
|
* property identifiers. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The source object. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function basePick(object, paths) { |
|
|
return basePickBy(object, paths, function(value, path) { |
|
|
return hasIn(object, path); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.pickBy` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The source object. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @param {Function} predicate The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function basePickBy(object, paths, predicate) { |
|
|
var index = -1, |
|
|
length = paths.length, |
|
|
result = {}; |
|
|
|
|
|
while (++index < length) { |
|
|
var path = paths[index], |
|
|
value = baseGet(object, path); |
|
|
|
|
|
if (predicate(value, path)) { |
|
|
baseSet(result, castPath(path, object), value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseProperty` which supports deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function basePropertyDeep(path) { |
|
|
return function(object) { |
|
|
return baseGet(object, path); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.random` without support for returning |
|
|
* floating-point numbers. |
|
|
* |
|
|
* @private |
|
|
* @param {number} lower The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the random number. |
|
|
*/ |
|
|
function baseRandom(lower, upper) { |
|
|
return lower + nativeFloor(nativeRandom() * (upper - lower + 1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.range` and `_.rangeRight` which doesn't |
|
|
* coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {number} start The start of the range. |
|
|
* @param {number} end The end of the range. |
|
|
* @param {number} step The value to increment or decrement by. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Array} Returns the range of numbers. |
|
|
*/ |
|
|
function baseRange(start, end, step, fromRight) { |
|
|
var index = -1, |
|
|
length = nativeMax(nativeCeil((end - start) / (step || 1)), 0), |
|
|
result = Array(length); |
|
|
|
|
|
while (length--) { |
|
|
result[fromRight ? length : ++index] = start; |
|
|
start += step; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.rest` which doesn't validate or coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function baseRest(func, start) { |
|
|
return setToString(overRest(func, start, identity), func + ''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.set`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {Array|string} path The path of the property to set. |
|
|
* @param {*} value The value to set. |
|
|
* @param {Function} [customizer] The function to customize path creation. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseSet(object, path, value, customizer) { |
|
|
if (!isObject(object)) { |
|
|
return object; |
|
|
} |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length, |
|
|
lastIndex = length - 1, |
|
|
nested = object; |
|
|
|
|
|
while (nested != null && ++index < length) { |
|
|
var key = toKey(path[index]), |
|
|
newValue = value; |
|
|
|
|
|
if (index != lastIndex) { |
|
|
var objValue = nested[key]; |
|
|
newValue = customizer ? customizer(objValue, key, nested) : undefined; |
|
|
if (newValue === undefined) { |
|
|
newValue = isObject(objValue) |
|
|
? objValue |
|
|
: (isIndex(path[index + 1]) ? [] : {}); |
|
|
} |
|
|
} |
|
|
assignValue(nested, key, newValue); |
|
|
nested = nested[key]; |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `setData` without support for hot loop shorting. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to associate metadata with. |
|
|
* @param {*} data The metadata. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var baseSetData = !metaMap ? identity : function(func, data) { |
|
|
metaMap.set(func, data); |
|
|
return func; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* The base implementation of `setToString` without support for hot loop shorting. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to modify. |
|
|
* @param {Function} string The `toString` result. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var baseSetToString = !defineProperty ? identity : function(func, string) { |
|
|
return defineProperty(func, 'toString', { |
|
|
'configurable': true, |
|
|
'enumerable': false, |
|
|
'value': constant(string), |
|
|
'writable': true |
|
|
}); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.slice` without an iteratee call guard. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to slice. |
|
|
* @param {number} [start=0] The start position. |
|
|
* @param {number} [end=array.length] The end position. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
*/ |
|
|
function baseSlice(array, start, end) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
if (start < 0) { |
|
|
start = -start > length ? 0 : (length + start); |
|
|
} |
|
|
end = end > length ? length : end; |
|
|
if (end < 0) { |
|
|
end += length; |
|
|
} |
|
|
length = start > end ? 0 : ((end - start) >>> 0); |
|
|
start >>>= 0; |
|
|
|
|
|
var result = Array(length); |
|
|
while (++index < length) { |
|
|
result[index] = array[index + start]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.some` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseSome(collection, predicate) { |
|
|
var result; |
|
|
|
|
|
baseEach(collection, function(value, index, collection) { |
|
|
result = predicate(value, index, collection); |
|
|
return !result; |
|
|
}); |
|
|
return !!result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.toString` which doesn't convert nullish |
|
|
* values to empty strings. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to process. |
|
|
* @returns {string} Returns the string. |
|
|
*/ |
|
|
function baseToString(value) { |
|
|
// Exit early for strings to avoid a performance hit in some environments. |
|
|
if (typeof value == 'string') { |
|
|
return value; |
|
|
} |
|
|
if (isArray(value)) { |
|
|
// Recursively convert values (susceptible to call stack limits). |
|
|
return arrayMap(value, baseToString) + ''; |
|
|
} |
|
|
if (isSymbol(value)) { |
|
|
return symbolToString ? symbolToString.call(value) : ''; |
|
|
} |
|
|
var result = (value + ''); |
|
|
return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.uniqBy` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
*/ |
|
|
function baseUniq(array, iteratee, comparator) { |
|
|
var index = -1, |
|
|
includes = arrayIncludes, |
|
|
length = array.length, |
|
|
isCommon = true, |
|
|
result = [], |
|
|
seen = result; |
|
|
|
|
|
if (comparator) { |
|
|
isCommon = false; |
|
|
includes = arrayIncludesWith; |
|
|
} |
|
|
else if (length >= LARGE_ARRAY_SIZE) { |
|
|
var set = iteratee ? null : createSet(array); |
|
|
if (set) { |
|
|
return setToArray(set); |
|
|
} |
|
|
isCommon = false; |
|
|
includes = cacheHas; |
|
|
seen = new SetCache; |
|
|
} |
|
|
else { |
|
|
seen = iteratee ? [] : result; |
|
|
} |
|
|
outer: |
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
computed = iteratee ? iteratee(value) : value; |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (isCommon && computed === computed) { |
|
|
var seenIndex = seen.length; |
|
|
while (seenIndex--) { |
|
|
if (seen[seenIndex] === computed) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
if (iteratee) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
else if (!includes(seen, computed, comparator)) { |
|
|
if (seen !== result) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.unset`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {Array|string} path The property path to unset. |
|
|
* @returns {boolean} Returns `true` if the property is deleted, else `false`. |
|
|
*/ |
|
|
function baseUnset(object, path) { |
|
|
path = castPath(path, object); |
|
|
object = parent(object, path); |
|
|
return object == null || delete object[toKey(last(path))]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `wrapperValue` which returns the result of |
|
|
* performing a sequence of actions on the unwrapped `value`, where each |
|
|
* successive action is supplied the return value of the previous. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The unwrapped value. |
|
|
* @param {Array} actions Actions to perform to resolve the unwrapped value. |
|
|
* @returns {*} Returns the resolved value. |
|
|
*/ |
|
|
function baseWrapperValue(value, actions) { |
|
|
var result = value; |
|
|
if (result instanceof LazyWrapper) { |
|
|
result = result.value(); |
|
|
} |
|
|
return arrayReduce(actions, function(result, action) { |
|
|
return action.func.apply(action.thisArg, arrayPush([result], action.args)); |
|
|
}, result); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This base implementation of `_.zipObject` which assigns values using `assignFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} props The property identifiers. |
|
|
* @param {Array} values The property values. |
|
|
* @param {Function} assignFunc The function to assign values. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function baseZipObject(props, values, assignFunc) { |
|
|
var index = -1, |
|
|
length = props.length, |
|
|
valsLength = values.length, |
|
|
result = {}; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = index < valsLength ? values[index] : undefined; |
|
|
assignFunc(result, props[index], value); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Casts `value` to an empty array if it's not an array like object. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @returns {Array|Object} Returns the cast array-like object. |
|
|
*/ |
|
|
function castArrayLikeObject(value) { |
|
|
return isArrayLikeObject(value) ? value : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Casts `value` to a path array if it's not one. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @param {Object} [object] The object to query keys on. |
|
|
* @returns {Array} Returns the cast property path array. |
|
|
*/ |
|
|
function castPath(value, object) { |
|
|
if (isArray(value)) { |
|
|
return value; |
|
|
} |
|
|
return isKey(value, object) ? [value] : stringToPath(toString(value)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `buffer`. |
|
|
* |
|
|
* @private |
|
|
* @param {Buffer} buffer The buffer to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Buffer} Returns the cloned buffer. |
|
|
*/ |
|
|
function cloneBuffer(buffer, isDeep) { |
|
|
if (isDeep) { |
|
|
return buffer.slice(); |
|
|
} |
|
|
var length = buffer.length, |
|
|
result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length); |
|
|
|
|
|
buffer.copy(result); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `arrayBuffer`. |
|
|
* |
|
|
* @private |
|
|
* @param {ArrayBuffer} arrayBuffer The array buffer to clone. |
|
|
* @returns {ArrayBuffer} Returns the cloned array buffer. |
|
|
*/ |
|
|
function cloneArrayBuffer(arrayBuffer) { |
|
|
var result = new arrayBuffer.constructor(arrayBuffer.byteLength); |
|
|
new Uint8Array(result).set(new Uint8Array(arrayBuffer)); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `dataView`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} dataView The data view to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the cloned data view. |
|
|
*/ |
|
|
function cloneDataView(dataView, isDeep) { |
|
|
var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer; |
|
|
return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `regexp`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} regexp The regexp to clone. |
|
|
* @returns {Object} Returns the cloned regexp. |
|
|
*/ |
|
|
function cloneRegExp(regexp) { |
|
|
var result = new regexp.constructor(regexp.source, reFlags.exec(regexp)); |
|
|
result.lastIndex = regexp.lastIndex; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the `symbol` object. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} symbol The symbol object to clone. |
|
|
* @returns {Object} Returns the cloned symbol object. |
|
|
*/ |
|
|
function cloneSymbol(symbol) { |
|
|
return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `typedArray`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} typedArray The typed array to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the cloned typed array. |
|
|
*/ |
|
|
function cloneTypedArray(typedArray, isDeep) { |
|
|
var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer; |
|
|
return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Compares values to sort them in ascending order. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {number} Returns the sort order indicator for `value`. |
|
|
*/ |
|
|
function compareAscending(value, other) { |
|
|
if (value !== other) { |
|
|
var valIsDefined = value !== undefined, |
|
|
valIsNull = value === null, |
|
|
valIsReflexive = value === value, |
|
|
valIsSymbol = isSymbol(value); |
|
|
|
|
|
var othIsDefined = other !== undefined, |
|
|
othIsNull = other === null, |
|
|
othIsReflexive = other === other, |
|
|
othIsSymbol = isSymbol(other); |
|
|
|
|
|
if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) || |
|
|
(valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) || |
|
|
(valIsNull && othIsDefined && othIsReflexive) || |
|
|
(!valIsDefined && othIsReflexive) || |
|
|
!valIsReflexive) { |
|
|
return 1; |
|
|
} |
|
|
if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) || |
|
|
(othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) || |
|
|
(othIsNull && valIsDefined && valIsReflexive) || |
|
|
(!othIsDefined && valIsReflexive) || |
|
|
!othIsReflexive) { |
|
|
return -1; |
|
|
} |
|
|
} |
|
|
return 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.orderBy` to compare multiple properties of a value to another |
|
|
* and stable sort them. |
|
|
* |
|
|
* If `orders` is unspecified, all values are sorted in ascending order. Otherwise, |
|
|
* specify an order of "desc" for descending or "asc" for ascending sort order |
|
|
* of corresponding values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {boolean[]|string[]} orders The order to sort by for each property. |
|
|
* @returns {number} Returns the sort order indicator for `object`. |
|
|
*/ |
|
|
function compareMultiple(object, other, orders) { |
|
|
var index = -1, |
|
|
objCriteria = object.criteria, |
|
|
othCriteria = other.criteria, |
|
|
length = objCriteria.length, |
|
|
ordersLength = orders.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var result = compareAscending(objCriteria[index], othCriteria[index]); |
|
|
if (result) { |
|
|
if (index >= ordersLength) { |
|
|
return result; |
|
|
} |
|
|
var order = orders[index]; |
|
|
return result * (order == 'desc' ? -1 : 1); |
|
|
} |
|
|
} |
|
|
// Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications |
|
|
// that causes it, under certain circumstances, to provide the same value for |
|
|
// `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247 |
|
|
// for more details. |
|
|
// |
|
|
// This also ensures a stable sort in V8 and other engines. |
|
|
// See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details. |
|
|
return object.index - other.index; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array that is the composition of partially applied arguments, |
|
|
* placeholders, and provided arguments into a single array of arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} args The provided arguments. |
|
|
* @param {Array} partials The arguments to prepend to those provided. |
|
|
* @param {Array} holders The `partials` placeholder indexes. |
|
|
* @params {boolean} [isCurried] Specify composing for a curried function. |
|
|
* @returns {Array} Returns the new array of composed arguments. |
|
|
*/ |
|
|
function composeArgs(args, partials, holders, isCurried) { |
|
|
var argsIndex = -1, |
|
|
argsLength = args.length, |
|
|
holdersLength = holders.length, |
|
|
leftIndex = -1, |
|
|
leftLength = partials.length, |
|
|
rangeLength = nativeMax(argsLength - holdersLength, 0), |
|
|
result = Array(leftLength + rangeLength), |
|
|
isUncurried = !isCurried; |
|
|
|
|
|
while (++leftIndex < leftLength) { |
|
|
result[leftIndex] = partials[leftIndex]; |
|
|
} |
|
|
while (++argsIndex < holdersLength) { |
|
|
if (isUncurried || argsIndex < argsLength) { |
|
|
result[holders[argsIndex]] = args[argsIndex]; |
|
|
} |
|
|
} |
|
|
while (rangeLength--) { |
|
|
result[leftIndex++] = args[argsIndex++]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like `composeArgs` except that the arguments composition |
|
|
* is tailored for `_.partialRight`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} args The provided arguments. |
|
|
* @param {Array} partials The arguments to append to those provided. |
|
|
* @param {Array} holders The `partials` placeholder indexes. |
|
|
* @params {boolean} [isCurried] Specify composing for a curried function. |
|
|
* @returns {Array} Returns the new array of composed arguments. |
|
|
*/ |
|
|
function composeArgsRight(args, partials, holders, isCurried) { |
|
|
var argsIndex = -1, |
|
|
argsLength = args.length, |
|
|
holdersIndex = -1, |
|
|
holdersLength = holders.length, |
|
|
rightIndex = -1, |
|
|
rightLength = partials.length, |
|
|
rangeLength = nativeMax(argsLength - holdersLength, 0), |
|
|
result = Array(rangeLength + rightLength), |
|
|
isUncurried = !isCurried; |
|
|
|
|
|
while (++argsIndex < rangeLength) { |
|
|
result[argsIndex] = args[argsIndex]; |
|
|
} |
|
|
var offset = argsIndex; |
|
|
while (++rightIndex < rightLength) { |
|
|
result[offset + rightIndex] = partials[rightIndex]; |
|
|
} |
|
|
while (++holdersIndex < holdersLength) { |
|
|
if (isUncurried || argsIndex < argsLength) { |
|
|
result[offset + holders[holdersIndex]] = args[argsIndex++]; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies the values of `source` to `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} source The array to copy values from. |
|
|
* @param {Array} [array=[]] The array to copy values to. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function copyArray(source, array) { |
|
|
var index = -1, |
|
|
length = source.length; |
|
|
|
|
|
array || (array = Array(length)); |
|
|
while (++index < length) { |
|
|
array[index] = source[index]; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies properties of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy properties from. |
|
|
* @param {Array} props The property identifiers to copy. |
|
|
* @param {Object} [object={}] The object to copy properties to. |
|
|
* @param {Function} [customizer] The function to customize copied values. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copyObject(source, props, object, customizer) { |
|
|
var isNew = !object; |
|
|
object || (object = {}); |
|
|
|
|
|
var index = -1, |
|
|
length = props.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var key = props[index]; |
|
|
|
|
|
var newValue = customizer |
|
|
? customizer(object[key], source[key], key, object, source) |
|
|
: undefined; |
|
|
|
|
|
if (newValue === undefined) { |
|
|
newValue = source[key]; |
|
|
} |
|
|
if (isNew) { |
|
|
baseAssignValue(object, key, newValue); |
|
|
} else { |
|
|
assignValue(object, key, newValue); |
|
|
} |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies own symbols of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy symbols from. |
|
|
* @param {Object} [object={}] The object to copy symbols to. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copySymbols(source, object) { |
|
|
return copyObject(source, getSymbols(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies own and inherited symbols of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy symbols from. |
|
|
* @param {Object} [object={}] The object to copy symbols to. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copySymbolsIn(source, object) { |
|
|
return copyObject(source, getSymbolsIn(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.groupBy`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} setter The function to set accumulator values. |
|
|
* @param {Function} [initializer] The accumulator object initializer. |
|
|
* @returns {Function} Returns the new aggregator function. |
|
|
*/ |
|
|
function createAggregator(setter, initializer) { |
|
|
return function(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayAggregator : baseAggregator, |
|
|
accumulator = initializer ? initializer() : {}; |
|
|
|
|
|
return func(collection, setter, baseIteratee(iteratee, 2), accumulator); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.assign`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} assigner The function to assign values. |
|
|
* @returns {Function} Returns the new assigner function. |
|
|
*/ |
|
|
function createAssigner(assigner) { |
|
|
return baseRest(function(object, sources) { |
|
|
var index = -1, |
|
|
length = sources.length, |
|
|
customizer = length > 1 ? sources[length - 1] : undefined, |
|
|
guard = length > 2 ? sources[2] : undefined; |
|
|
|
|
|
customizer = (assigner.length > 3 && typeof customizer == 'function') |
|
|
? (length--, customizer) |
|
|
: undefined; |
|
|
|
|
|
if (guard && isIterateeCall(sources[0], sources[1], guard)) { |
|
|
customizer = length < 3 ? undefined : customizer; |
|
|
length = 1; |
|
|
} |
|
|
object = Object(object); |
|
|
while (++index < length) { |
|
|
var source = sources[index]; |
|
|
if (source) { |
|
|
assigner(object, source, index, customizer); |
|
|
} |
|
|
} |
|
|
return object; |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `baseEach` or `baseEachRight` function. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} eachFunc The function to iterate over a collection. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new base function. |
|
|
*/ |
|
|
function createBaseEach(eachFunc, fromRight) { |
|
|
return function(collection, iteratee) { |
|
|
if (collection == null) { |
|
|
return collection; |
|
|
} |
|
|
if (!isArrayLike(collection)) { |
|
|
return eachFunc(collection, iteratee); |
|
|
} |
|
|
var length = collection.length, |
|
|
index = fromRight ? length : -1, |
|
|
iterable = Object(collection); |
|
|
|
|
|
while ((fromRight ? index-- : ++index < length)) { |
|
|
if (iteratee(iterable[index], index, iterable) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return collection; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a base function for methods like `_.forIn` and `_.forOwn`. |
|
|
* |
|
|
* @private |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new base function. |
|
|
*/ |
|
|
function createBaseFor(fromRight) { |
|
|
return function(object, iteratee, keysFunc) { |
|
|
var index = -1, |
|
|
iterable = Object(object), |
|
|
props = keysFunc(object), |
|
|
length = props.length; |
|
|
|
|
|
while (length--) { |
|
|
var key = props[fromRight ? length : ++index]; |
|
|
if (iteratee(iterable[key], key, iterable) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return object; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with the optional `this` |
|
|
* binding of `thisArg`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createBind(func, bitmask, thisArg) { |
|
|
var isBind = bitmask & WRAP_BIND_FLAG, |
|
|
Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
return fn.apply(isBind ? thisArg : this, arguments); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that produces an instance of `Ctor` regardless of |
|
|
* whether it was invoked as part of a `new` expression or by `call` or `apply`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} Ctor The constructor to wrap. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createCtor(Ctor) { |
|
|
return function() { |
|
|
// Use a `switch` statement to work with class constructors. See |
|
|
// http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist |
|
|
// for more details. |
|
|
var args = arguments; |
|
|
switch (args.length) { |
|
|
case 0: return new Ctor; |
|
|
case 1: return new Ctor(args[0]); |
|
|
case 2: return new Ctor(args[0], args[1]); |
|
|
case 3: return new Ctor(args[0], args[1], args[2]); |
|
|
case 4: return new Ctor(args[0], args[1], args[2], args[3]); |
|
|
case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]); |
|
|
case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
} |
|
|
var thisBinding = baseCreate(Ctor.prototype), |
|
|
result = Ctor.apply(thisBinding, args); |
|
|
|
|
|
// Mimic the constructor's `return` behavior. |
|
|
// See https://es5.github.io/#x13.2.2 for more details. |
|
|
return isObject(result) ? result : thisBinding; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to enable currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {number} arity The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createCurry(func, bitmask, arity) { |
|
|
var Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var length = arguments.length, |
|
|
args = Array(length), |
|
|
index = length, |
|
|
placeholder = getHolder(wrapper); |
|
|
|
|
|
while (index--) { |
|
|
args[index] = arguments[index]; |
|
|
} |
|
|
var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder) |
|
|
? [] |
|
|
: replaceHolders(args, placeholder); |
|
|
|
|
|
length -= holders.length; |
|
|
if (length < arity) { |
|
|
return createRecurry( |
|
|
func, bitmask, createHybrid, wrapper.placeholder, undefined, |
|
|
args, holders, undefined, undefined, arity - length); |
|
|
} |
|
|
var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
return apply(fn, this, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `_.find` or `_.findLast` function. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} findIndexFunc The function to find the collection index. |
|
|
* @returns {Function} Returns the new find function. |
|
|
*/ |
|
|
function createFind(findIndexFunc) { |
|
|
return function(collection, predicate, fromIndex) { |
|
|
var iterable = Object(collection); |
|
|
if (!isArrayLike(collection)) { |
|
|
var iteratee = baseIteratee(predicate, 3); |
|
|
collection = keys(collection); |
|
|
predicate = function(key) { return iteratee(iterable[key], key, iterable); }; |
|
|
} |
|
|
var index = findIndexFunc(collection, predicate, fromIndex); |
|
|
return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with optional `this` |
|
|
* binding of `thisArg`, partial application, and currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function|string} func The function or method name to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [partialsRight] The arguments to append to those provided |
|
|
* to the new function. |
|
|
* @param {Array} [holdersRight] The `partialsRight` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) { |
|
|
var isAry = bitmask & WRAP_ARY_FLAG, |
|
|
isBind = bitmask & WRAP_BIND_FLAG, |
|
|
isBindKey = bitmask & WRAP_BIND_KEY_FLAG, |
|
|
isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG), |
|
|
isFlip = bitmask & WRAP_FLIP_FLAG, |
|
|
Ctor = isBindKey ? undefined : createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var length = arguments.length, |
|
|
args = Array(length), |
|
|
index = length; |
|
|
|
|
|
while (index--) { |
|
|
args[index] = arguments[index]; |
|
|
} |
|
|
if (isCurried) { |
|
|
var placeholder = getHolder(wrapper), |
|
|
holdersCount = countHolders(args, placeholder); |
|
|
} |
|
|
if (partials) { |
|
|
args = composeArgs(args, partials, holders, isCurried); |
|
|
} |
|
|
if (partialsRight) { |
|
|
args = composeArgsRight(args, partialsRight, holdersRight, isCurried); |
|
|
} |
|
|
length -= holdersCount; |
|
|
if (isCurried && length < arity) { |
|
|
var newHolders = replaceHolders(args, placeholder); |
|
|
return createRecurry( |
|
|
func, bitmask, createHybrid, wrapper.placeholder, thisArg, |
|
|
args, newHolders, argPos, ary, arity - length |
|
|
); |
|
|
} |
|
|
var thisBinding = isBind ? thisArg : this, |
|
|
fn = isBindKey ? thisBinding[func] : func; |
|
|
|
|
|
length = args.length; |
|
|
if (argPos) { |
|
|
args = reorder(args, argPos); |
|
|
} else if (isFlip && length > 1) { |
|
|
args.reverse(); |
|
|
} |
|
|
if (isAry && ary < length) { |
|
|
args.length = ary; |
|
|
} |
|
|
if (this && this !== root && this instanceof wrapper) { |
|
|
fn = Ctor || createCtor(fn); |
|
|
} |
|
|
return fn.apply(thisBinding, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.invertBy`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} setter The function to set accumulator values. |
|
|
* @param {Function} toIteratee The function to resolve iteratees. |
|
|
* @returns {Function} Returns the new inverter function. |
|
|
*/ |
|
|
function createInverter(setter, toIteratee) { |
|
|
return function(object, iteratee) { |
|
|
return baseInverter(object, setter, toIteratee(iteratee), {}); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with the `this` binding |
|
|
* of `thisArg` and `partials` prepended to the arguments it receives. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {Array} partials The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createPartial(func, bitmask, thisArg, partials) { |
|
|
var isBind = bitmask & WRAP_BIND_FLAG, |
|
|
Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var argsIndex = -1, |
|
|
argsLength = arguments.length, |
|
|
leftIndex = -1, |
|
|
leftLength = partials.length, |
|
|
args = Array(leftLength + argsLength), |
|
|
fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
|
|
|
while (++leftIndex < leftLength) { |
|
|
args[leftIndex] = partials[leftIndex]; |
|
|
} |
|
|
while (argsLength--) { |
|
|
args[leftIndex++] = arguments[++argsIndex]; |
|
|
} |
|
|
return apply(fn, isBind ? thisArg : this, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `_.range` or `_.rangeRight` function. |
|
|
* |
|
|
* @private |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new range function. |
|
|
*/ |
|
|
function createRange(fromRight) { |
|
|
return function(start, end, step) { |
|
|
if (step && typeof step != 'number' && isIterateeCall(start, end, step)) { |
|
|
end = step = undefined; |
|
|
} |
|
|
// Ensure the sign of `-0` is preserved. |
|
|
start = toFinite(start); |
|
|
if (end === undefined) { |
|
|
end = start; |
|
|
start = 0; |
|
|
} else { |
|
|
end = toFinite(end); |
|
|
} |
|
|
step = step === undefined ? (start < end ? 1 : -1) : toFinite(step); |
|
|
return baseRange(start, end, step, fromRight); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to continue currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {Function} wrapFunc The function to create the `func` wrapper. |
|
|
* @param {*} placeholder The placeholder value. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) { |
|
|
var isCurry = bitmask & WRAP_CURRY_FLAG, |
|
|
newHolders = isCurry ? holders : undefined, |
|
|
newHoldersRight = isCurry ? undefined : holders, |
|
|
newPartials = isCurry ? partials : undefined, |
|
|
newPartialsRight = isCurry ? undefined : partials; |
|
|
|
|
|
bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG); |
|
|
bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG); |
|
|
|
|
|
if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) { |
|
|
bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG); |
|
|
} |
|
|
var newData = [ |
|
|
func, bitmask, thisArg, newPartials, newHolders, newPartialsRight, |
|
|
newHoldersRight, argPos, ary, arity |
|
|
]; |
|
|
|
|
|
var result = wrapFunc.apply(undefined, newData); |
|
|
if (isLaziable(func)) { |
|
|
setData(result, newData); |
|
|
} |
|
|
result.placeholder = placeholder; |
|
|
return setWrapToString(result, func, bitmask); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a set object of `values`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} values The values to add to the set. |
|
|
* @returns {Object} Returns the new set. |
|
|
*/ |
|
|
var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) { |
|
|
return new Set(values); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Creates a function that either curries or invokes `func` with optional |
|
|
* `this` binding and partially applied arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Function|string} func The function or method name to wrap. |
|
|
* @param {number} bitmask The bitmask flags. |
|
|
* 1 - `_.bind` |
|
|
* 2 - `_.bindKey` |
|
|
* 4 - `_.curry` or `_.curryRight` of a bound function |
|
|
* 8 - `_.curry` |
|
|
* 16 - `_.curryRight` |
|
|
* 32 - `_.partial` |
|
|
* 64 - `_.partialRight` |
|
|
* 128 - `_.rearg` |
|
|
* 256 - `_.ary` |
|
|
* 512 - `_.flip` |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to be partially applied. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) { |
|
|
var isBindKey = bitmask & WRAP_BIND_KEY_FLAG; |
|
|
if (!isBindKey && typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
var length = partials ? partials.length : 0; |
|
|
if (!length) { |
|
|
bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG); |
|
|
partials = holders = undefined; |
|
|
} |
|
|
ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0); |
|
|
arity = arity === undefined ? arity : toInteger(arity); |
|
|
length -= holders ? holders.length : 0; |
|
|
|
|
|
if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) { |
|
|
var partialsRight = partials, |
|
|
holdersRight = holders; |
|
|
|
|
|
partials = holders = undefined; |
|
|
} |
|
|
var data = isBindKey ? undefined : getData(func); |
|
|
|
|
|
var newData = [ |
|
|
func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, |
|
|
argPos, ary, arity |
|
|
]; |
|
|
|
|
|
if (data) { |
|
|
mergeData(newData, data); |
|
|
} |
|
|
func = newData[0]; |
|
|
bitmask = newData[1]; |
|
|
thisArg = newData[2]; |
|
|
partials = newData[3]; |
|
|
holders = newData[4]; |
|
|
arity = newData[9] = newData[9] === undefined |
|
|
? (isBindKey ? 0 : func.length) |
|
|
: nativeMax(newData[9] - length, 0); |
|
|
|
|
|
if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) { |
|
|
bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG); |
|
|
} |
|
|
if (!bitmask || bitmask == WRAP_BIND_FLAG) { |
|
|
var result = createBind(func, bitmask, thisArg); |
|
|
} else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) { |
|
|
result = createCurry(func, bitmask, arity); |
|
|
} else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) { |
|
|
result = createPartial(func, bitmask, thisArg, partials); |
|
|
} else { |
|
|
result = createHybrid.apply(undefined, newData); |
|
|
} |
|
|
var setter = data ? baseSetData : setData; |
|
|
return setWrapToString(setter(result, newData), func, bitmask); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain |
|
|
* objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @param {string} key The key of the property to inspect. |
|
|
* @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`. |
|
|
*/ |
|
|
function customOmitClone(value) { |
|
|
return isPlainObject(value) ? undefined : value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for arrays with support for |
|
|
* partial deep comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to compare. |
|
|
* @param {Array} other The other array to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `array` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the arrays are equivalent, else `false`. |
|
|
*/ |
|
|
function equalArrays(array, other, bitmask, customizer, equalFunc, stack) { |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG, |
|
|
arrLength = array.length, |
|
|
othLength = other.length; |
|
|
|
|
|
if (arrLength != othLength && !(isPartial && othLength > arrLength)) { |
|
|
return false; |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(array); |
|
|
if (stacked && stack.get(other)) { |
|
|
return stacked == other; |
|
|
} |
|
|
var index = -1, |
|
|
result = true, |
|
|
seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined; |
|
|
|
|
|
stack.set(array, other); |
|
|
stack.set(other, array); |
|
|
|
|
|
// Ignore non-index properties. |
|
|
while (++index < arrLength) { |
|
|
var arrValue = array[index], |
|
|
othValue = other[index]; |
|
|
|
|
|
if (customizer) { |
|
|
var compared = isPartial |
|
|
? customizer(othValue, arrValue, index, other, array, stack) |
|
|
: customizer(arrValue, othValue, index, array, other, stack); |
|
|
} |
|
|
if (compared !== undefined) { |
|
|
if (compared) { |
|
|
continue; |
|
|
} |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
// Recursively compare arrays (susceptible to call stack limits). |
|
|
if (seen) { |
|
|
if (!arraySome(other, function(othValue, othIndex) { |
|
|
if (!cacheHas(seen, othIndex) && |
|
|
(arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) { |
|
|
return seen.push(othIndex); |
|
|
} |
|
|
})) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
} else if (!( |
|
|
arrValue === othValue || |
|
|
equalFunc(arrValue, othValue, bitmask, customizer, stack) |
|
|
)) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
} |
|
|
stack['delete'](array); |
|
|
stack['delete'](other); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for comparing objects of |
|
|
* the same `toStringTag`. |
|
|
* |
|
|
* **Note:** This function only supports comparing values with tags of |
|
|
* `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {string} tag The `toStringTag` of the objects to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) { |
|
|
switch (tag) { |
|
|
case dataViewTag: |
|
|
if ((object.byteLength != other.byteLength) || |
|
|
(object.byteOffset != other.byteOffset)) { |
|
|
return false; |
|
|
} |
|
|
object = object.buffer; |
|
|
other = other.buffer; |
|
|
|
|
|
case arrayBufferTag: |
|
|
if ((object.byteLength != other.byteLength) || |
|
|
!equalFunc(new Uint8Array(object), new Uint8Array(other))) { |
|
|
return false; |
|
|
} |
|
|
return true; |
|
|
|
|
|
case boolTag: |
|
|
case dateTag: |
|
|
case numberTag: |
|
|
// Coerce booleans to `1` or `0` and dates to milliseconds. |
|
|
// Invalid dates are coerced to `NaN`. |
|
|
return eq(+object, +other); |
|
|
|
|
|
case errorTag: |
|
|
return object.name == other.name && object.message == other.message; |
|
|
|
|
|
case regexpTag: |
|
|
case stringTag: |
|
|
// Coerce regexes to strings and treat strings, primitives and objects, |
|
|
// as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring |
|
|
// for more details. |
|
|
return object == (other + ''); |
|
|
|
|
|
case mapTag: |
|
|
var convert = mapToArray; |
|
|
|
|
|
case setTag: |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG; |
|
|
convert || (convert = setToArray); |
|
|
|
|
|
if (object.size != other.size && !isPartial) { |
|
|
return false; |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(object); |
|
|
if (stacked) { |
|
|
return stacked == other; |
|
|
} |
|
|
bitmask |= COMPARE_UNORDERED_FLAG; |
|
|
|
|
|
// Recursively compare objects (susceptible to call stack limits). |
|
|
stack.set(object, other); |
|
|
var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack); |
|
|
stack['delete'](object); |
|
|
return result; |
|
|
|
|
|
case symbolTag: |
|
|
if (symbolValueOf) { |
|
|
return symbolValueOf.call(object) == symbolValueOf.call(other); |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for objects with support for |
|
|
* partial deep comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function equalObjects(object, other, bitmask, customizer, equalFunc, stack) { |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG, |
|
|
objProps = getAllKeys(object), |
|
|
objLength = objProps.length, |
|
|
othProps = getAllKeys(other), |
|
|
othLength = othProps.length; |
|
|
|
|
|
if (objLength != othLength && !isPartial) { |
|
|
return false; |
|
|
} |
|
|
var index = objLength; |
|
|
while (index--) { |
|
|
var key = objProps[index]; |
|
|
if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(object); |
|
|
if (stacked && stack.get(other)) { |
|
|
return stacked == other; |
|
|
} |
|
|
var result = true; |
|
|
stack.set(object, other); |
|
|
stack.set(other, object); |
|
|
|
|
|
var skipCtor = isPartial; |
|
|
while (++index < objLength) { |
|
|
key = objProps[index]; |
|
|
var objValue = object[key], |
|
|
othValue = other[key]; |
|
|
|
|
|
if (customizer) { |
|
|
var compared = isPartial |
|
|
? customizer(othValue, objValue, key, other, object, stack) |
|
|
: customizer(objValue, othValue, key, object, other, stack); |
|
|
} |
|
|
// Recursively compare objects (susceptible to call stack limits). |
|
|
if (!(compared === undefined |
|
|
? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack)) |
|
|
: compared |
|
|
)) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
skipCtor || (skipCtor = key == 'constructor'); |
|
|
} |
|
|
if (result && !skipCtor) { |
|
|
var objCtor = object.constructor, |
|
|
othCtor = other.constructor; |
|
|
|
|
|
// Non `Object` object instances with different constructors are not equal. |
|
|
if (objCtor != othCtor && |
|
|
('constructor' in object && 'constructor' in other) && |
|
|
!(typeof objCtor == 'function' && objCtor instanceof objCtor && |
|
|
typeof othCtor == 'function' && othCtor instanceof othCtor)) { |
|
|
result = false; |
|
|
} |
|
|
} |
|
|
stack['delete'](object); |
|
|
stack['delete'](other); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseRest` which flattens the rest array. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function flatRest(func) { |
|
|
return setToString(overRest(func, undefined, flatten), func + ''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of own enumerable property names and symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function getAllKeys(object) { |
|
|
return baseGetAllKeys(object, keys, getSymbols); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of own and inherited enumerable property names and |
|
|
* symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function getAllKeysIn(object) { |
|
|
return baseGetAllKeys(object, keysIn, getSymbolsIn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets metadata for `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to query. |
|
|
* @returns {*} Returns the metadata for `func`. |
|
|
*/ |
|
|
var getData = !metaMap ? noop : function(func) { |
|
|
return metaMap.get(func); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Gets the name of `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to query. |
|
|
* @returns {string} Returns the function name. |
|
|
*/ |
|
|
function getFuncName(func) { |
|
|
var result = (func.name + ''), |
|
|
array = realNames[result], |
|
|
length = hasOwnProperty.call(realNames, result) ? array.length : 0; |
|
|
|
|
|
while (length--) { |
|
|
var data = array[length], |
|
|
otherFunc = data.func; |
|
|
if (otherFunc == null || otherFunc == func) { |
|
|
return data.name; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the argument placeholder value for `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to inspect. |
|
|
* @returns {*} Returns the placeholder value. |
|
|
*/ |
|
|
function getHolder(func) { |
|
|
var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func; |
|
|
return object.placeholder; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the data for `map`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} map The map to query. |
|
|
* @param {string} key The reference key. |
|
|
* @returns {*} Returns the map data. |
|
|
*/ |
|
|
function getMapData(map, key) { |
|
|
var data = map.__data__; |
|
|
return isKeyable(key) |
|
|
? data[typeof key == 'string' ? 'string' : 'hash'] |
|
|
: data.map; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the property names, values, and compare flags of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the match data of `object`. |
|
|
*/ |
|
|
function getMatchData(object) { |
|
|
var result = keys(object), |
|
|
length = result.length; |
|
|
|
|
|
while (length--) { |
|
|
var key = result[length], |
|
|
value = object[key]; |
|
|
|
|
|
result[length] = [key, value, isStrictComparable(value)]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the native function at `key` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {string} key The key of the method to get. |
|
|
* @returns {*} Returns the function if it's native, else `undefined`. |
|
|
*/ |
|
|
function getNative(object, key) { |
|
|
var value = getValue(object, key); |
|
|
return baseIsNative(value) ? value : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the raw `toStringTag`. |
|
|
*/ |
|
|
function getRawTag(value) { |
|
|
var isOwn = hasOwnProperty.call(value, symToStringTag), |
|
|
tag = value[symToStringTag]; |
|
|
|
|
|
try { |
|
|
value[symToStringTag] = undefined; |
|
|
var unmasked = true; |
|
|
} catch (e) {} |
|
|
|
|
|
var result = nativeObjectToString.call(value); |
|
|
if (unmasked) { |
|
|
if (isOwn) { |
|
|
value[symToStringTag] = tag; |
|
|
} else { |
|
|
delete value[symToStringTag]; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of symbols. |
|
|
*/ |
|
|
var getSymbols = !nativeGetSymbols ? stubArray : function(object) { |
|
|
if (object == null) { |
|
|
return []; |
|
|
} |
|
|
object = Object(object); |
|
|
return arrayFilter(nativeGetSymbols(object), function(symbol) { |
|
|
return propertyIsEnumerable.call(object, symbol); |
|
|
}); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Creates an array of the own and inherited enumerable symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of symbols. |
|
|
*/ |
|
|
var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) { |
|
|
var result = []; |
|
|
while (object) { |
|
|
arrayPush(result, getSymbols(object)); |
|
|
object = getPrototype(object); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Gets the `toStringTag` of `value`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the `toStringTag`. |
|
|
*/ |
|
|
var getTag = baseGetTag; |
|
|
|
|
|
// Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6. |
|
|
if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) || |
|
|
(Map && getTag(new Map) != mapTag) || |
|
|
(Promise && getTag(Promise.resolve()) != promiseTag) || |
|
|
(Set && getTag(new Set) != setTag) || |
|
|
(WeakMap && getTag(new WeakMap) != weakMapTag)) { |
|
|
getTag = function(value) { |
|
|
var result = baseGetTag(value), |
|
|
Ctor = result == objectTag ? value.constructor : undefined, |
|
|
ctorString = Ctor ? toSource(Ctor) : ''; |
|
|
|
|
|
if (ctorString) { |
|
|
switch (ctorString) { |
|
|
case dataViewCtorString: return dataViewTag; |
|
|
case mapCtorString: return mapTag; |
|
|
case promiseCtorString: return promiseTag; |
|
|
case setCtorString: return setTag; |
|
|
case weakMapCtorString: return weakMapTag; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the view, applying any `transforms` to the `start` and `end` positions. |
|
|
* |
|
|
* @private |
|
|
* @param {number} start The start of the view. |
|
|
* @param {number} end The end of the view. |
|
|
* @param {Array} transforms The transformations to apply to the view. |
|
|
* @returns {Object} Returns an object containing the `start` and `end` |
|
|
* positions of the view. |
|
|
*/ |
|
|
function getView(start, end, transforms) { |
|
|
var index = -1, |
|
|
length = transforms.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var data = transforms[index], |
|
|
size = data.size; |
|
|
|
|
|
switch (data.type) { |
|
|
case 'drop': start += size; break; |
|
|
case 'dropRight': end -= size; break; |
|
|
case 'take': end = nativeMin(end, start + size); break; |
|
|
case 'takeRight': start = nativeMax(start, end - size); break; |
|
|
} |
|
|
} |
|
|
return { 'start': start, 'end': end }; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Extracts wrapper details from the `source` body comment. |
|
|
* |
|
|
* @private |
|
|
* @param {string} source The source to inspect. |
|
|
* @returns {Array} Returns the wrapper details. |
|
|
*/ |
|
|
function getWrapDetails(source) { |
|
|
var match = source.match(reWrapDetails); |
|
|
return match ? match[1].split(reSplitDetails) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` exists on `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @param {Function} hasFunc The function to check properties. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
*/ |
|
|
function hasPath(object, path, hasFunc) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length, |
|
|
result = false; |
|
|
|
|
|
while (++index < length) { |
|
|
var key = toKey(path[index]); |
|
|
if (!(result = object != null && hasFunc(object, key))) { |
|
|
break; |
|
|
} |
|
|
object = object[key]; |
|
|
} |
|
|
if (result || ++index != length) { |
|
|
return result; |
|
|
} |
|
|
length = object == null ? 0 : object.length; |
|
|
return !!length && isLength(length) && isIndex(key, length) && |
|
|
(isArray(object) || isArguments(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an array clone. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to clone. |
|
|
* @returns {Array} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneArray(array) { |
|
|
var length = array.length, |
|
|
result = new array.constructor(length); |
|
|
|
|
|
// Add properties assigned by `RegExp#exec`. |
|
|
if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) { |
|
|
result.index = array.index; |
|
|
result.input = array.input; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an object clone. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to clone. |
|
|
* @returns {Object} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneObject(object) { |
|
|
return (typeof object.constructor == 'function' && !isPrototype(object)) |
|
|
? baseCreate(getPrototype(object)) |
|
|
: {}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an object clone based on its `toStringTag`. |
|
|
* |
|
|
* **Note:** This function only supports cloning values with tags of |
|
|
* `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to clone. |
|
|
* @param {string} tag The `toStringTag` of the object to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneByTag(object, tag, isDeep) { |
|
|
var Ctor = object.constructor; |
|
|
switch (tag) { |
|
|
case arrayBufferTag: |
|
|
return cloneArrayBuffer(object); |
|
|
|
|
|
case boolTag: |
|
|
case dateTag: |
|
|
return new Ctor(+object); |
|
|
|
|
|
case dataViewTag: |
|
|
return cloneDataView(object, isDeep); |
|
|
|
|
|
case float32Tag: case float64Tag: |
|
|
case int8Tag: case int16Tag: case int32Tag: |
|
|
case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag: |
|
|
return cloneTypedArray(object, isDeep); |
|
|
|
|
|
case mapTag: |
|
|
return new Ctor; |
|
|
|
|
|
case numberTag: |
|
|
case stringTag: |
|
|
return new Ctor(object); |
|
|
|
|
|
case regexpTag: |
|
|
return cloneRegExp(object); |
|
|
|
|
|
case setTag: |
|
|
return new Ctor; |
|
|
|
|
|
case symbolTag: |
|
|
return cloneSymbol(object); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Inserts wrapper `details` in a comment at the top of the `source` body. |
|
|
* |
|
|
* @private |
|
|
* @param {string} source The source to modify. |
|
|
* @returns {Array} details The details to insert. |
|
|
* @returns {string} Returns the modified source. |
|
|
*/ |
|
|
function insertWrapDetails(source, details) { |
|
|
var length = details.length; |
|
|
if (!length) { |
|
|
return source; |
|
|
} |
|
|
var lastIndex = length - 1; |
|
|
details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex]; |
|
|
details = details.join(length > 2 ? ', ' : ' '); |
|
|
return source.replace(reWrapComment, '{\n/* [wrapped with ' + details + '] */\n'); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a flattenable `arguments` object or array. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is flattenable, else `false`. |
|
|
*/ |
|
|
function isFlattenable(value) { |
|
|
return isArray(value) || isArguments(value) || |
|
|
!!(spreadableSymbol && value && value[spreadableSymbol]); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a valid array-like index. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index. |
|
|
* @returns {boolean} Returns `true` if `value` is a valid index, else `false`. |
|
|
*/ |
|
|
function isIndex(value, length) { |
|
|
var type = typeof value; |
|
|
length = length == null ? MAX_SAFE_INTEGER : length; |
|
|
|
|
|
return !!length && |
|
|
(type == 'number' || |
|
|
(type != 'symbol' && reIsUint.test(value))) && |
|
|
(value > -1 && value % 1 == 0 && value < length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if the given arguments are from an iteratee call. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The potential iteratee value argument. |
|
|
* @param {*} index The potential iteratee index or key argument. |
|
|
* @param {*} object The potential iteratee object argument. |
|
|
* @returns {boolean} Returns `true` if the arguments are from an iteratee call, |
|
|
* else `false`. |
|
|
*/ |
|
|
function isIterateeCall(value, index, object) { |
|
|
if (!isObject(object)) { |
|
|
return false; |
|
|
} |
|
|
var type = typeof index; |
|
|
if (type == 'number' |
|
|
? (isArrayLike(object) && isIndex(index, object.length)) |
|
|
: (type == 'string' && index in object) |
|
|
) { |
|
|
return eq(object[index], value); |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a property name and not a property path. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @param {Object} [object] The object to query keys on. |
|
|
* @returns {boolean} Returns `true` if `value` is a property name, else `false`. |
|
|
*/ |
|
|
function isKey(value, object) { |
|
|
if (isArray(value)) { |
|
|
return false; |
|
|
} |
|
|
var type = typeof value; |
|
|
if (type == 'number' || type == 'symbol' || type == 'boolean' || |
|
|
value == null || isSymbol(value)) { |
|
|
return true; |
|
|
} |
|
|
return reIsPlainProp.test(value) || !reIsDeepProp.test(value) || |
|
|
(object != null && value in Object(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is suitable for use as unique object key. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is suitable, else `false`. |
|
|
*/ |
|
|
function isKeyable(value) { |
|
|
var type = typeof value; |
|
|
return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean') |
|
|
? (value !== '__proto__') |
|
|
: (value === null); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `func` has a lazy counterpart. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to check. |
|
|
* @returns {boolean} Returns `true` if `func` has a lazy counterpart, |
|
|
* else `false`. |
|
|
*/ |
|
|
function isLaziable(func) { |
|
|
var funcName = getFuncName(func), |
|
|
other = lodash[funcName]; |
|
|
|
|
|
if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) { |
|
|
return false; |
|
|
} |
|
|
if (func === other) { |
|
|
return true; |
|
|
} |
|
|
var data = getData(other); |
|
|
return !!data && func === data[0]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `func` has its source masked. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to check. |
|
|
* @returns {boolean} Returns `true` if `func` is masked, else `false`. |
|
|
*/ |
|
|
function isMasked(func) { |
|
|
return !!maskSrcKey && (maskSrcKey in func); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is likely a prototype object. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a prototype, else `false`. |
|
|
*/ |
|
|
function isPrototype(value) { |
|
|
var Ctor = value && value.constructor, |
|
|
proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto; |
|
|
|
|
|
return value === proto; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is suitable for strict equality comparisons, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` if suitable for strict |
|
|
* equality comparisons, else `false`. |
|
|
*/ |
|
|
function isStrictComparable(value) { |
|
|
return value === value && !isObject(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `matchesProperty` for source values suitable |
|
|
* for strict equality comparisons, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} key The key of the property to get. |
|
|
* @param {*} srcValue The value to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function matchesStrictComparable(key, srcValue) { |
|
|
return function(object) { |
|
|
if (object == null) { |
|
|
return false; |
|
|
} |
|
|
return object[key] === srcValue && |
|
|
(srcValue !== undefined || (key in Object(object))); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.memoize` which clears the memoized function's |
|
|
* cache when it exceeds `MAX_MEMOIZE_SIZE`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to have its output memoized. |
|
|
* @returns {Function} Returns the new memoized function. |
|
|
*/ |
|
|
function memoizeCapped(func) { |
|
|
var result = memoize(func, function(key) { |
|
|
if (cache.size === MAX_MEMOIZE_SIZE) { |
|
|
cache.clear(); |
|
|
} |
|
|
return key; |
|
|
}); |
|
|
|
|
|
var cache = result.cache; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Merges the function metadata of `source` into `data`. |
|
|
* |
|
|
* Merging metadata reduces the number of wrappers used to invoke a function. |
|
|
* This is possible because methods like `_.bind`, `_.curry`, and `_.partial` |
|
|
* may be applied regardless of execution order. Methods like `_.ary` and |
|
|
* `_.rearg` modify function arguments, making the order in which they are |
|
|
* executed important, preventing the merging of metadata. However, we make |
|
|
* an exception for a safe combined case where curried functions have `_.ary` |
|
|
* and or `_.rearg` applied. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} data The destination metadata. |
|
|
* @param {Array} source The source metadata. |
|
|
* @returns {Array} Returns `data`. |
|
|
*/ |
|
|
function mergeData(data, source) { |
|
|
var bitmask = data[1], |
|
|
srcBitmask = source[1], |
|
|
newBitmask = bitmask | srcBitmask, |
|
|
isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG); |
|
|
|
|
|
var isCombo = |
|
|
((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) || |
|
|
((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) || |
|
|
((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG)); |
|
|
|
|
|
// Exit early if metadata can't be merged. |
|
|
if (!(isCommon || isCombo)) { |
|
|
return data; |
|
|
} |
|
|
// Use source `thisArg` if available. |
|
|
if (srcBitmask & WRAP_BIND_FLAG) { |
|
|
data[2] = source[2]; |
|
|
// Set when currying a bound function. |
|
|
newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG; |
|
|
} |
|
|
// Compose partial arguments. |
|
|
var value = source[3]; |
|
|
if (value) { |
|
|
var partials = data[3]; |
|
|
data[3] = partials ? composeArgs(partials, value, source[4]) : value; |
|
|
data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4]; |
|
|
} |
|
|
// Compose partial right arguments. |
|
|
value = source[5]; |
|
|
if (value) { |
|
|
partials = data[5]; |
|
|
data[5] = partials ? composeArgsRight(partials, value, source[6]) : value; |
|
|
data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6]; |
|
|
} |
|
|
// Use source `argPos` if available. |
|
|
value = source[7]; |
|
|
if (value) { |
|
|
data[7] = value; |
|
|
} |
|
|
// Use source `ary` if it's smaller. |
|
|
if (srcBitmask & WRAP_ARY_FLAG) { |
|
|
data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]); |
|
|
} |
|
|
// Use source `arity` if one is not provided. |
|
|
if (data[9] == null) { |
|
|
data[9] = source[9]; |
|
|
} |
|
|
// Use source `func` and merge bitmasks. |
|
|
data[0] = source[0]; |
|
|
data[1] = newBitmask; |
|
|
|
|
|
return data; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like |
|
|
* [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys) |
|
|
* except that it includes inherited enumerable properties. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function nativeKeysIn(object) { |
|
|
var result = []; |
|
|
if (object != null) { |
|
|
for (var key in Object(object)) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string using `Object.prototype.toString`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {string} Returns the converted string. |
|
|
*/ |
|
|
function objectToString(value) { |
|
|
return nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseRest` which transforms the rest array. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @param {Function} transform The rest array transform. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function overRest(func, start, transform) { |
|
|
start = nativeMax(start === undefined ? (func.length - 1) : start, 0); |
|
|
return function() { |
|
|
var args = arguments, |
|
|
index = -1, |
|
|
length = nativeMax(args.length - start, 0), |
|
|
array = Array(length); |
|
|
|
|
|
while (++index < length) { |
|
|
array[index] = args[start + index]; |
|
|
} |
|
|
index = -1; |
|
|
var otherArgs = Array(start + 1); |
|
|
while (++index < start) { |
|
|
otherArgs[index] = args[index]; |
|
|
} |
|
|
otherArgs[start] = transform(array); |
|
|
return apply(func, this, otherArgs); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the parent value at `path` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array} path The path to get the parent value of. |
|
|
* @returns {*} Returns the parent value. |
|
|
*/ |
|
|
function parent(object, path) { |
|
|
return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reorder `array` according to the specified indexes where the element at |
|
|
* the first index is assigned as the first element, the element at |
|
|
* the second index is assigned as the second element, and so on. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to reorder. |
|
|
* @param {Array} indexes The arranged array indexes. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function reorder(array, indexes) { |
|
|
var arrLength = array.length, |
|
|
length = nativeMin(indexes.length, arrLength), |
|
|
oldArray = copyArray(array); |
|
|
|
|
|
while (length--) { |
|
|
var index = indexes[length]; |
|
|
array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets metadata for `func`. |
|
|
* |
|
|
* **Note:** If this function becomes hot, i.e. is invoked a lot in a short |
|
|
* period of time, it will trip its breaker and transition to an identity |
|
|
* function to avoid garbage collection pauses in V8. See |
|
|
* [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070) |
|
|
* for more details. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to associate metadata with. |
|
|
* @param {*} data The metadata. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var setData = shortOut(baseSetData); |
|
|
|
|
|
/** |
|
|
* Sets the `toString` method of `func` to return `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to modify. |
|
|
* @param {Function} string The `toString` result. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var setToString = shortOut(baseSetToString); |
|
|
|
|
|
/** |
|
|
* Sets the `toString` method of `wrapper` to mimic the source of `reference` |
|
|
* with wrapper details in a comment at the top of the source body. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} wrapper The function to modify. |
|
|
* @param {Function} reference The reference function. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @returns {Function} Returns `wrapper`. |
|
|
*/ |
|
|
function setWrapToString(wrapper, reference, bitmask) { |
|
|
var source = (reference + ''); |
|
|
return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that'll short out and invoke `identity` instead |
|
|
* of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN` |
|
|
* milliseconds. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new shortable function. |
|
|
*/ |
|
|
function shortOut(func) { |
|
|
var count = 0, |
|
|
lastCalled = 0; |
|
|
|
|
|
return function() { |
|
|
var stamp = nativeNow(), |
|
|
remaining = HOT_SPAN - (stamp - lastCalled); |
|
|
|
|
|
lastCalled = stamp; |
|
|
if (remaining > 0) { |
|
|
if (++count >= HOT_COUNT) { |
|
|
return arguments[0]; |
|
|
} |
|
|
} else { |
|
|
count = 0; |
|
|
} |
|
|
return func.apply(undefined, arguments); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `string` to a property path array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the property path array. |
|
|
*/ |
|
|
var stringToPath = memoizeCapped(function(string) { |
|
|
var result = []; |
|
|
if (string.charCodeAt(0) === 46 /* . */) { |
|
|
result.push(''); |
|
|
} |
|
|
string.replace(rePropName, function(match, number, quote, subString) { |
|
|
result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match)); |
|
|
}); |
|
|
return result; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string key if it's not a string or symbol. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @returns {string|symbol} Returns the key. |
|
|
*/ |
|
|
function toKey(value) { |
|
|
if (typeof value == 'string' || isSymbol(value)) { |
|
|
return value; |
|
|
} |
|
|
var result = (value + ''); |
|
|
return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `func` to its source code. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to convert. |
|
|
* @returns {string} Returns the source code. |
|
|
*/ |
|
|
function toSource(func) { |
|
|
if (func != null) { |
|
|
try { |
|
|
return funcToString.call(func); |
|
|
} catch (e) {} |
|
|
try { |
|
|
return (func + ''); |
|
|
} catch (e) {} |
|
|
} |
|
|
return ''; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Updates wrapper `details` based on `bitmask` flags. |
|
|
* |
|
|
* @private |
|
|
* @returns {Array} details The details to modify. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @returns {Array} Returns `details`. |
|
|
*/ |
|
|
function updateWrapDetails(details, bitmask) { |
|
|
arrayEach(wrapFlags, function(pair) { |
|
|
var value = '_.' + pair[0]; |
|
|
if ((bitmask & pair[1]) && !arrayIncludes(details, value)) { |
|
|
details.push(value); |
|
|
} |
|
|
}); |
|
|
return details.sort(); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `wrapper`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} wrapper The wrapper to clone. |
|
|
* @returns {Object} Returns the cloned wrapper. |
|
|
*/ |
|
|
function wrapperClone(wrapper) { |
|
|
if (wrapper instanceof LazyWrapper) { |
|
|
return wrapper.clone(); |
|
|
} |
|
|
var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__); |
|
|
result.__actions__ = copyArray(wrapper.__actions__); |
|
|
result.__index__ = wrapper.__index__; |
|
|
result.__values__ = wrapper.__values__; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an array with all falsey values removed. The values `false`, `null`, |
|
|
* `0`, `""`, `undefined`, and `NaN` are falsey. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to compact. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @example |
|
|
* |
|
|
* _.compact([0, 1, false, 2, '', 3]); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function compact(array) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (value) { |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a new array concatenating `array` with any additional arrays |
|
|
* and/or values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to concatenate. |
|
|
* @param {...*} [values] The values to concatenate. |
|
|
* @returns {Array} Returns the new concatenated array. |
|
|
* @example |
|
|
* |
|
|
* var array = [1]; |
|
|
* var other = _.concat(array, 2, [3], [[4]]); |
|
|
* |
|
|
* console.log(other); |
|
|
* // => [1, 2, 3, [4]] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1] |
|
|
*/ |
|
|
function concat() { |
|
|
var length = arguments.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
var args = Array(length - 1), |
|
|
array = arguments[0], |
|
|
index = length; |
|
|
|
|
|
while (index--) { |
|
|
args[index - 1] = arguments[index]; |
|
|
} |
|
|
return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of `array` values not included in the other given arrays |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. The order and references of result values are |
|
|
* determined by the first array. |
|
|
* |
|
|
* **Note:** Unlike `_.pullAll`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {...Array} [values] The values to exclude. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @see _.without, _.xor |
|
|
* @example |
|
|
* |
|
|
* _.difference([2, 1], [2, 3]); |
|
|
* // => [1] |
|
|
*/ |
|
|
var difference = baseRest(function(array, values) { |
|
|
return isArrayLikeObject(array) |
|
|
? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true)) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements dropped from the beginning. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.5.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to drop. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.drop([1, 2, 3]); |
|
|
* // => [2, 3] |
|
|
* |
|
|
* _.drop([1, 2, 3], 2); |
|
|
* // => [3] |
|
|
* |
|
|
* _.drop([1, 2, 3], 5); |
|
|
* // => [] |
|
|
* |
|
|
* _.drop([1, 2, 3], 0); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function drop(array, n, guard) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
return baseSlice(array, n < 0 ? 0 : n, length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.find` except that it returns the index of the first |
|
|
* element `predicate` returns truthy for instead of the element itself. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {number} Returns the index of the found element, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': false }, |
|
|
* { 'user': 'fred', 'active': false }, |
|
|
* { 'user': 'pebbles', 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.findIndex(users, function(o) { return o.user == 'barney'; }); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findIndex(users, { 'user': 'fred', 'active': false }); |
|
|
* // => 1 |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findIndex(users, ['active', false]); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findIndex(users, 'active'); |
|
|
* // => 2 |
|
|
*/ |
|
|
function findIndex(array, predicate, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = fromIndex == null ? 0 : toInteger(fromIndex); |
|
|
if (index < 0) { |
|
|
index = nativeMax(length + index, 0); |
|
|
} |
|
|
return baseFindIndex(array, baseIteratee(predicate, 3), index); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.findIndex` except that it iterates over elements |
|
|
* of `collection` from right to left. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=array.length-1] The index to search from. |
|
|
* @returns {number} Returns the index of the found element, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': true }, |
|
|
* { 'user': 'fred', 'active': false }, |
|
|
* { 'user': 'pebbles', 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* _.findLastIndex(users, function(o) { return o.user == 'pebbles'; }); |
|
|
* // => 2 |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findLastIndex(users, { 'user': 'barney', 'active': true }); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findLastIndex(users, ['active', false]); |
|
|
* // => 2 |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findLastIndex(users, 'active'); |
|
|
* // => 0 |
|
|
*/ |
|
|
function findLastIndex(array, predicate, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = length - 1; |
|
|
if (fromIndex !== undefined) { |
|
|
index = toInteger(fromIndex); |
|
|
index = fromIndex < 0 |
|
|
? nativeMax(length + index, 0) |
|
|
: nativeMin(index, length - 1); |
|
|
} |
|
|
return baseFindIndex(array, baseIteratee(predicate, 3), index, true); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Flattens `array` a single level deep. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to flatten. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
* @example |
|
|
* |
|
|
* _.flatten([1, [2, [3, [4]], 5]]); |
|
|
* // => [1, 2, [3, [4]], 5] |
|
|
*/ |
|
|
function flatten(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseFlatten(array, 1) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Recursively flattens `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to flatten. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
* @example |
|
|
* |
|
|
* _.flattenDeep([1, [2, [3, [4]], 5]]); |
|
|
* // => [1, 2, 3, 4, 5] |
|
|
*/ |
|
|
function flattenDeep(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseFlatten(array, INFINITY) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the first element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias first |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {*} Returns the first element of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.head([1, 2, 3]); |
|
|
* // => 1 |
|
|
* |
|
|
* _.head([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function head(array) { |
|
|
return (array && array.length) ? array[0] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the index at which the first occurrence of `value` is found in `array` |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. If `fromIndex` is negative, it's used as the |
|
|
* offset from the end of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* _.indexOf([1, 2, 1, 2], 2); |
|
|
* // => 1 |
|
|
* |
|
|
* // Search from the `fromIndex`. |
|
|
* _.indexOf([1, 2, 1, 2], 2, 2); |
|
|
* // => 3 |
|
|
*/ |
|
|
function indexOf(array, value, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = fromIndex == null ? 0 : toInteger(fromIndex); |
|
|
if (index < 0) { |
|
|
index = nativeMax(length + index, 0); |
|
|
} |
|
|
return baseIndexOf(array, value, index); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets all but the last element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.initial([1, 2, 3]); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function initial(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseSlice(array, 0, -1) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of unique values that are included in all given arrays |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. The order and references of result values are |
|
|
* determined by the first array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to inspect. |
|
|
* @returns {Array} Returns the new array of intersecting values. |
|
|
* @example |
|
|
* |
|
|
* _.intersection([2, 1], [2, 3]); |
|
|
* // => [2] |
|
|
*/ |
|
|
var intersection = baseRest(function(arrays) { |
|
|
var mapped = arrayMap(arrays, castArrayLikeObject); |
|
|
return (mapped.length && mapped[0] === arrays[0]) |
|
|
? baseIntersection(mapped) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Gets the last element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {*} Returns the last element of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.last([1, 2, 3]); |
|
|
* // => 3 |
|
|
*/ |
|
|
function last(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? array[length - 1] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverses `array` so that the first element becomes the last, the second |
|
|
* element becomes the second to last, and so on. |
|
|
* |
|
|
* **Note:** This method mutates `array` and is based on |
|
|
* [`Array#reverse`](https://mdn.io/Array/reverse). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to modify. |
|
|
* @returns {Array} Returns `array`. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2, 3]; |
|
|
* |
|
|
* _.reverse(array); |
|
|
* // => [3, 2, 1] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [3, 2, 1] |
|
|
*/ |
|
|
function reverse(array) { |
|
|
return array == null ? array : nativeReverse.call(array); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` from `start` up to, but not including, `end`. |
|
|
* |
|
|
* **Note:** This method is used instead of |
|
|
* [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are |
|
|
* returned. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to slice. |
|
|
* @param {number} [start=0] The start position. |
|
|
* @param {number} [end=array.length] The end position. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
*/ |
|
|
function slice(array, start, end) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
if (end && typeof end != 'number' && isIterateeCall(array, start, end)) { |
|
|
start = 0; |
|
|
end = length; |
|
|
} |
|
|
else { |
|
|
start = start == null ? 0 : toInteger(start); |
|
|
end = end === undefined ? length : toInteger(end); |
|
|
} |
|
|
return baseSlice(array, start, end); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements taken from the beginning. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to take. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.take([1, 2, 3]); |
|
|
* // => [1] |
|
|
* |
|
|
* _.take([1, 2, 3], 2); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* _.take([1, 2, 3], 5); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* _.take([1, 2, 3], 0); |
|
|
* // => [] |
|
|
*/ |
|
|
function take(array, n, guard) { |
|
|
if (!(array && array.length)) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
return baseSlice(array, 0, n < 0 ? 0 : n); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements taken from the end. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to take. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.takeRight([1, 2, 3]); |
|
|
* // => [3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 2); |
|
|
* // => [2, 3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 5); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 0); |
|
|
* // => [] |
|
|
*/ |
|
|
function takeRight(array, n, guard) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
n = length - n; |
|
|
return baseSlice(array, n < 0 ? 0 : n, length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of unique values, in order, from all given arrays using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to inspect. |
|
|
* @returns {Array} Returns the new array of combined values. |
|
|
* @example |
|
|
* |
|
|
* _.union([2], [1, 2]); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
var union = baseRest(function(arrays) { |
|
|
return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true)); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a duplicate-free version of an array, using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons, in which only the first occurrence of each element |
|
|
* is kept. The order of result values is determined by the order they occur |
|
|
* in the array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
* @example |
|
|
* |
|
|
* _.uniq([2, 1, 2]); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
function uniq(array) { |
|
|
return (array && array.length) ? baseUniq(array) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.uniq` except that it accepts `iteratee` which is |
|
|
* invoked for each element in `array` to generate the criterion by which |
|
|
* uniqueness is computed. The order of result values is determined by the |
|
|
* order they occur in the array. The iteratee is invoked with one argument: |
|
|
* (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee invoked per element. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
* @example |
|
|
* |
|
|
* _.uniqBy([2.1, 1.2, 2.3], Math.floor); |
|
|
* // => [2.1, 1.2] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x'); |
|
|
* // => [{ 'x': 1 }, { 'x': 2 }] |
|
|
*/ |
|
|
function uniqBy(array, iteratee) { |
|
|
return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.zip` except that it accepts an array of grouped |
|
|
* elements and creates an array regrouping the elements to their pre-zip |
|
|
* configuration. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.2.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array of grouped elements to process. |
|
|
* @returns {Array} Returns the new array of regrouped elements. |
|
|
* @example |
|
|
* |
|
|
* var zipped = _.zip(['a', 'b'], [1, 2], [true, false]); |
|
|
* // => [['a', 1, true], ['b', 2, false]] |
|
|
* |
|
|
* _.unzip(zipped); |
|
|
* // => [['a', 'b'], [1, 2], [true, false]] |
|
|
*/ |
|
|
function unzip(array) { |
|
|
if (!(array && array.length)) { |
|
|
return []; |
|
|
} |
|
|
var length = 0; |
|
|
array = arrayFilter(array, function(group) { |
|
|
if (isArrayLikeObject(group)) { |
|
|
length = nativeMax(group.length, length); |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
return baseTimes(length, function(index) { |
|
|
return arrayMap(array, baseProperty(index)); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array excluding all given values using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* **Note:** Unlike `_.pull`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {...*} [values] The values to exclude. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @see _.difference, _.xor |
|
|
* @example |
|
|
* |
|
|
* _.without([2, 1, 2, 3], 1, 2); |
|
|
* // => [3] |
|
|
*/ |
|
|
var without = baseRest(function(array, values) { |
|
|
return isArrayLikeObject(array) |
|
|
? baseDifference(array, values) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an array of grouped elements, the first of which contains the |
|
|
* first elements of the given arrays, the second of which contains the |
|
|
* second elements of the given arrays, and so on. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to process. |
|
|
* @returns {Array} Returns the new array of grouped elements. |
|
|
* @example |
|
|
* |
|
|
* _.zip(['a', 'b'], [1, 2], [true, false]); |
|
|
* // => [['a', 1, true], ['b', 2, false]] |
|
|
*/ |
|
|
var zip = baseRest(unzip); |
|
|
|
|
|
/** |
|
|
* This method is like `_.fromPairs` except that it accepts two arrays, |
|
|
* one of property identifiers and one of corresponding values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.4.0 |
|
|
* @category Array |
|
|
* @param {Array} [props=[]] The property identifiers. |
|
|
* @param {Array} [values=[]] The property values. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* _.zipObject(['a', 'b'], [1, 2]); |
|
|
* // => { 'a': 1, 'b': 2 } |
|
|
*/ |
|
|
function zipObject(props, values) { |
|
|
return baseZipObject(props || [], values || [], assignValue); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` wrapper instance that wraps `value` with explicit method |
|
|
* chain sequences enabled. The result of such sequences must be unwrapped |
|
|
* with `_#value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.3.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to wrap. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 }, |
|
|
* { 'user': 'pebbles', 'age': 1 } |
|
|
* ]; |
|
|
* |
|
|
* var youngest = _ |
|
|
* .chain(users) |
|
|
* .sortBy('age') |
|
|
* .map(function(o) { |
|
|
* return o.user + ' is ' + o.age; |
|
|
* }) |
|
|
* .head() |
|
|
* .value(); |
|
|
* // => 'pebbles is 1' |
|
|
*/ |
|
|
function chain(value) { |
|
|
var result = lodash(value); |
|
|
result.__chain__ = true; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method invokes `interceptor` and returns `value`. The interceptor |
|
|
* is invoked with one argument; (value). The purpose of this method is to |
|
|
* "tap into" a method chain sequence in order to modify intermediate results. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to provide to `interceptor`. |
|
|
* @param {Function} interceptor The function to invoke. |
|
|
* @returns {*} Returns `value`. |
|
|
* @example |
|
|
* |
|
|
* _([1, 2, 3]) |
|
|
* .tap(function(array) { |
|
|
* // Mutate input array. |
|
|
* array.pop(); |
|
|
* }) |
|
|
* .reverse() |
|
|
* .value(); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
function tap(value, interceptor) { |
|
|
interceptor(value); |
|
|
return value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.tap` except that it returns the result of `interceptor`. |
|
|
* The purpose of this method is to "pass thru" values replacing intermediate |
|
|
* results in a method chain sequence. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to provide to `interceptor`. |
|
|
* @param {Function} interceptor The function to invoke. |
|
|
* @returns {*} Returns the result of `interceptor`. |
|
|
* @example |
|
|
* |
|
|
* _(' abc ') |
|
|
* .chain() |
|
|
* .trim() |
|
|
* .thru(function(value) { |
|
|
* return [value]; |
|
|
* }) |
|
|
* .value(); |
|
|
* // => ['abc'] |
|
|
*/ |
|
|
function thru(value, interceptor) { |
|
|
return interceptor(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is the wrapper version of `_.at`. |
|
|
* |
|
|
* @name at |
|
|
* @memberOf _ |
|
|
* @since 1.0.0 |
|
|
* @category Seq |
|
|
* @param {...(string|string[])} [paths] The property paths to pick. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c': 3 } }, 4] }; |
|
|
* |
|
|
* _(object).at(['a[0].b.c', 'a[1]']).value(); |
|
|
* // => [3, 4] |
|
|
*/ |
|
|
var wrapperAt = flatRest(function(paths) { |
|
|
var length = paths.length, |
|
|
start = length ? paths[0] : 0, |
|
|
value = this.__wrapped__, |
|
|
interceptor = function(object) { return baseAt(object, paths); }; |
|
|
|
|
|
if (length > 1 || this.__actions__.length || |
|
|
!(value instanceof LazyWrapper) || !isIndex(start)) { |
|
|
return this.thru(interceptor); |
|
|
} |
|
|
value = value.slice(start, +start + (length ? 1 : 0)); |
|
|
value.__actions__.push({ |
|
|
'func': thru, |
|
|
'args': [interceptor], |
|
|
'thisArg': undefined |
|
|
}); |
|
|
return new LodashWrapper(value, this.__chain__).thru(function(array) { |
|
|
if (length && !array.length) { |
|
|
array.push(undefined); |
|
|
} |
|
|
return array; |
|
|
}); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` wrapper instance with explicit method chain sequences enabled. |
|
|
* |
|
|
* @name chain |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 } |
|
|
* ]; |
|
|
* |
|
|
* // A sequence without explicit chaining. |
|
|
* _(users).head(); |
|
|
* // => { 'user': 'barney', 'age': 36 } |
|
|
* |
|
|
* // A sequence with explicit chaining. |
|
|
* _(users) |
|
|
* .chain() |
|
|
* .head() |
|
|
* .pick('user') |
|
|
* .value(); |
|
|
* // => { 'user': 'barney' } |
|
|
*/ |
|
|
function wrapperChain() { |
|
|
return chain(this); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Executes the chain sequence and returns the wrapped result. |
|
|
* |
|
|
* @name commit |
|
|
* @memberOf _ |
|
|
* @since 3.2.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2]; |
|
|
* var wrapped = _(array).push(3); |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* wrapped = wrapped.commit(); |
|
|
* console.log(array); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* wrapped.last(); |
|
|
* // => 3 |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function wrapperCommit() { |
|
|
return new LodashWrapper(this.value(), this.__chain__); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the next value on a wrapped object following the |
|
|
* [iterator protocol](https://mdn.io/iteration_protocols#iterator). |
|
|
* |
|
|
* @name next |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the next iterator value. |
|
|
* @example |
|
|
* |
|
|
* var wrapped = _([1, 2]); |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': false, 'value': 1 } |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': false, 'value': 2 } |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': true, 'value': undefined } |
|
|
*/ |
|
|
function wrapperNext() { |
|
|
if (this.__values__ === undefined) { |
|
|
this.__values__ = toArray(this.value()); |
|
|
} |
|
|
var done = this.__index__ >= this.__values__.length, |
|
|
value = done ? undefined : this.__values__[this.__index__++]; |
|
|
|
|
|
return { 'done': done, 'value': value }; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Enables the wrapper to be iterable. |
|
|
* |
|
|
* @name Symbol.iterator |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the wrapper object. |
|
|
* @example |
|
|
* |
|
|
* var wrapped = _([1, 2]); |
|
|
* |
|
|
* wrapped[Symbol.iterator]() === wrapped; |
|
|
* // => true |
|
|
* |
|
|
* Array.from(wrapped); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function wrapperToIterator() { |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the chain sequence planting `value` as the wrapped value. |
|
|
* |
|
|
* @name plant |
|
|
* @memberOf _ |
|
|
* @since 3.2.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to plant. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* var wrapped = _([1, 2]).map(square); |
|
|
* var other = wrapped.plant([3, 4]); |
|
|
* |
|
|
* other.value(); |
|
|
* // => [9, 16] |
|
|
* |
|
|
* wrapped.value(); |
|
|
* // => [1, 4] |
|
|
*/ |
|
|
function wrapperPlant(value) { |
|
|
var result, |
|
|
parent = this; |
|
|
|
|
|
while (parent instanceof baseLodash) { |
|
|
var clone = wrapperClone(parent); |
|
|
clone.__index__ = 0; |
|
|
clone.__values__ = undefined; |
|
|
if (result) { |
|
|
previous.__wrapped__ = clone; |
|
|
} else { |
|
|
result = clone; |
|
|
} |
|
|
var previous = clone; |
|
|
parent = parent.__wrapped__; |
|
|
} |
|
|
previous.__wrapped__ = value; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is the wrapper version of `_.reverse`. |
|
|
* |
|
|
* **Note:** This method mutates the wrapped array. |
|
|
* |
|
|
* @name reverse |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2, 3]; |
|
|
* |
|
|
* _(array).reverse().value() |
|
|
* // => [3, 2, 1] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [3, 2, 1] |
|
|
*/ |
|
|
function wrapperReverse() { |
|
|
var value = this.__wrapped__; |
|
|
if (value instanceof LazyWrapper) { |
|
|
var wrapped = value; |
|
|
if (this.__actions__.length) { |
|
|
wrapped = new LazyWrapper(this); |
|
|
} |
|
|
wrapped = wrapped.reverse(); |
|
|
wrapped.__actions__.push({ |
|
|
'func': thru, |
|
|
'args': [reverse], |
|
|
'thisArg': undefined |
|
|
}); |
|
|
return new LodashWrapper(wrapped, this.__chain__); |
|
|
} |
|
|
return this.thru(reverse); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Executes the chain sequence to resolve the unwrapped value. |
|
|
* |
|
|
* @name value |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias toJSON, valueOf |
|
|
* @category Seq |
|
|
* @returns {*} Returns the resolved unwrapped value. |
|
|
* @example |
|
|
* |
|
|
* _([1, 2, 3]).value(); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function wrapperValue() { |
|
|
return baseWrapperValue(this.__wrapped__, this.__actions__); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an object composed of keys generated from the results of running |
|
|
* each element of `collection` thru `iteratee`. The corresponding value of |
|
|
* each key is the number of times the key was returned by `iteratee`. The |
|
|
* iteratee is invoked with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.5.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee to transform keys. |
|
|
* @returns {Object} Returns the composed aggregate object. |
|
|
* @example |
|
|
* |
|
|
* _.countBy([6.1, 4.2, 6.3], Math.floor); |
|
|
* // => { '4': 1, '6': 2 } |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.countBy(['one', 'two', 'three'], 'length'); |
|
|
* // => { '3': 2, '5': 1 } |
|
|
*/ |
|
|
var countBy = createAggregator(function(result, value, key) { |
|
|
if (hasOwnProperty.call(result, key)) { |
|
|
++result[key]; |
|
|
} else { |
|
|
baseAssignValue(result, key, 1); |
|
|
} |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Checks if `predicate` returns truthy for **all** elements of `collection`. |
|
|
* Iteration is stopped once `predicate` returns falsey. The predicate is |
|
|
* invoked with three arguments: (value, index|key, collection). |
|
|
* |
|
|
* **Note:** This method returns `true` for |
|
|
* [empty collections](https://en.wikipedia.org/wiki/Empty_set) because |
|
|
* [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of |
|
|
* elements of empty collections. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.every([true, 1, null, 'yes'], Boolean); |
|
|
* // => false |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': false }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.every(users, { 'user': 'barney', 'active': false }); |
|
|
* // => false |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.every(users, ['active', false]); |
|
|
* // => true |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.every(users, 'active'); |
|
|
* // => false |
|
|
*/ |
|
|
function every(collection, predicate, guard) { |
|
|
var func = isArray(collection) ? arrayEvery : baseEvery; |
|
|
if (guard && isIterateeCall(collection, predicate, guard)) { |
|
|
predicate = undefined; |
|
|
} |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection`, returning an array of all elements |
|
|
* `predicate` returns truthy for. The predicate is invoked with three |
|
|
* arguments: (value, index|key, collection). |
|
|
* |
|
|
* **Note:** Unlike `_.remove`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
* @see _.reject |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* _.filter(users, function(o) { return !o.active; }); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.filter(users, { 'age': 36, 'active': true }); |
|
|
* // => objects for ['barney'] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.filter(users, ['active', false]); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.filter(users, 'active'); |
|
|
* // => objects for ['barney'] |
|
|
*/ |
|
|
function filter(collection, predicate) { |
|
|
var func = isArray(collection) ? arrayFilter : baseFilter; |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection`, returning the first element |
|
|
* `predicate` returns truthy for. The predicate is invoked with three |
|
|
* arguments: (value, index|key, collection). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {*} Returns the matched element, else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false }, |
|
|
* { 'user': 'pebbles', 'age': 1, 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.find(users, function(o) { return o.age < 40; }); |
|
|
* // => object for 'barney' |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.find(users, { 'age': 1, 'active': true }); |
|
|
* // => object for 'pebbles' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.find(users, ['active', false]); |
|
|
* // => object for 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.find(users, 'active'); |
|
|
* // => object for 'barney' |
|
|
*/ |
|
|
var find = createFind(findIndex); |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection` and invokes `iteratee` for each element. |
|
|
* The iteratee is invoked with three arguments: (value, index|key, collection). |
|
|
* Iteratee functions may exit iteration early by explicitly returning `false`. |
|
|
* |
|
|
* **Note:** As with other "Collections" methods, objects with a "length" |
|
|
* property are iterated like arrays. To avoid this behavior use `_.forIn` |
|
|
* or `_.forOwn` for object iteration. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias each |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @returns {Array|Object} Returns `collection`. |
|
|
* @see _.forEachRight |
|
|
* @example |
|
|
* |
|
|
* _.forEach([1, 2], function(value) { |
|
|
* console.log(value); |
|
|
* }); |
|
|
* // => Logs `1` then `2`. |
|
|
* |
|
|
* _.forEach({ 'a': 1, 'b': 2 }, function(value, key) { |
|
|
* console.log(key); |
|
|
* }); |
|
|
* // => Logs 'a' then 'b' (iteration order is not guaranteed). |
|
|
*/ |
|
|
function forEach(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayEach : baseEach; |
|
|
return func(collection, baseIteratee(iteratee, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of values by running each element in `collection` thru |
|
|
* `iteratee`. The iteratee is invoked with three arguments: |
|
|
* (value, index|key, collection). |
|
|
* |
|
|
* Many lodash methods are guarded to work as iteratees for methods like |
|
|
* `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`. |
|
|
* |
|
|
* The guarded methods are: |
|
|
* `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`, |
|
|
* `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`, |
|
|
* `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`, |
|
|
* `template`, `trim`, `trimEnd`, `trimStart`, and `words` |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* _.map([4, 8], square); |
|
|
* // => [16, 64] |
|
|
* |
|
|
* _.map({ 'a': 4, 'b': 8 }, square); |
|
|
* // => [16, 64] (iteration order is not guaranteed) |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney' }, |
|
|
* { 'user': 'fred' } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.map(users, 'user'); |
|
|
* // => ['barney', 'fred'] |
|
|
*/ |
|
|
function map(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayMap : baseMap; |
|
|
return func(collection, baseIteratee(iteratee, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reduces `collection` to a value which is the accumulated result of running |
|
|
* each element in `collection` thru `iteratee`, where each successive |
|
|
* invocation is supplied the return value of the previous. If `accumulator` |
|
|
* is not given, the first element of `collection` is used as the initial |
|
|
* value. The iteratee is invoked with four arguments: |
|
|
* (accumulator, value, index|key, collection). |
|
|
* |
|
|
* Many lodash methods are guarded to work as iteratees for methods like |
|
|
* `_.reduce`, `_.reduceRight`, and `_.transform`. |
|
|
* |
|
|
* The guarded methods are: |
|
|
* `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`, |
|
|
* and `sortBy` |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @param {*} [accumulator] The initial value. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
* @see _.reduceRight |
|
|
* @example |
|
|
* |
|
|
* _.reduce([1, 2], function(sum, n) { |
|
|
* return sum + n; |
|
|
* }, 0); |
|
|
* // => 3 |
|
|
* |
|
|
* _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) { |
|
|
* (result[value] || (result[value] = [])).push(key); |
|
|
* return result; |
|
|
* }, {}); |
|
|
* // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed) |
|
|
*/ |
|
|
function reduce(collection, iteratee, accumulator) { |
|
|
var func = isArray(collection) ? arrayReduce : baseReduce, |
|
|
initAccum = arguments.length < 3; |
|
|
|
|
|
return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The opposite of `_.filter`; this method returns the elements of `collection` |
|
|
* that `predicate` does **not** return truthy for. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
* @see _.filter |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': false }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.reject(users, function(o) { return !o.active; }); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.reject(users, { 'age': 40, 'active': true }); |
|
|
* // => objects for ['barney'] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.reject(users, ['active', false]); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.reject(users, 'active'); |
|
|
* // => objects for ['barney'] |
|
|
*/ |
|
|
function reject(collection, predicate) { |
|
|
var func = isArray(collection) ? arrayFilter : baseFilter; |
|
|
return func(collection, negate(baseIteratee(predicate, 3))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of `collection` by returning its length for array-like |
|
|
* values or the number of own enumerable string keyed properties for objects. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object|string} collection The collection to inspect. |
|
|
* @returns {number} Returns the collection size. |
|
|
* @example |
|
|
* |
|
|
* _.size([1, 2, 3]); |
|
|
* // => 3 |
|
|
* |
|
|
* _.size({ 'a': 1, 'b': 2 }); |
|
|
* // => 2 |
|
|
* |
|
|
* _.size('pebbles'); |
|
|
* // => 7 |
|
|
*/ |
|
|
function size(collection) { |
|
|
if (collection == null) { |
|
|
return 0; |
|
|
} |
|
|
if (isArrayLike(collection)) { |
|
|
return isString(collection) ? stringSize(collection) : collection.length; |
|
|
} |
|
|
var tag = getTag(collection); |
|
|
if (tag == mapTag || tag == setTag) { |
|
|
return collection.size; |
|
|
} |
|
|
return baseKeys(collection).length; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `predicate` returns truthy for **any** element of `collection`. |
|
|
* Iteration is stopped once `predicate` returns truthy. The predicate is |
|
|
* invoked with three arguments: (value, index|key, collection). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.some([null, 0, 'yes', false], Boolean); |
|
|
* // => true |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': true }, |
|
|
* { 'user': 'fred', 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.some(users, { 'user': 'barney', 'active': false }); |
|
|
* // => false |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.some(users, ['active', false]); |
|
|
* // => true |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.some(users, 'active'); |
|
|
* // => true |
|
|
*/ |
|
|
function some(collection, predicate, guard) { |
|
|
var func = isArray(collection) ? arraySome : baseSome; |
|
|
if (guard && isIterateeCall(collection, predicate, guard)) { |
|
|
predicate = undefined; |
|
|
} |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of elements, sorted in ascending order by the results of |
|
|
* running each element in a collection thru each iteratee. This method |
|
|
* performs a stable sort, that is, it preserves the original sort order of |
|
|
* equal elements. The iteratees are invoked with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {...(Function|Function[])} [iteratees=[_.identity]] |
|
|
* The iteratees to sort by. |
|
|
* @returns {Array} Returns the new sorted array. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'fred', 'age': 48 }, |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 }, |
|
|
* { 'user': 'barney', 'age': 34 } |
|
|
* ]; |
|
|
* |
|
|
* _.sortBy(users, [function(o) { return o.user; }]); |
|
|
* // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]] |
|
|
* |
|
|
* _.sortBy(users, ['user', 'age']); |
|
|
* // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]] |
|
|
*/ |
|
|
var sortBy = baseRest(function(collection, iteratees) { |
|
|
if (collection == null) { |
|
|
return []; |
|
|
} |
|
|
var length = iteratees.length; |
|
|
if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) { |
|
|
iteratees = []; |
|
|
} else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) { |
|
|
iteratees = [iteratees[0]]; |
|
|
} |
|
|
return baseOrderBy(collection, baseFlatten(iteratees, 1), []); |
|
|
}); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Gets the timestamp of the number of milliseconds that have elapsed since |
|
|
* the Unix epoch (1 January 1970 00:00:00 UTC). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Date |
|
|
* @returns {number} Returns the timestamp. |
|
|
* @example |
|
|
* |
|
|
* _.defer(function(stamp) { |
|
|
* console.log(_.now() - stamp); |
|
|
* }, _.now()); |
|
|
* // => Logs the number of milliseconds it took for the deferred invocation. |
|
|
*/ |
|
|
var now = function() { |
|
|
return root.Date.now(); |
|
|
}; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func`, with the `this` binding and arguments |
|
|
* of the created function, while it's called less than `n` times. Subsequent |
|
|
* calls to the created function return the result of the last `func` invocation. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Function |
|
|
* @param {number} n The number of calls at which `func` is no longer invoked. |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new restricted function. |
|
|
* @example |
|
|
* |
|
|
* jQuery(element).on('click', _.before(5, addContactToList)); |
|
|
* // => Allows adding up to 4 contacts to the list. |
|
|
*/ |
|
|
function before(n, func) { |
|
|
var result; |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
n = toInteger(n); |
|
|
return function() { |
|
|
if (--n > 0) { |
|
|
result = func.apply(this, arguments); |
|
|
} |
|
|
if (n <= 1) { |
|
|
func = undefined; |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the `this` binding of `thisArg` |
|
|
* and `partials` prepended to the arguments it receives. |
|
|
* |
|
|
* The `_.bind.placeholder` value, which defaults to `_` in monolithic builds, |
|
|
* may be used as a placeholder for partially applied arguments. |
|
|
* |
|
|
* **Note:** Unlike native `Function#bind`, this method doesn't set the "length" |
|
|
* property of bound functions. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to bind. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {...*} [partials] The arguments to be partially applied. |
|
|
* @returns {Function} Returns the new bound function. |
|
|
* @example |
|
|
* |
|
|
* function greet(greeting, punctuation) { |
|
|
* return greeting + ' ' + this.user + punctuation; |
|
|
* } |
|
|
* |
|
|
* var object = { 'user': 'fred' }; |
|
|
* |
|
|
* var bound = _.bind(greet, object, 'hi'); |
|
|
* bound('!'); |
|
|
* // => 'hi fred!' |
|
|
* |
|
|
* // Bound with placeholders. |
|
|
* var bound = _.bind(greet, object, _, '!'); |
|
|
* bound('hi'); |
|
|
* // => 'hi fred!' |
|
|
*/ |
|
|
var bind = baseRest(function(func, thisArg, partials) { |
|
|
var bitmask = WRAP_BIND_FLAG; |
|
|
if (partials.length) { |
|
|
var holders = replaceHolders(partials, getHolder(bind)); |
|
|
bitmask |= WRAP_PARTIAL_FLAG; |
|
|
} |
|
|
return createWrap(func, bitmask, thisArg, partials, holders); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a debounced function that delays invoking `func` until after `wait` |
|
|
* milliseconds have elapsed since the last time the debounced function was |
|
|
* invoked. The debounced function comes with a `cancel` method to cancel |
|
|
* delayed `func` invocations and a `flush` method to immediately invoke them. |
|
|
* Provide `options` to indicate whether `func` should be invoked on the |
|
|
* leading and/or trailing edge of the `wait` timeout. The `func` is invoked |
|
|
* with the last arguments provided to the debounced function. Subsequent |
|
|
* calls to the debounced function return the result of the last `func` |
|
|
* invocation. |
|
|
* |
|
|
* **Note:** If `leading` and `trailing` options are `true`, `func` is |
|
|
* invoked on the trailing edge of the timeout only if the debounced function |
|
|
* is invoked more than once during the `wait` timeout. |
|
|
* |
|
|
* If `wait` is `0` and `leading` is `false`, `func` invocation is deferred |
|
|
* until to the next tick, similar to `setTimeout` with a timeout of `0`. |
|
|
* |
|
|
* See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/) |
|
|
* for details over the differences between `_.debounce` and `_.throttle`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to debounce. |
|
|
* @param {number} [wait=0] The number of milliseconds to delay. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.leading=false] |
|
|
* Specify invoking on the leading edge of the timeout. |
|
|
* @param {number} [options.maxWait] |
|
|
* The maximum time `func` is allowed to be delayed before it's invoked. |
|
|
* @param {boolean} [options.trailing=true] |
|
|
* Specify invoking on the trailing edge of the timeout. |
|
|
* @returns {Function} Returns the new debounced function. |
|
|
* @example |
|
|
* |
|
|
* // Avoid costly calculations while the window size is in flux. |
|
|
* jQuery(window).on('resize', _.debounce(calculateLayout, 150)); |
|
|
* |
|
|
* // Invoke `sendMail` when clicked, debouncing subsequent calls. |
|
|
* jQuery(element).on('click', _.debounce(sendMail, 300, { |
|
|
* 'leading': true, |
|
|
* 'trailing': false |
|
|
* })); |
|
|
* |
|
|
* // Ensure `batchLog` is invoked once after 1 second of debounced calls. |
|
|
* var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 }); |
|
|
* var source = new EventSource('/stream'); |
|
|
* jQuery(source).on('message', debounced); |
|
|
* |
|
|
* // Cancel the trailing debounced invocation. |
|
|
* jQuery(window).on('popstate', debounced.cancel); |
|
|
*/ |
|
|
function debounce(func, wait, options) { |
|
|
var lastArgs, |
|
|
lastThis, |
|
|
maxWait, |
|
|
result, |
|
|
timerId, |
|
|
lastCallTime, |
|
|
lastInvokeTime = 0, |
|
|
leading = false, |
|
|
maxing = false, |
|
|
trailing = true; |
|
|
|
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
wait = toNumber(wait) || 0; |
|
|
if (isObject(options)) { |
|
|
leading = !!options.leading; |
|
|
maxing = 'maxWait' in options; |
|
|
maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait; |
|
|
trailing = 'trailing' in options ? !!options.trailing : trailing; |
|
|
} |
|
|
|
|
|
function invokeFunc(time) { |
|
|
var args = lastArgs, |
|
|
thisArg = lastThis; |
|
|
|
|
|
lastArgs = lastThis = undefined; |
|
|
lastInvokeTime = time; |
|
|
result = func.apply(thisArg, args); |
|
|
return result; |
|
|
} |
|
|
|
|
|
function leadingEdge(time) { |
|
|
// Reset any `maxWait` timer. |
|
|
lastInvokeTime = time; |
|
|
// Start the timer for the trailing edge. |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
// Invoke the leading edge. |
|
|
return leading ? invokeFunc(time) : result; |
|
|
} |
|
|
|
|
|
function remainingWait(time) { |
|
|
var timeSinceLastCall = time - lastCallTime, |
|
|
timeSinceLastInvoke = time - lastInvokeTime, |
|
|
timeWaiting = wait - timeSinceLastCall; |
|
|
|
|
|
return maxing |
|
|
? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke) |
|
|
: timeWaiting; |
|
|
} |
|
|
|
|
|
function shouldInvoke(time) { |
|
|
var timeSinceLastCall = time - lastCallTime, |
|
|
timeSinceLastInvoke = time - lastInvokeTime; |
|
|
|
|
|
// Either this is the first call, activity has stopped and we're at the |
|
|
// trailing edge, the system time has gone backwards and we're treating |
|
|
// it as the trailing edge, or we've hit the `maxWait` limit. |
|
|
return (lastCallTime === undefined || (timeSinceLastCall >= wait) || |
|
|
(timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait)); |
|
|
} |
|
|
|
|
|
function timerExpired() { |
|
|
var time = now(); |
|
|
if (shouldInvoke(time)) { |
|
|
return trailingEdge(time); |
|
|
} |
|
|
// Restart the timer. |
|
|
timerId = setTimeout(timerExpired, remainingWait(time)); |
|
|
} |
|
|
|
|
|
function trailingEdge(time) { |
|
|
timerId = undefined; |
|
|
|
|
|
// Only invoke if we have `lastArgs` which means `func` has been |
|
|
// debounced at least once. |
|
|
if (trailing && lastArgs) { |
|
|
return invokeFunc(time); |
|
|
} |
|
|
lastArgs = lastThis = undefined; |
|
|
return result; |
|
|
} |
|
|
|
|
|
function cancel() { |
|
|
if (timerId !== undefined) { |
|
|
clearTimeout(timerId); |
|
|
} |
|
|
lastInvokeTime = 0; |
|
|
lastArgs = lastCallTime = lastThis = timerId = undefined; |
|
|
} |
|
|
|
|
|
function flush() { |
|
|
return timerId === undefined ? result : trailingEdge(now()); |
|
|
} |
|
|
|
|
|
function debounced() { |
|
|
var time = now(), |
|
|
isInvoking = shouldInvoke(time); |
|
|
|
|
|
lastArgs = arguments; |
|
|
lastThis = this; |
|
|
lastCallTime = time; |
|
|
|
|
|
if (isInvoking) { |
|
|
if (timerId === undefined) { |
|
|
return leadingEdge(lastCallTime); |
|
|
} |
|
|
if (maxing) { |
|
|
// Handle invocations in a tight loop. |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
return invokeFunc(lastCallTime); |
|
|
} |
|
|
} |
|
|
if (timerId === undefined) { |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
debounced.cancel = cancel; |
|
|
debounced.flush = flush; |
|
|
return debounced; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Defers invoking the `func` until the current call stack has cleared. Any |
|
|
* additional arguments are provided to `func` when it's invoked. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to defer. |
|
|
* @param {...*} [args] The arguments to invoke `func` with. |
|
|
* @returns {number} Returns the timer id. |
|
|
* @example |
|
|
* |
|
|
* _.defer(function(text) { |
|
|
* console.log(text); |
|
|
* }, 'deferred'); |
|
|
* // => Logs 'deferred' after one millisecond. |
|
|
*/ |
|
|
var defer = baseRest(function(func, args) { |
|
|
return baseDelay(func, 1, args); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Invokes `func` after `wait` milliseconds. Any additional arguments are |
|
|
* provided to `func` when it's invoked. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to delay. |
|
|
* @param {number} wait The number of milliseconds to delay invocation. |
|
|
* @param {...*} [args] The arguments to invoke `func` with. |
|
|
* @returns {number} Returns the timer id. |
|
|
* @example |
|
|
* |
|
|
* _.delay(function(text) { |
|
|
* console.log(text); |
|
|
* }, 1000, 'later'); |
|
|
* // => Logs 'later' after one second. |
|
|
*/ |
|
|
var delay = baseRest(function(func, wait, args) { |
|
|
return baseDelay(func, toNumber(wait) || 0, args); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a function that memoizes the result of `func`. If `resolver` is |
|
|
* provided, it determines the cache key for storing the result based on the |
|
|
* arguments provided to the memoized function. By default, the first argument |
|
|
* provided to the memoized function is used as the map cache key. The `func` |
|
|
* is invoked with the `this` binding of the memoized function. |
|
|
* |
|
|
* **Note:** The cache is exposed as the `cache` property on the memoized |
|
|
* function. Its creation may be customized by replacing the `_.memoize.Cache` |
|
|
* constructor with one whose instances implement the |
|
|
* [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object) |
|
|
* method interface of `clear`, `delete`, `get`, `has`, and `set`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to have its output memoized. |
|
|
* @param {Function} [resolver] The function to resolve the cache key. |
|
|
* @returns {Function} Returns the new memoized function. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2 }; |
|
|
* var other = { 'c': 3, 'd': 4 }; |
|
|
* |
|
|
* var values = _.memoize(_.values); |
|
|
* values(object); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* values(other); |
|
|
* // => [3, 4] |
|
|
* |
|
|
* object.a = 2; |
|
|
* values(object); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* // Modify the result cache. |
|
|
* values.cache.set(object, ['a', 'b']); |
|
|
* values(object); |
|
|
* // => ['a', 'b'] |
|
|
* |
|
|
* // Replace `_.memoize.Cache`. |
|
|
* _.memoize.Cache = WeakMap; |
|
|
*/ |
|
|
function memoize(func, resolver) { |
|
|
if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
var memoized = function() { |
|
|
var args = arguments, |
|
|
key = resolver ? resolver.apply(this, args) : args[0], |
|
|
cache = memoized.cache; |
|
|
|
|
|
if (cache.has(key)) { |
|
|
return cache.get(key); |
|
|
} |
|
|
var result = func.apply(this, args); |
|
|
memoized.cache = cache.set(key, result) || cache; |
|
|
return result; |
|
|
}; |
|
|
memoized.cache = new (memoize.Cache || MapCache); |
|
|
return memoized; |
|
|
} |
|
|
|
|
|
// Expose `MapCache`. |
|
|
memoize.Cache = MapCache; |
|
|
|
|
|
/** |
|
|
* Creates a function that negates the result of the predicate `func`. The |
|
|
* `func` predicate is invoked with the `this` binding and arguments of the |
|
|
* created function. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Function |
|
|
* @param {Function} predicate The predicate to negate. |
|
|
* @returns {Function} Returns the new negated function. |
|
|
* @example |
|
|
* |
|
|
* function isEven(n) { |
|
|
* return n % 2 == 0; |
|
|
* } |
|
|
* |
|
|
* _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven)); |
|
|
* // => [1, 3, 5] |
|
|
*/ |
|
|
function negate(predicate) { |
|
|
if (typeof predicate != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
return function() { |
|
|
var args = arguments; |
|
|
switch (args.length) { |
|
|
case 0: return !predicate.call(this); |
|
|
case 1: return !predicate.call(this, args[0]); |
|
|
case 2: return !predicate.call(this, args[0], args[1]); |
|
|
case 3: return !predicate.call(this, args[0], args[1], args[2]); |
|
|
} |
|
|
return !predicate.apply(this, args); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that is restricted to invoking `func` once. Repeat calls |
|
|
* to the function return the value of the first invocation. The `func` is |
|
|
* invoked with the `this` binding and arguments of the created function. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new restricted function. |
|
|
* @example |
|
|
* |
|
|
* var initialize = _.once(createApplication); |
|
|
* initialize(); |
|
|
* initialize(); |
|
|
* // => `createApplication` is invoked once |
|
|
*/ |
|
|
function once(func) { |
|
|
return before(2, func); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the `this` binding of the |
|
|
* created function and arguments from `start` and beyond provided as |
|
|
* an array. |
|
|
* |
|
|
* **Note:** This method is based on the |
|
|
* [rest parameter](https://mdn.io/rest_parameters). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @returns {Function} Returns the new function. |
|
|
* @example |
|
|
* |
|
|
* var say = _.rest(function(what, names) { |
|
|
* return what + ' ' + _.initial(names).join(', ') + |
|
|
* (_.size(names) > 1 ? ', & ' : '') + _.last(names); |
|
|
* }); |
|
|
* |
|
|
* say('hello', 'fred', 'barney', 'pebbles'); |
|
|
* // => 'hello fred, barney, & pebbles' |
|
|
*/ |
|
|
function rest(func, start) { |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
start = start === undefined ? start : toInteger(start); |
|
|
return baseRest(func, start); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a throttled function that only invokes `func` at most once per |
|
|
* every `wait` milliseconds. The throttled function comes with a `cancel` |
|
|
* method to cancel delayed `func` invocations and a `flush` method to |
|
|
* immediately invoke them. Provide `options` to indicate whether `func` |
|
|
* should be invoked on the leading and/or trailing edge of the `wait` |
|
|
* timeout. The `func` is invoked with the last arguments provided to the |
|
|
* throttled function. Subsequent calls to the throttled function return the |
|
|
* result of the last `func` invocation. |
|
|
* |
|
|
* **Note:** If `leading` and `trailing` options are `true`, `func` is |
|
|
* invoked on the trailing edge of the timeout only if the throttled function |
|
|
* is invoked more than once during the `wait` timeout. |
|
|
* |
|
|
* If `wait` is `0` and `leading` is `false`, `func` invocation is deferred |
|
|
* until to the next tick, similar to `setTimeout` with a timeout of `0`. |
|
|
* |
|
|
* See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/) |
|
|
* for details over the differences between `_.throttle` and `_.debounce`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to throttle. |
|
|
* @param {number} [wait=0] The number of milliseconds to throttle invocations to. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.leading=true] |
|
|
* Specify invoking on the leading edge of the timeout. |
|
|
* @param {boolean} [options.trailing=true] |
|
|
* Specify invoking on the trailing edge of the timeout. |
|
|
* @returns {Function} Returns the new throttled function. |
|
|
* @example |
|
|
* |
|
|
* // Avoid excessively updating the position while scrolling. |
|
|
* jQuery(window).on('scroll', _.throttle(updatePosition, 100)); |
|
|
* |
|
|
* // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes. |
|
|
* var throttled = _.throttle(renewToken, 300000, { 'trailing': false }); |
|
|
* jQuery(element).on('click', throttled); |
|
|
* |
|
|
* // Cancel the trailing throttled invocation. |
|
|
* jQuery(window).on('popstate', throttled.cancel); |
|
|
*/ |
|
|
function throttle(func, wait, options) { |
|
|
var leading = true, |
|
|
trailing = true; |
|
|
|
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
if (isObject(options)) { |
|
|
leading = 'leading' in options ? !!options.leading : leading; |
|
|
trailing = 'trailing' in options ? !!options.trailing : trailing; |
|
|
} |
|
|
return debounce(func, wait, { |
|
|
'leading': leading, |
|
|
'maxWait': wait, |
|
|
'trailing': trailing |
|
|
}); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a shallow clone of `value`. |
|
|
* |
|
|
* **Note:** This method is loosely based on the |
|
|
* [structured clone algorithm](https://mdn.io/Structured_clone_algorithm) |
|
|
* and supports cloning arrays, array buffers, booleans, date objects, maps, |
|
|
* numbers, `Object` objects, regexes, sets, strings, symbols, and typed |
|
|
* arrays. The own enumerable properties of `arguments` objects are cloned |
|
|
* as plain objects. An empty object is returned for uncloneable values such |
|
|
* as error objects, functions, DOM nodes, and WeakMaps. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to clone. |
|
|
* @returns {*} Returns the cloned value. |
|
|
* @see _.cloneDeep |
|
|
* @example |
|
|
* |
|
|
* var objects = [{ 'a': 1 }, { 'b': 2 }]; |
|
|
* |
|
|
* var shallow = _.clone(objects); |
|
|
* console.log(shallow[0] === objects[0]); |
|
|
* // => true |
|
|
*/ |
|
|
function clone(value) { |
|
|
return baseClone(value, CLONE_SYMBOLS_FLAG); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.clone` except that it recursively clones `value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to recursively clone. |
|
|
* @returns {*} Returns the deep cloned value. |
|
|
* @see _.clone |
|
|
* @example |
|
|
* |
|
|
* var objects = [{ 'a': 1 }, { 'b': 2 }]; |
|
|
* |
|
|
* var deep = _.cloneDeep(objects); |
|
|
* console.log(deep[0] === objects[0]); |
|
|
* // => false |
|
|
*/ |
|
|
function cloneDeep(value) { |
|
|
return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Performs a |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* comparison between two values to determine if they are equivalent. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* var other = { 'a': 1 }; |
|
|
* |
|
|
* _.eq(object, object); |
|
|
* // => true |
|
|
* |
|
|
* _.eq(object, other); |
|
|
* // => false |
|
|
* |
|
|
* _.eq('a', 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.eq('a', Object('a')); |
|
|
* // => false |
|
|
* |
|
|
* _.eq(NaN, NaN); |
|
|
* // => true |
|
|
*/ |
|
|
function eq(value, other) { |
|
|
return value === other || (value !== value && other !== other); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is likely an `arguments` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an `arguments` object, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArguments(function() { return arguments; }()); |
|
|
* // => true |
|
|
* |
|
|
* _.isArguments([1, 2, 3]); |
|
|
* // => false |
|
|
*/ |
|
|
var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) { |
|
|
return isObjectLike(value) && hasOwnProperty.call(value, 'callee') && |
|
|
!propertyIsEnumerable.call(value, 'callee'); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as an `Array` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an array, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArray([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArray(document.body.children); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray('abc'); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
var isArray = Array.isArray; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is array-like. A value is considered array-like if it's |
|
|
* not a function and has a `value.length` that's an integer greater than or |
|
|
* equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is array-like, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArrayLike([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike(document.body.children); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike('abc'); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
function isArrayLike(value) { |
|
|
return value != null && isLength(value.length) && !isFunction(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.isArrayLike` except that it also checks if `value` |
|
|
* is an object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an array-like object, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArrayLikeObject([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLikeObject(document.body.children); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLikeObject('abc'); |
|
|
* // => false |
|
|
* |
|
|
* _.isArrayLikeObject(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
function isArrayLikeObject(value) { |
|
|
return isObjectLike(value) && isArrayLike(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a boolean primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a boolean, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isBoolean(false); |
|
|
* // => true |
|
|
* |
|
|
* _.isBoolean(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isBoolean(value) { |
|
|
return value === true || value === false || |
|
|
(isObjectLike(value) && baseGetTag(value) == boolTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a buffer. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a buffer, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isBuffer(new Buffer(2)); |
|
|
* // => true |
|
|
* |
|
|
* _.isBuffer(new Uint8Array(2)); |
|
|
* // => false |
|
|
*/ |
|
|
var isBuffer = nativeIsBuffer || stubFalse; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Date` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a date object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isDate(new Date); |
|
|
* // => true |
|
|
* |
|
|
* _.isDate('Mon April 23 2012'); |
|
|
* // => false |
|
|
*/ |
|
|
var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is an empty object, collection, map, or set. |
|
|
* |
|
|
* Objects are considered empty if they have no own enumerable string keyed |
|
|
* properties. |
|
|
* |
|
|
* Array-like values such as `arguments` objects, arrays, buffers, strings, or |
|
|
* jQuery-like collections are considered empty if they have a `length` of `0`. |
|
|
* Similarly, maps and sets are considered empty if they have a `size` of `0`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is empty, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isEmpty(null); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty(true); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty(1); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty([1, 2, 3]); |
|
|
* // => false |
|
|
* |
|
|
* _.isEmpty({ 'a': 1 }); |
|
|
* // => false |
|
|
*/ |
|
|
function isEmpty(value) { |
|
|
if (value == null) { |
|
|
return true; |
|
|
} |
|
|
if (isArrayLike(value) && |
|
|
(isArray(value) || typeof value == 'string' || typeof value.splice == 'function' || |
|
|
isBuffer(value) || isTypedArray(value) || isArguments(value))) { |
|
|
return !value.length; |
|
|
} |
|
|
var tag = getTag(value); |
|
|
if (tag == mapTag || tag == setTag) { |
|
|
return !value.size; |
|
|
} |
|
|
if (isPrototype(value)) { |
|
|
return !baseKeys(value).length; |
|
|
} |
|
|
for (var key in value) { |
|
|
if (hasOwnProperty.call(value, key)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Performs a deep comparison between two values to determine if they are |
|
|
* equivalent. |
|
|
* |
|
|
* **Note:** This method supports comparing arrays, array buffers, booleans, |
|
|
* date objects, error objects, maps, numbers, `Object` objects, regexes, |
|
|
* sets, strings, symbols, and typed arrays. `Object` objects are compared |
|
|
* by their own, not inherited, enumerable properties. Functions and DOM |
|
|
* nodes are compared by strict equality, i.e. `===`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* var other = { 'a': 1 }; |
|
|
* |
|
|
* _.isEqual(object, other); |
|
|
* // => true |
|
|
* |
|
|
* object === other; |
|
|
* // => false |
|
|
*/ |
|
|
function isEqual(value, other) { |
|
|
return baseIsEqual(value, other); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a finite primitive number. |
|
|
* |
|
|
* **Note:** This method is based on |
|
|
* [`Number.isFinite`](https://mdn.io/Number/isFinite). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a finite number, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isFinite(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isFinite(Number.MIN_VALUE); |
|
|
* // => true |
|
|
* |
|
|
* _.isFinite(Infinity); |
|
|
* // => false |
|
|
* |
|
|
* _.isFinite('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isFinite(value) { |
|
|
return typeof value == 'number' && nativeIsFinite(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Function` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a function, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isFunction(_); |
|
|
* // => true |
|
|
* |
|
|
* _.isFunction(/abc/); |
|
|
* // => false |
|
|
*/ |
|
|
function isFunction(value) { |
|
|
if (!isObject(value)) { |
|
|
return false; |
|
|
} |
|
|
// The use of `Object#toString` avoids issues with the `typeof` operator |
|
|
// in Safari 9 which returns 'object' for typed arrays and other constructors. |
|
|
var tag = baseGetTag(value); |
|
|
return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a valid array-like length. |
|
|
* |
|
|
* **Note:** This method is loosely based on |
|
|
* [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a valid length, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isLength(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isLength(Number.MIN_VALUE); |
|
|
* // => false |
|
|
* |
|
|
* _.isLength(Infinity); |
|
|
* // => false |
|
|
* |
|
|
* _.isLength('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isLength(value) { |
|
|
return typeof value == 'number' && |
|
|
value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is the |
|
|
* [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types) |
|
|
* of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`) |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isObject({}); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject(_.noop); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isObject(value) { |
|
|
var type = typeof value; |
|
|
return value != null && (type == 'object' || type == 'function'); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is object-like. A value is object-like if it's not `null` |
|
|
* and has a `typeof` result of "object". |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is object-like, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isObjectLike({}); |
|
|
* // => true |
|
|
* |
|
|
* _.isObjectLike([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isObjectLike(_.noop); |
|
|
* // => false |
|
|
* |
|
|
* _.isObjectLike(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isObjectLike(value) { |
|
|
return value != null && typeof value == 'object'; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Map` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a map, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isMap(new Map); |
|
|
* // => true |
|
|
* |
|
|
* _.isMap(new WeakMap); |
|
|
* // => false |
|
|
*/ |
|
|
var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `NaN`. |
|
|
* |
|
|
* **Note:** This method is based on |
|
|
* [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as |
|
|
* global [`isNaN`](https://mdn.io/isNaN) which returns `true` for |
|
|
* `undefined` and other non-number values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `NaN`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNaN(NaN); |
|
|
* // => true |
|
|
* |
|
|
* _.isNaN(new Number(NaN)); |
|
|
* // => true |
|
|
* |
|
|
* isNaN(undefined); |
|
|
* // => true |
|
|
* |
|
|
* _.isNaN(undefined); |
|
|
* // => false |
|
|
*/ |
|
|
function isNaN(value) { |
|
|
// An `NaN` primitive is the only value that is not equal to itself. |
|
|
// Perform the `toStringTag` check first to avoid errors with some |
|
|
// ActiveX objects in IE. |
|
|
return isNumber(value) && value != +value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `null`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `null`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNull(null); |
|
|
* // => true |
|
|
* |
|
|
* _.isNull(void 0); |
|
|
* // => false |
|
|
*/ |
|
|
function isNull(value) { |
|
|
return value === null; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Number` primitive or object. |
|
|
* |
|
|
* **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are |
|
|
* classified as numbers, use the `_.isFinite` method. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a number, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNumber(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber(Number.MIN_VALUE); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber(Infinity); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isNumber(value) { |
|
|
return typeof value == 'number' || |
|
|
(isObjectLike(value) && baseGetTag(value) == numberTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a plain object, that is, an object created by the |
|
|
* `Object` constructor or one with a `[[Prototype]]` of `null`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.8.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a plain object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* } |
|
|
* |
|
|
* _.isPlainObject(new Foo); |
|
|
* // => false |
|
|
* |
|
|
* _.isPlainObject([1, 2, 3]); |
|
|
* // => false |
|
|
* |
|
|
* _.isPlainObject({ 'x': 0, 'y': 0 }); |
|
|
* // => true |
|
|
* |
|
|
* _.isPlainObject(Object.create(null)); |
|
|
* // => true |
|
|
*/ |
|
|
function isPlainObject(value) { |
|
|
if (!isObjectLike(value) || baseGetTag(value) != objectTag) { |
|
|
return false; |
|
|
} |
|
|
var proto = getPrototype(value); |
|
|
if (proto === null) { |
|
|
return true; |
|
|
} |
|
|
var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor; |
|
|
return typeof Ctor == 'function' && Ctor instanceof Ctor && |
|
|
funcToString.call(Ctor) == objectCtorString; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `RegExp` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a regexp, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isRegExp(/abc/); |
|
|
* // => true |
|
|
* |
|
|
* _.isRegExp('/abc/'); |
|
|
* // => false |
|
|
*/ |
|
|
var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Set` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a set, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isSet(new Set); |
|
|
* // => true |
|
|
* |
|
|
* _.isSet(new WeakSet); |
|
|
* // => false |
|
|
*/ |
|
|
var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `String` primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a string, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isString('abc'); |
|
|
* // => true |
|
|
* |
|
|
* _.isString(1); |
|
|
* // => false |
|
|
*/ |
|
|
function isString(value) { |
|
|
return typeof value == 'string' || |
|
|
(!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Symbol` primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a symbol, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isSymbol(Symbol.iterator); |
|
|
* // => true |
|
|
* |
|
|
* _.isSymbol('abc'); |
|
|
* // => false |
|
|
*/ |
|
|
function isSymbol(value) { |
|
|
return typeof value == 'symbol' || |
|
|
(isObjectLike(value) && baseGetTag(value) == symbolTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a typed array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a typed array, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isTypedArray(new Uint8Array); |
|
|
* // => true |
|
|
* |
|
|
* _.isTypedArray([]); |
|
|
* // => false |
|
|
*/ |
|
|
var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `undefined`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `undefined`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isUndefined(void 0); |
|
|
* // => true |
|
|
* |
|
|
* _.isUndefined(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isUndefined(value) { |
|
|
return value === undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to an array. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
* @example |
|
|
* |
|
|
* _.toArray({ 'a': 1, 'b': 2 }); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* _.toArray('abc'); |
|
|
* // => ['a', 'b', 'c'] |
|
|
* |
|
|
* _.toArray(1); |
|
|
* // => [] |
|
|
* |
|
|
* _.toArray(null); |
|
|
* // => [] |
|
|
*/ |
|
|
function toArray(value) { |
|
|
if (!value) { |
|
|
return []; |
|
|
} |
|
|
if (isArrayLike(value)) { |
|
|
return isString(value) ? stringToArray(value) : copyArray(value); |
|
|
} |
|
|
if (symIterator && value[symIterator]) { |
|
|
return iteratorToArray(value[symIterator]()); |
|
|
} |
|
|
var tag = getTag(value), |
|
|
func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values); |
|
|
|
|
|
return func(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a finite number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.12.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {number} Returns the converted number. |
|
|
* @example |
|
|
* |
|
|
* _.toFinite(3.2); |
|
|
* // => 3.2 |
|
|
* |
|
|
* _.toFinite(Number.MIN_VALUE); |
|
|
* // => 5e-324 |
|
|
* |
|
|
* _.toFinite(Infinity); |
|
|
* // => 1.7976931348623157e+308 |
|
|
* |
|
|
* _.toFinite('3.2'); |
|
|
* // => 3.2 |
|
|
*/ |
|
|
function toFinite(value) { |
|
|
if (!value) { |
|
|
return value === 0 ? value : 0; |
|
|
} |
|
|
value = toNumber(value); |
|
|
if (value === INFINITY || value === -INFINITY) { |
|
|
var sign = (value < 0 ? -1 : 1); |
|
|
return sign * MAX_INTEGER; |
|
|
} |
|
|
return value === value ? value : 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to an integer. |
|
|
* |
|
|
* **Note:** This method is loosely based on |
|
|
* [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {number} Returns the converted integer. |
|
|
* @example |
|
|
* |
|
|
* _.toInteger(3.2); |
|
|
* // => 3 |
|
|
* |
|
|
* _.toInteger(Number.MIN_VALUE); |
|
|
* // => 0 |
|
|
* |
|
|
* _.toInteger(Infinity); |
|
|
* // => 1.7976931348623157e+308 |
|
|
* |
|
|
* _.toInteger('3.2'); |
|
|
* // => 3 |
|
|
*/ |
|
|
function toInteger(value) { |
|
|
var result = toFinite(value), |
|
|
remainder = result % 1; |
|
|
|
|
|
return result === result ? (remainder ? result - remainder : result) : 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to process. |
|
|
* @returns {number} Returns the number. |
|
|
* @example |
|
|
* |
|
|
* _.toNumber(3.2); |
|
|
* // => 3.2 |
|
|
* |
|
|
* _.toNumber(Number.MIN_VALUE); |
|
|
* // => 5e-324 |
|
|
* |
|
|
* _.toNumber(Infinity); |
|
|
* // => Infinity |
|
|
* |
|
|
* _.toNumber('3.2'); |
|
|
* // => 3.2 |
|
|
*/ |
|
|
function toNumber(value) { |
|
|
if (typeof value == 'number') { |
|
|
return value; |
|
|
} |
|
|
if (isSymbol(value)) { |
|
|
return NAN; |
|
|
} |
|
|
if (isObject(value)) { |
|
|
var other = typeof value.valueOf == 'function' ? value.valueOf() : value; |
|
|
value = isObject(other) ? (other + '') : other; |
|
|
} |
|
|
if (typeof value != 'string') { |
|
|
return value === 0 ? value : +value; |
|
|
} |
|
|
value = value.replace(reTrim, ''); |
|
|
var isBinary = reIsBinary.test(value); |
|
|
return (isBinary || reIsOctal.test(value)) |
|
|
? freeParseInt(value.slice(2), isBinary ? 2 : 8) |
|
|
: (reIsBadHex.test(value) ? NAN : +value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string. An empty string is returned for `null` |
|
|
* and `undefined` values. The sign of `-0` is preserved. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {string} Returns the converted string. |
|
|
* @example |
|
|
* |
|
|
* _.toString(null); |
|
|
* // => '' |
|
|
* |
|
|
* _.toString(-0); |
|
|
* // => '-0' |
|
|
* |
|
|
* _.toString([1, 2, 3]); |
|
|
* // => '1,2,3' |
|
|
*/ |
|
|
function toString(value) { |
|
|
return value == null ? '' : baseToString(value); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* This method is like `_.assign` except that it iterates over own and |
|
|
* inherited source properties. |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @alias extend |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} [sources] The source objects. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @see _.assign |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* } |
|
|
* |
|
|
* function Bar() { |
|
|
* this.c = 3; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.b = 2; |
|
|
* Bar.prototype.d = 4; |
|
|
* |
|
|
* _.assignIn({ 'a': 0 }, new Foo, new Bar); |
|
|
* // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 } |
|
|
*/ |
|
|
var assignIn = createAssigner(function(object, source) { |
|
|
copyObject(source, keysIn(source), object); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an object that inherits from the `prototype` object. If a |
|
|
* `properties` object is given, its own enumerable string keyed properties |
|
|
* are assigned to the created object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.3.0 |
|
|
* @category Object |
|
|
* @param {Object} prototype The object to inherit from. |
|
|
* @param {Object} [properties] The properties to assign to the object. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* function Shape() { |
|
|
* this.x = 0; |
|
|
* this.y = 0; |
|
|
* } |
|
|
* |
|
|
* function Circle() { |
|
|
* Shape.call(this); |
|
|
* } |
|
|
* |
|
|
* Circle.prototype = _.create(Shape.prototype, { |
|
|
* 'constructor': Circle |
|
|
* }); |
|
|
* |
|
|
* var circle = new Circle; |
|
|
* circle instanceof Circle; |
|
|
* // => true |
|
|
* |
|
|
* circle instanceof Shape; |
|
|
* // => true |
|
|
*/ |
|
|
function create(prototype, properties) { |
|
|
var result = baseCreate(prototype); |
|
|
return properties == null ? result : baseAssign(result, properties); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Assigns own and inherited enumerable string keyed properties of source |
|
|
* objects to the destination object for all destination properties that |
|
|
* resolve to `undefined`. Source objects are applied from left to right. |
|
|
* Once a property is set, additional values of the same property are ignored. |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} [sources] The source objects. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @see _.defaultsDeep |
|
|
* @example |
|
|
* |
|
|
* _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 }); |
|
|
* // => { 'a': 1, 'b': 2 } |
|
|
*/ |
|
|
var defaults = baseRest(function(object, sources) { |
|
|
object = Object(object); |
|
|
|
|
|
var index = -1; |
|
|
var length = sources.length; |
|
|
var guard = length > 2 ? sources[2] : undefined; |
|
|
|
|
|
if (guard && isIterateeCall(sources[0], sources[1], guard)) { |
|
|
length = 1; |
|
|
} |
|
|
|
|
|
while (++index < length) { |
|
|
var source = sources[index]; |
|
|
var props = keysIn(source); |
|
|
var propsIndex = -1; |
|
|
var propsLength = props.length; |
|
|
|
|
|
while (++propsIndex < propsLength) { |
|
|
var key = props[propsIndex]; |
|
|
var value = object[key]; |
|
|
|
|
|
if (value === undefined || |
|
|
(eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) { |
|
|
object[key] = source[key]; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return object; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* This method is like `_.find` except that it returns the key of the first |
|
|
* element `predicate` returns truthy for instead of the element itself. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.1.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {string|undefined} Returns the key of the matched element, |
|
|
* else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = { |
|
|
* 'barney': { 'age': 36, 'active': true }, |
|
|
* 'fred': { 'age': 40, 'active': false }, |
|
|
* 'pebbles': { 'age': 1, 'active': true } |
|
|
* }; |
|
|
* |
|
|
* _.findKey(users, function(o) { return o.age < 40; }); |
|
|
* // => 'barney' (iteration order is not guaranteed) |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findKey(users, { 'age': 1, 'active': true }); |
|
|
* // => 'pebbles' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findKey(users, ['active', false]); |
|
|
* // => 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findKey(users, 'active'); |
|
|
* // => 'barney' |
|
|
*/ |
|
|
function findKey(object, predicate) { |
|
|
return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.findKey` except that it iterates over elements of |
|
|
* a collection in the opposite order. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {string|undefined} Returns the key of the matched element, |
|
|
* else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = { |
|
|
* 'barney': { 'age': 36, 'active': true }, |
|
|
* 'fred': { 'age': 40, 'active': false }, |
|
|
* 'pebbles': { 'age': 1, 'active': true } |
|
|
* }; |
|
|
* |
|
|
* _.findLastKey(users, function(o) { return o.age < 40; }); |
|
|
* // => returns 'pebbles' assuming `_.findKey` returns 'barney' |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findLastKey(users, { 'age': 36, 'active': true }); |
|
|
* // => 'barney' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findLastKey(users, ['active', false]); |
|
|
* // => 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findLastKey(users, 'active'); |
|
|
* // => 'pebbles' |
|
|
*/ |
|
|
function findLastKey(object, predicate) { |
|
|
return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the value at `path` of `object`. If the resolved value is |
|
|
* `undefined`, the `defaultValue` is returned in its place. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.7.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @param {*} [defaultValue] The value returned for `undefined` resolved values. |
|
|
* @returns {*} Returns the resolved value. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c': 3 } }] }; |
|
|
* |
|
|
* _.get(object, 'a[0].b.c'); |
|
|
* // => 3 |
|
|
* |
|
|
* _.get(object, ['a', '0', 'b', 'c']); |
|
|
* // => 3 |
|
|
* |
|
|
* _.get(object, 'a.b.c', 'default'); |
|
|
* // => 'default' |
|
|
*/ |
|
|
function get(object, path, defaultValue) { |
|
|
var result = object == null ? undefined : baseGet(object, path); |
|
|
return result === undefined ? defaultValue : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` is a direct property of `object`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': { 'b': 2 } }; |
|
|
* var other = _.create({ 'a': _.create({ 'b': 2 }) }); |
|
|
* |
|
|
* _.has(object, 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.has(object, 'a.b'); |
|
|
* // => true |
|
|
* |
|
|
* _.has(object, ['a', 'b']); |
|
|
* // => true |
|
|
* |
|
|
* _.has(other, 'a'); |
|
|
* // => false |
|
|
*/ |
|
|
function has(object, path) { |
|
|
return object != null && hasPath(object, path, baseHas); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` is a direct or inherited property of `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = _.create({ 'a': _.create({ 'b': 2 }) }); |
|
|
* |
|
|
* _.hasIn(object, 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, 'a.b'); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, ['a', 'b']); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, 'b'); |
|
|
* // => false |
|
|
*/ |
|
|
function hasIn(object, path) { |
|
|
return object != null && hasPath(object, path, baseHasIn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the inverted keys and values of `object`. |
|
|
* If `object` contains duplicate values, subsequent values overwrite |
|
|
* property assignments of previous values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.7.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to invert. |
|
|
* @returns {Object} Returns the new inverted object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2, 'c': 1 }; |
|
|
* |
|
|
* _.invert(object); |
|
|
* // => { '1': 'c', '2': 'b' } |
|
|
*/ |
|
|
var invert = createInverter(function(result, value, key) { |
|
|
if (value != null && |
|
|
typeof value.toString != 'function') { |
|
|
value = nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
result[value] = key; |
|
|
}, constant(identity)); |
|
|
|
|
|
/** |
|
|
* This method is like `_.invert` except that the inverted object is generated |
|
|
* from the results of running each element of `object` thru `iteratee`. The |
|
|
* corresponding inverted value of each inverted key is an array of keys |
|
|
* responsible for generating the inverted value. The iteratee is invoked |
|
|
* with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.1.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to invert. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee invoked per element. |
|
|
* @returns {Object} Returns the new inverted object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2, 'c': 1 }; |
|
|
* |
|
|
* _.invertBy(object); |
|
|
* // => { '1': ['a', 'c'], '2': ['b'] } |
|
|
* |
|
|
* _.invertBy(object, function(value) { |
|
|
* return 'group' + value; |
|
|
* }); |
|
|
* // => { 'group1': ['a', 'c'], 'group2': ['b'] } |
|
|
*/ |
|
|
var invertBy = createInverter(function(result, value, key) { |
|
|
if (value != null && |
|
|
typeof value.toString != 'function') { |
|
|
value = nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
if (hasOwnProperty.call(result, value)) { |
|
|
result[value].push(key); |
|
|
} else { |
|
|
result[value] = [key]; |
|
|
} |
|
|
}, baseIteratee); |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable property names of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. See the |
|
|
* [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys) |
|
|
* for more details. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.keys(new Foo); |
|
|
* // => ['a', 'b'] (iteration order is not guaranteed) |
|
|
* |
|
|
* _.keys('hi'); |
|
|
* // => ['0', '1'] |
|
|
*/ |
|
|
function keys(object) { |
|
|
return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own and inherited enumerable property names of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.keysIn(new Foo); |
|
|
* // => ['a', 'b', 'c'] (iteration order is not guaranteed) |
|
|
*/ |
|
|
function keysIn(object) { |
|
|
return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The opposite of `_.pick`; this method creates an object composed of the |
|
|
* own and inherited enumerable property paths of `object` that are not omitted. |
|
|
* |
|
|
* **Note:** This method is considerably slower than `_.pick`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {...(string|string[])} [paths] The property paths to omit. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.omit(object, ['a', 'c']); |
|
|
* // => { 'b': '2' } |
|
|
*/ |
|
|
var omit = flatRest(function(object, paths) { |
|
|
var result = {}; |
|
|
if (object == null) { |
|
|
return result; |
|
|
} |
|
|
var isDeep = false; |
|
|
paths = arrayMap(paths, function(path) { |
|
|
path = castPath(path, object); |
|
|
isDeep || (isDeep = path.length > 1); |
|
|
return path; |
|
|
}); |
|
|
copyObject(object, getAllKeysIn(object), result); |
|
|
if (isDeep) { |
|
|
result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone); |
|
|
} |
|
|
var length = paths.length; |
|
|
while (length--) { |
|
|
baseUnset(result, paths[length]); |
|
|
} |
|
|
return result; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* The opposite of `_.pickBy`; this method creates an object composed of |
|
|
* the own and inherited enumerable string keyed properties of `object` that |
|
|
* `predicate` doesn't return truthy for. The predicate is invoked with two |
|
|
* arguments: (value, key). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.omitBy(object, _.isNumber); |
|
|
* // => { 'b': '2' } |
|
|
*/ |
|
|
function omitBy(object, predicate) { |
|
|
return pickBy(object, negate(baseIteratee(predicate))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the picked `object` properties. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {...(string|string[])} [paths] The property paths to pick. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.pick(object, ['a', 'c']); |
|
|
* // => { 'a': 1, 'c': 3 } |
|
|
*/ |
|
|
var pick = flatRest(function(object, paths) { |
|
|
return object == null ? {} : basePick(object, paths); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the `object` properties `predicate` returns |
|
|
* truthy for. The predicate is invoked with two arguments: (value, key). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.pickBy(object, _.isNumber); |
|
|
* // => { 'a': 1, 'c': 3 } |
|
|
*/ |
|
|
function pickBy(object, predicate) { |
|
|
if (object == null) { |
|
|
return {}; |
|
|
} |
|
|
var props = arrayMap(getAllKeysIn(object), function(prop) { |
|
|
return [prop]; |
|
|
}); |
|
|
predicate = baseIteratee(predicate); |
|
|
return basePickBy(object, props, function(value, path) { |
|
|
return predicate(value, path[0]); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.get` except that if the resolved value is a |
|
|
* function it's invoked with the `this` binding of its parent object and |
|
|
* its result is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to resolve. |
|
|
* @param {*} [defaultValue] The value returned for `undefined` resolved values. |
|
|
* @returns {*} Returns the resolved value. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] }; |
|
|
* |
|
|
* _.result(object, 'a[0].b.c1'); |
|
|
* // => 3 |
|
|
* |
|
|
* _.result(object, 'a[0].b.c2'); |
|
|
* // => 4 |
|
|
* |
|
|
* _.result(object, 'a[0].b.c3', 'default'); |
|
|
* // => 'default' |
|
|
* |
|
|
* _.result(object, 'a[0].b.c3', _.constant('default')); |
|
|
* // => 'default' |
|
|
*/ |
|
|
function result(object, path, defaultValue) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length; |
|
|
|
|
|
// Ensure the loop is entered when path is empty. |
|
|
if (!length) { |
|
|
length = 1; |
|
|
object = undefined; |
|
|
} |
|
|
while (++index < length) { |
|
|
var value = object == null ? undefined : object[toKey(path[index])]; |
|
|
if (value === undefined) { |
|
|
index = length; |
|
|
value = defaultValue; |
|
|
} |
|
|
object = isFunction(value) ? value.call(object) : value; |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable string keyed property values of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property values. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.values(new Foo); |
|
|
* // => [1, 2] (iteration order is not guaranteed) |
|
|
* |
|
|
* _.values('hi'); |
|
|
* // => ['h', 'i'] |
|
|
*/ |
|
|
function values(object) { |
|
|
return object == null ? [] : baseValues(object, keys(object)); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Clamps `number` within the inclusive `lower` and `upper` bounds. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Number |
|
|
* @param {number} number The number to clamp. |
|
|
* @param {number} [lower] The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the clamped number. |
|
|
* @example |
|
|
* |
|
|
* _.clamp(-10, -5, 5); |
|
|
* // => -5 |
|
|
* |
|
|
* _.clamp(10, -5, 5); |
|
|
* // => 5 |
|
|
*/ |
|
|
function clamp(number, lower, upper) { |
|
|
if (upper === undefined) { |
|
|
upper = lower; |
|
|
lower = undefined; |
|
|
} |
|
|
if (upper !== undefined) { |
|
|
upper = toNumber(upper); |
|
|
upper = upper === upper ? upper : 0; |
|
|
} |
|
|
if (lower !== undefined) { |
|
|
lower = toNumber(lower); |
|
|
lower = lower === lower ? lower : 0; |
|
|
} |
|
|
return baseClamp(toNumber(number), lower, upper); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Produces a random number between the inclusive `lower` and `upper` bounds. |
|
|
* If only one argument is provided a number between `0` and the given number |
|
|
* is returned. If `floating` is `true`, or either `lower` or `upper` are |
|
|
* floats, a floating-point number is returned instead of an integer. |
|
|
* |
|
|
* **Note:** JavaScript follows the IEEE-754 standard for resolving |
|
|
* floating-point values which can produce unexpected results. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.7.0 |
|
|
* @category Number |
|
|
* @param {number} [lower=0] The lower bound. |
|
|
* @param {number} [upper=1] The upper bound. |
|
|
* @param {boolean} [floating] Specify returning a floating-point number. |
|
|
* @returns {number} Returns the random number. |
|
|
* @example |
|
|
* |
|
|
* _.random(0, 5); |
|
|
* // => an integer between 0 and 5 |
|
|
* |
|
|
* _.random(5); |
|
|
* // => also an integer between 0 and 5 |
|
|
* |
|
|
* _.random(5, true); |
|
|
* // => a floating-point number between 0 and 5 |
|
|
* |
|
|
* _.random(1.2, 5.2); |
|
|
* // => a floating-point number between 1.2 and 5.2 |
|
|
*/ |
|
|
function random(lower, upper, floating) { |
|
|
if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) { |
|
|
upper = floating = undefined; |
|
|
} |
|
|
if (floating === undefined) { |
|
|
if (typeof upper == 'boolean') { |
|
|
floating = upper; |
|
|
upper = undefined; |
|
|
} |
|
|
else if (typeof lower == 'boolean') { |
|
|
floating = lower; |
|
|
lower = undefined; |
|
|
} |
|
|
} |
|
|
if (lower === undefined && upper === undefined) { |
|
|
lower = 0; |
|
|
upper = 1; |
|
|
} |
|
|
else { |
|
|
lower = toFinite(lower); |
|
|
if (upper === undefined) { |
|
|
upper = lower; |
|
|
lower = 0; |
|
|
} else { |
|
|
upper = toFinite(upper); |
|
|
} |
|
|
} |
|
|
if (lower > upper) { |
|
|
var temp = lower; |
|
|
lower = upper; |
|
|
upper = temp; |
|
|
} |
|
|
if (floating || lower % 1 || upper % 1) { |
|
|
var rand = nativeRandom(); |
|
|
return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper); |
|
|
} |
|
|
return baseRandom(lower, upper); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Converts the characters "&", "<", ">", '"', and "'" in `string` to their |
|
|
* corresponding HTML entities. |
|
|
* |
|
|
* **Note:** No other characters are escaped. To escape additional |
|
|
* characters use a third-party library like [_he_](https://mths.be/he). |
|
|
* |
|
|
* Though the ">" character is escaped for symmetry, characters like |
|
|
* ">" and "/" don't need escaping in HTML and have no special meaning |
|
|
* unless they're part of a tag or unquoted attribute value. See |
|
|
* [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands) |
|
|
* (under "semi-related fun fact") for more details. |
|
|
* |
|
|
* When working with HTML you should always |
|
|
* [quote attribute values](http://wonko.com/post/html-escaping) to reduce |
|
|
* XSS vectors. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category String |
|
|
* @param {string} [string=''] The string to escape. |
|
|
* @returns {string} Returns the escaped string. |
|
|
* @example |
|
|
* |
|
|
* _.escape('fred, barney, & pebbles'); |
|
|
* // => 'fred, barney, & pebbles' |
|
|
*/ |
|
|
function escape(string) { |
|
|
string = toString(string); |
|
|
return (string && reHasUnescapedHtml.test(string)) |
|
|
? string.replace(reUnescapedHtml, escapeHtmlChar) |
|
|
: string; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a function that returns `value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Util |
|
|
* @param {*} value The value to return from the new function. |
|
|
* @returns {Function} Returns the new constant function. |
|
|
* @example |
|
|
* |
|
|
* var objects = _.times(2, _.constant({ 'a': 1 })); |
|
|
* |
|
|
* console.log(objects); |
|
|
* // => [{ 'a': 1 }, { 'a': 1 }] |
|
|
* |
|
|
* console.log(objects[0] === objects[1]); |
|
|
* // => true |
|
|
*/ |
|
|
function constant(value) { |
|
|
return function() { |
|
|
return value; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns the first argument it receives. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {*} value Any value. |
|
|
* @returns {*} Returns `value`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* |
|
|
* console.log(_.identity(object) === object); |
|
|
* // => true |
|
|
*/ |
|
|
function identity(value) { |
|
|
return value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the arguments of the created |
|
|
* function. If `func` is a property name, the created function returns the |
|
|
* property value for a given element. If `func` is an array or object, the |
|
|
* created function returns `true` for elements that contain the equivalent |
|
|
* source properties, otherwise it returns `false`. |
|
|
* |
|
|
* @static |
|
|
* @since 4.0.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {*} [func=_.identity] The value to convert to a callback. |
|
|
* @returns {Function} Returns the callback. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.filter(users, _.iteratee({ 'user': 'barney', 'active': true })); |
|
|
* // => [{ 'user': 'barney', 'age': 36, 'active': true }] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.filter(users, _.iteratee(['user', 'fred'])); |
|
|
* // => [{ 'user': 'fred', 'age': 40 }] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.map(users, _.iteratee('user')); |
|
|
* // => ['barney', 'fred'] |
|
|
* |
|
|
* // Create custom iteratee shorthands. |
|
|
* _.iteratee = _.wrap(_.iteratee, function(iteratee, func) { |
|
|
* return !_.isRegExp(func) ? iteratee(func) : function(string) { |
|
|
* return func.test(string); |
|
|
* }; |
|
|
* }); |
|
|
* |
|
|
* _.filter(['abc', 'def'], /ef/); |
|
|
* // => ['def'] |
|
|
*/ |
|
|
function iteratee(func) { |
|
|
return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that performs a partial deep comparison between a given |
|
|
* object and `source`, returning `true` if the given object has equivalent |
|
|
* property values, else `false`. |
|
|
* |
|
|
* **Note:** The created function is equivalent to `_.isMatch` with `source` |
|
|
* partially applied. |
|
|
* |
|
|
* Partial comparisons will match empty array and empty object `source` |
|
|
* values against any array or object value, respectively. See `_.isEqual` |
|
|
* for a list of supported value comparisons. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Util |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
* @example |
|
|
* |
|
|
* var objects = [ |
|
|
* { 'a': 1, 'b': 2, 'c': 3 }, |
|
|
* { 'a': 4, 'b': 5, 'c': 6 } |
|
|
* ]; |
|
|
* |
|
|
* _.filter(objects, _.matches({ 'a': 4, 'c': 6 })); |
|
|
* // => [{ 'a': 4, 'b': 5, 'c': 6 }] |
|
|
*/ |
|
|
function matches(source) { |
|
|
return baseMatches(baseClone(source, CLONE_DEEP_FLAG)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Adds all own enumerable string keyed function properties of a source |
|
|
* object to the destination object. If `object` is a function, then methods |
|
|
* are added to its prototype as well. |
|
|
* |
|
|
* **Note:** Use `_.runInContext` to create a pristine `lodash` function to |
|
|
* avoid conflicts caused by modifying the original. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {Function|Object} [object=lodash] The destination object. |
|
|
* @param {Object} source The object of functions to add. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.chain=true] Specify whether mixins are chainable. |
|
|
* @returns {Function|Object} Returns `object`. |
|
|
* @example |
|
|
* |
|
|
* function vowels(string) { |
|
|
* return _.filter(string, function(v) { |
|
|
* return /[aeiou]/i.test(v); |
|
|
* }); |
|
|
* } |
|
|
* |
|
|
* _.mixin({ 'vowels': vowels }); |
|
|
* _.vowels('fred'); |
|
|
* // => ['e'] |
|
|
* |
|
|
* _('fred').vowels().value(); |
|
|
* // => ['e'] |
|
|
* |
|
|
* _.mixin({ 'vowels': vowels }, { 'chain': false }); |
|
|
* _('fred').vowels(); |
|
|
* // => ['e'] |
|
|
*/ |
|
|
function mixin(object, source, options) { |
|
|
var props = keys(source), |
|
|
methodNames = baseFunctions(source, props); |
|
|
|
|
|
if (options == null && |
|
|
!(isObject(source) && (methodNames.length || !props.length))) { |
|
|
options = source; |
|
|
source = object; |
|
|
object = this; |
|
|
methodNames = baseFunctions(source, keys(source)); |
|
|
} |
|
|
var chain = !(isObject(options) && 'chain' in options) || !!options.chain, |
|
|
isFunc = isFunction(object); |
|
|
|
|
|
arrayEach(methodNames, function(methodName) { |
|
|
var func = source[methodName]; |
|
|
object[methodName] = func; |
|
|
if (isFunc) { |
|
|
object.prototype[methodName] = function() { |
|
|
var chainAll = this.__chain__; |
|
|
if (chain || chainAll) { |
|
|
var result = object(this.__wrapped__), |
|
|
actions = result.__actions__ = copyArray(this.__actions__); |
|
|
|
|
|
actions.push({ 'func': func, 'args': arguments, 'thisArg': object }); |
|
|
result.__chain__ = chainAll; |
|
|
return result; |
|
|
} |
|
|
return func.apply(object, arrayPush([this.value()], arguments)); |
|
|
}; |
|
|
} |
|
|
}); |
|
|
|
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverts the `_` variable to its previous value and returns a reference to |
|
|
* the `lodash` function. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @returns {Function} Returns the `lodash` function. |
|
|
* @example |
|
|
* |
|
|
* var lodash = _.noConflict(); |
|
|
*/ |
|
|
function noConflict() { |
|
|
if (root._ === this) { |
|
|
root._ = oldDash; |
|
|
} |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns `undefined`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.3.0 |
|
|
* @category Util |
|
|
* @example |
|
|
* |
|
|
* _.times(2, _.noop); |
|
|
* // => [undefined, undefined] |
|
|
*/ |
|
|
function noop() { |
|
|
// No operation performed. |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that returns the value at `path` of a given object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Util |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
* @example |
|
|
* |
|
|
* var objects = [ |
|
|
* { 'a': { 'b': 2 } }, |
|
|
* { 'a': { 'b': 1 } } |
|
|
* ]; |
|
|
* |
|
|
* _.map(objects, _.property('a.b')); |
|
|
* // => [2, 1] |
|
|
* |
|
|
* _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b'); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function property(path) { |
|
|
return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of numbers (positive and/or negative) progressing from |
|
|
* `start` up to, but not including, `end`. A step of `-1` is used if a negative |
|
|
* `start` is specified without an `end` or `step`. If `end` is not specified, |
|
|
* it's set to `start` with `start` then set to `0`. |
|
|
* |
|
|
* **Note:** JavaScript follows the IEEE-754 standard for resolving |
|
|
* floating-point values which can produce unexpected results. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {number} [start=0] The start of the range. |
|
|
* @param {number} end The end of the range. |
|
|
* @param {number} [step=1] The value to increment or decrement by. |
|
|
* @returns {Array} Returns the range of numbers. |
|
|
* @see _.inRange, _.rangeRight |
|
|
* @example |
|
|
* |
|
|
* _.range(4); |
|
|
* // => [0, 1, 2, 3] |
|
|
* |
|
|
* _.range(-4); |
|
|
* // => [0, -1, -2, -3] |
|
|
* |
|
|
* _.range(1, 5); |
|
|
* // => [1, 2, 3, 4] |
|
|
* |
|
|
* _.range(0, 20, 5); |
|
|
* // => [0, 5, 10, 15] |
|
|
* |
|
|
* _.range(0, -4, -1); |
|
|
* // => [0, -1, -2, -3] |
|
|
* |
|
|
* _.range(1, 4, 0); |
|
|
* // => [1, 1, 1] |
|
|
* |
|
|
* _.range(0); |
|
|
* // => [] |
|
|
*/ |
|
|
var range = createRange(); |
|
|
|
|
|
/** |
|
|
* This method returns a new empty array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.13.0 |
|
|
* @category Util |
|
|
* @returns {Array} Returns the new empty array. |
|
|
* @example |
|
|
* |
|
|
* var arrays = _.times(2, _.stubArray); |
|
|
* |
|
|
* console.log(arrays); |
|
|
* // => [[], []] |
|
|
* |
|
|
* console.log(arrays[0] === arrays[1]); |
|
|
* // => false |
|
|
*/ |
|
|
function stubArray() { |
|
|
return []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns `false`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.13.0 |
|
|
* @category Util |
|
|
* @returns {boolean} Returns `false`. |
|
|
* @example |
|
|
* |
|
|
* _.times(2, _.stubFalse); |
|
|
* // => [false, false] |
|
|
*/ |
|
|
function stubFalse() { |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Generates a unique ID. If `prefix` is given, the ID is appended to it. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {string} [prefix=''] The value to prefix the ID with. |
|
|
* @returns {string} Returns the unique ID. |
|
|
* @example |
|
|
* |
|
|
* _.uniqueId('contact_'); |
|
|
* // => 'contact_104' |
|
|
* |
|
|
* _.uniqueId(); |
|
|
* // => '105' |
|
|
*/ |
|
|
function uniqueId(prefix) { |
|
|
var id = ++idCounter; |
|
|
return toString(prefix) + id; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Computes the maximum value of `array`. If `array` is empty or falsey, |
|
|
* `undefined` is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Math |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @returns {*} Returns the maximum value. |
|
|
* @example |
|
|
* |
|
|
* _.max([4, 2, 8, 6]); |
|
|
* // => 8 |
|
|
* |
|
|
* _.max([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function max(array) { |
|
|
return (array && array.length) |
|
|
? baseExtremum(array, identity, baseGt) |
|
|
: undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Computes the minimum value of `array`. If `array` is empty or falsey, |
|
|
* `undefined` is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Math |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @returns {*} Returns the minimum value. |
|
|
* @example |
|
|
* |
|
|
* _.min([4, 2, 8, 6]); |
|
|
* // => 2 |
|
|
* |
|
|
* _.min([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function min(array) { |
|
|
return (array && array.length) |
|
|
? baseExtremum(array, identity, baseLt) |
|
|
: undefined; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
// Add methods that return wrapped values in chain sequences. |
|
|
lodash.assignIn = assignIn; |
|
|
lodash.before = before; |
|
|
lodash.bind = bind; |
|
|
lodash.chain = chain; |
|
|
lodash.compact = compact; |
|
|
lodash.concat = concat; |
|
|
lodash.countBy = countBy; |
|
|
lodash.create = create; |
|
|
lodash.debounce = debounce; |
|
|
lodash.defaults = defaults; |
|
|
lodash.defer = defer; |
|
|
lodash.delay = delay; |
|
|
lodash.difference = difference; |
|
|
lodash.drop = drop; |
|
|
lodash.filter = filter; |
|
|
lodash.flatten = flatten; |
|
|
lodash.flattenDeep = flattenDeep; |
|
|
lodash.initial = initial; |
|
|
lodash.intersection = intersection; |
|
|
lodash.invert = invert; |
|
|
lodash.invertBy = invertBy; |
|
|
lodash.iteratee = iteratee; |
|
|
lodash.keys = keys; |
|
|
lodash.map = map; |
|
|
lodash.matches = matches; |
|
|
lodash.mixin = mixin; |
|
|
lodash.negate = negate; |
|
|
lodash.omit = omit; |
|
|
lodash.omitBy = omitBy; |
|
|
lodash.once = once; |
|
|
lodash.pick = pick; |
|
|
lodash.range = range; |
|
|
lodash.reject = reject; |
|
|
lodash.rest = rest; |
|
|
lodash.slice = slice; |
|
|
lodash.sortBy = sortBy; |
|
|
lodash.take = take; |
|
|
lodash.takeRight = takeRight; |
|
|
lodash.tap = tap; |
|
|
lodash.throttle = throttle; |
|
|
lodash.thru = thru; |
|
|
lodash.toArray = toArray; |
|
|
lodash.union = union; |
|
|
lodash.uniq = uniq; |
|
|
lodash.uniqBy = uniqBy; |
|
|
lodash.unzip = unzip; |
|
|
lodash.values = values; |
|
|
lodash.without = without; |
|
|
lodash.zip = zip; |
|
|
lodash.zipObject = zipObject; |
|
|
|
|
|
// Add aliases. |
|
|
lodash.extend = assignIn; |
|
|
|
|
|
// Add methods to `lodash.prototype`. |
|
|
mixin(lodash, lodash); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
// Add methods that return unwrapped values in chain sequences. |
|
|
lodash.clamp = clamp; |
|
|
lodash.clone = clone; |
|
|
lodash.cloneDeep = cloneDeep; |
|
|
lodash.escape = escape; |
|
|
lodash.every = every; |
|
|
lodash.find = find; |
|
|
lodash.findIndex = findIndex; |
|
|
lodash.findKey = findKey; |
|
|
lodash.findLastIndex = findLastIndex; |
|
|
lodash.findLastKey = findLastKey; |
|
|
lodash.forEach = forEach; |
|
|
lodash.get = get; |
|
|
lodash.has = has; |
|
|
lodash.head = head; |
|
|
lodash.identity = identity; |
|
|
lodash.indexOf = indexOf; |
|
|
lodash.isArguments = isArguments; |
|
|
lodash.isArray = isArray; |
|
|
lodash.isArrayLike = isArrayLike; |
|
|
lodash.isBoolean = isBoolean; |
|
|
lodash.isDate = isDate; |
|
|
lodash.isEmpty = isEmpty; |
|
|
lodash.isEqual = isEqual; |
|
|
lodash.isFinite = isFinite; |
|
|
lodash.isFunction = isFunction; |
|
|
lodash.isNaN = isNaN; |
|
|
lodash.isNull = isNull; |
|
|
lodash.isNumber = isNumber; |
|
|
lodash.isObject = isObject; |
|
|
lodash.isPlainObject = isPlainObject; |
|
|
lodash.isRegExp = isRegExp; |
|
|
lodash.isString = isString; |
|
|
lodash.isUndefined = isUndefined; |
|
|
lodash.last = last; |
|
|
lodash.max = max; |
|
|
lodash.min = min; |
|
|
lodash.noConflict = noConflict; |
|
|
lodash.noop = noop; |
|
|
lodash.random = random; |
|
|
lodash.reduce = reduce; |
|
|
lodash.result = result; |
|
|
lodash.size = size; |
|
|
lodash.some = some; |
|
|
lodash.uniqueId = uniqueId; |
|
|
|
|
|
// Add aliases. |
|
|
lodash.each = forEach; |
|
|
lodash.first = head; |
|
|
|
|
|
mixin(lodash, (function() { |
|
|
var source = {}; |
|
|
baseForOwn(lodash, function(func, methodName) { |
|
|
if (!hasOwnProperty.call(lodash.prototype, methodName)) { |
|
|
source[methodName] = func; |
|
|
} |
|
|
}); |
|
|
return source; |
|
|
}()), { 'chain': false }); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* The semantic version number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @type {string} |
|
|
*/ |
|
|
lodash.VERSION = VERSION; |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.drop` and `_.take` variants. |
|
|
arrayEach(['drop', 'take'], function(methodName, index) { |
|
|
LazyWrapper.prototype[methodName] = function(n) { |
|
|
n = n === undefined ? 1 : nativeMax(toInteger(n), 0); |
|
|
|
|
|
var result = (this.__filtered__ && !index) |
|
|
? new LazyWrapper(this) |
|
|
: this.clone(); |
|
|
|
|
|
if (result.__filtered__) { |
|
|
result.__takeCount__ = nativeMin(n, result.__takeCount__); |
|
|
} else { |
|
|
result.__views__.push({ |
|
|
'size': nativeMin(n, MAX_ARRAY_LENGTH), |
|
|
'type': methodName + (result.__dir__ < 0 ? 'Right' : '') |
|
|
}); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype[methodName + 'Right'] = function(n) { |
|
|
return this.reverse()[methodName](n).reverse(); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods that accept an `iteratee` value. |
|
|
arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) { |
|
|
var type = index + 1, |
|
|
isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG; |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function(iteratee) { |
|
|
var result = this.clone(); |
|
|
result.__iteratees__.push({ |
|
|
'iteratee': getIteratee(iteratee, 3), |
|
|
'type': type |
|
|
}); |
|
|
result.__filtered__ = result.__filtered__ || isFilter; |
|
|
return result; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.head` and `_.last`. |
|
|
arrayEach(['head', 'last'], function(methodName, index) { |
|
|
var takeName = 'take' + (index ? 'Right' : ''); |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function() { |
|
|
return this[takeName](1).value()[0]; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.initial` and `_.tail`. |
|
|
arrayEach(['initial', 'tail'], function(methodName, index) { |
|
|
var dropName = 'drop' + (index ? '' : 'Right'); |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function() { |
|
|
return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1); |
|
|
}; |
|
|
}); |
|
|
|
|
|
LazyWrapper.prototype.compact = function() { |
|
|
return this.filter(identity); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.find = function(predicate) { |
|
|
return this.filter(predicate).head(); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.findLast = function(predicate) { |
|
|
return this.reverse().find(predicate); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.invokeMap = baseRest(function(path, args) { |
|
|
if (typeof path == 'function') { |
|
|
return new LazyWrapper(this); |
|
|
} |
|
|
return this.map(function(value) { |
|
|
return baseInvoke(value, path, args); |
|
|
}); |
|
|
}); |
|
|
|
|
|
LazyWrapper.prototype.reject = function(predicate) { |
|
|
return this.filter(negate(getIteratee(predicate))); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.slice = function(start, end) { |
|
|
start = toInteger(start); |
|
|
|
|
|
var result = this; |
|
|
if (result.__filtered__ && (start > 0 || end < 0)) { |
|
|
return new LazyWrapper(result); |
|
|
} |
|
|
if (start < 0) { |
|
|
result = result.takeRight(-start); |
|
|
} else if (start) { |
|
|
result = result.drop(start); |
|
|
} |
|
|
if (end !== undefined) { |
|
|
end = toInteger(end); |
|
|
result = end < 0 ? result.dropRight(-end) : result.take(end - start); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.takeRightWhile = function(predicate) { |
|
|
return this.reverse().takeWhile(predicate).reverse(); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.toArray = function() { |
|
|
return this.take(MAX_ARRAY_LENGTH); |
|
|
}; |
|
|
|
|
|
// Add `LazyWrapper` methods to `lodash.prototype`. |
|
|
baseForOwn(LazyWrapper.prototype, function(func, methodName) { |
|
|
var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName), |
|
|
isTaker = /^(?:head|last)$/.test(methodName), |
|
|
lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName], |
|
|
retUnwrapped = isTaker || /^find/.test(methodName); |
|
|
|
|
|
if (!lodashFunc) { |
|
|
return; |
|
|
} |
|
|
lodash.prototype[methodName] = function() { |
|
|
var value = this.__wrapped__, |
|
|
args = isTaker ? [1] : arguments, |
|
|
isLazy = value instanceof LazyWrapper, |
|
|
iteratee = args[0], |
|
|
useLazy = isLazy || isArray(value); |
|
|
|
|
|
var interceptor = function(value) { |
|
|
var result = lodashFunc.apply(lodash, arrayPush([value], args)); |
|
|
return (isTaker && chainAll) ? result[0] : result; |
|
|
}; |
|
|
|
|
|
if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) { |
|
|
// Avoid lazy use if the iteratee has a "length" value other than `1`. |
|
|
isLazy = useLazy = false; |
|
|
} |
|
|
var chainAll = this.__chain__, |
|
|
isHybrid = !!this.__actions__.length, |
|
|
isUnwrapped = retUnwrapped && !chainAll, |
|
|
onlyLazy = isLazy && !isHybrid; |
|
|
|
|
|
if (!retUnwrapped && useLazy) { |
|
|
value = onlyLazy ? value : new LazyWrapper(this); |
|
|
var result = func.apply(value, args); |
|
|
result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined }); |
|
|
return new LodashWrapper(result, chainAll); |
|
|
} |
|
|
if (isUnwrapped && onlyLazy) { |
|
|
return func.apply(this, args); |
|
|
} |
|
|
result = this.thru(interceptor); |
|
|
return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `Array` methods to `lodash.prototype`. |
|
|
arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) { |
|
|
var func = arrayProto[methodName], |
|
|
chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru', |
|
|
retUnwrapped = /^(?:pop|shift)$/.test(methodName); |
|
|
|
|
|
lodash.prototype[methodName] = function() { |
|
|
var args = arguments; |
|
|
if (retUnwrapped && !this.__chain__) { |
|
|
var value = this.value(); |
|
|
return func.apply(isArray(value) ? value : [], args); |
|
|
} |
|
|
return this[chainName](function(value) { |
|
|
return func.apply(isArray(value) ? value : [], args); |
|
|
}); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Map minified method names to their real names. |
|
|
baseForOwn(LazyWrapper.prototype, function(func, methodName) { |
|
|
var lodashFunc = lodash[methodName]; |
|
|
if (lodashFunc) { |
|
|
var key = (lodashFunc.name + ''), |
|
|
names = realNames[key] || (realNames[key] = []); |
|
|
|
|
|
names.push({ 'name': methodName, 'func': lodashFunc }); |
|
|
} |
|
|
}); |
|
|
|
|
|
realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{ |
|
|
'name': 'wrapper', |
|
|
'func': undefined |
|
|
}]; |
|
|
|
|
|
// Add methods to `LazyWrapper`. |
|
|
LazyWrapper.prototype.clone = lazyClone; |
|
|
LazyWrapper.prototype.reverse = lazyReverse; |
|
|
LazyWrapper.prototype.value = lazyValue; |
|
|
|
|
|
// Add lazy aliases. |
|
|
lodash.prototype.first = lodash.prototype.head; |
|
|
|
|
|
if (symIterator) { |
|
|
lodash.prototype[symIterator] = wrapperToIterator; |
|
|
} |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
// Some AMD build optimizers, like r.js, check for condition patterns like: |
|
|
if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) { |
|
|
// Expose Lodash on the global object to prevent errors when Lodash is |
|
|
// loaded by a script tag in the presence of an AMD loader. |
|
|
// See http://requirejs.org/docs/errors.html#mismatch for more details. |
|
|
// Use `_.noConflict` to remove Lodash from the global object. |
|
|
root._ = lodash; |
|
|
|
|
|
// Define as an anonymous module so, through path mapping, it can be |
|
|
// referenced as the "underscore" module. |
|
|
define(function() { |
|
|
return lodash; |
|
|
}); |
|
|
} |
|
|
// Check for `exports` after `define` in case a build optimizer adds it. |
|
|
else if (freeModule) { |
|
|
// Export for Node.js. |
|
|
(freeModule.exports = lodash)._ = lodash; |
|
|
// Export for CommonJS support. |
|
|
freeExports._ = lodash; |
|
|
} |
|
|
else { |
|
|
// Export to the global object. |
|
|
root._ = lodash; |
|
|
} |
|
|
}.call(this)); |
|
|
/** |
|
|
* Created by richie on 15/7/8. |
|
|
*/ |
|
|
/** |
|
|
* 初始化BI对象 |
|
|
*/ |
|
|
if (window.BI == null) { |
|
|
window.BI = {}; |
|
|
}/** |
|
|
* 常量 |
|
|
*/ |
|
|
|
|
|
_.extend(BI, { |
|
|
MAX: 0xfffffffffffffff, |
|
|
MIN: -0xfffffffffffffff, |
|
|
EVENT_RESPONSE_TIME: 200, |
|
|
zIndex_layer: 1e5, |
|
|
zIndex_popover: 1e6, |
|
|
zIndex_popup: 1e7, |
|
|
zIndex_masker: 1e8, |
|
|
zIndex_tip: 1e9, |
|
|
emptyStr: "", |
|
|
emptyFn: function () { |
|
|
}, |
|
|
empty: null, |
|
|
Key: { |
|
|
48: "0", |
|
|
49: "1", |
|
|
50: "2", |
|
|
51: "3", |
|
|
52: "4", |
|
|
53: "5", |
|
|
54: "6", |
|
|
55: "7", |
|
|
56: "8", |
|
|
57: "9", |
|
|
65: "a", |
|
|
66: "b", |
|
|
67: "c", |
|
|
68: "d", |
|
|
69: "e", |
|
|
70: "f", |
|
|
71: "g", |
|
|
72: "h", |
|
|
73: "i", |
|
|
74: "j", |
|
|
75: "k", |
|
|
76: "l", |
|
|
77: "m", |
|
|
78: "n", |
|
|
79: "o", |
|
|
80: "p", |
|
|
81: "q", |
|
|
82: "r", |
|
|
83: "s", |
|
|
84: "t", |
|
|
85: "u", |
|
|
86: "v", |
|
|
87: "w", |
|
|
88: "x", |
|
|
89: "y", |
|
|
90: "z", |
|
|
96: "0", |
|
|
97: "1", |
|
|
98: "2", |
|
|
99: "3", |
|
|
100: "4", |
|
|
101: "5", |
|
|
102: "6", |
|
|
103: "7", |
|
|
104: "8", |
|
|
105: "9", |
|
|
106: "*", |
|
|
107: "+", |
|
|
109: "-", |
|
|
110: ".", |
|
|
111: "/" |
|
|
}, |
|
|
KeyCode: { |
|
|
BACKSPACE: 8, |
|
|
COMMA: 188, |
|
|
DELETE: 46, |
|
|
DOWN: 40, |
|
|
END: 35, |
|
|
ENTER: 13, |
|
|
ESCAPE: 27, |
|
|
HOME: 36, |
|
|
LEFT: 37, |
|
|
NUMPAD_ADD: 107, |
|
|
NUMPAD_DECIMAL: 110, |
|
|
NUMPAD_DIVIDE: 111, |
|
|
NUMPAD_ENTER: 108, |
|
|
NUMPAD_MULTIPLY: 106, |
|
|
NUMPAD_SUBTRACT: 109, |
|
|
PAGE_DOWN: 34, |
|
|
PAGE_UP: 33, |
|
|
PERIOD: 190, |
|
|
RIGHT: 39, |
|
|
SPACE: 32, |
|
|
TAB: 9, |
|
|
UP: 38 |
|
|
}, |
|
|
Status: { |
|
|
SUCCESS: 1, |
|
|
WRONG: 2, |
|
|
START: 3, |
|
|
END: 4, |
|
|
WAITING: 5, |
|
|
READY: 6, |
|
|
RUNNING: 7, |
|
|
OUTOFBOUNDS: 8, |
|
|
NULL: -1 |
|
|
}, |
|
|
Direction: { |
|
|
Top: "top", |
|
|
Bottom: "bottom", |
|
|
Left: "left", |
|
|
Right: "right", |
|
|
Custom: "custom" |
|
|
}, |
|
|
Axis: { |
|
|
Vertical: "vertical", |
|
|
Horizontal: "horizontal" |
|
|
}, |
|
|
Selection: { |
|
|
Default: -2, |
|
|
None: -1, |
|
|
Single: 0, |
|
|
Multi: 1, |
|
|
All: 2 |
|
|
}, |
|
|
HorizontalAlign: { |
|
|
Left: "left", |
|
|
Right: "right", |
|
|
Center: "center", |
|
|
Stretch: "stretch" |
|
|
}, |
|
|
VerticalAlign: { |
|
|
Middle: "middle", |
|
|
Top: "top", |
|
|
Bottom: "bottom", |
|
|
Stretch: "stretch" |
|
|
} |
|
|
});/** |
|
|
* 对数组对象的扩展 |
|
|
* @class Array |
|
|
*/ |
|
|
_.extend(Array.prototype, { |
|
|
contains: function (o) { |
|
|
return this.indexOf(o) > -1; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 从数组中移除指定的值,如果值不在数组中,则不产生任何效果 |
|
|
* @param {Object} o 要移除的值 |
|
|
* @return {Array} 移除制定值后的数组 |
|
|
*/ |
|
|
remove: function (o) { |
|
|
var index = this.indexOf(o); |
|
|
if (index !== -1) { |
|
|
this.splice(index, 1); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
pushArray: function (array) { |
|
|
for (var i = 0; i < array.length; i++) { |
|
|
this.push(array[i]); |
|
|
} |
|
|
}, |
|
|
pushDistinct: function (obj) { |
|
|
if (!this.contains(obj)) { |
|
|
this.push(obj); |
|
|
} |
|
|
}, |
|
|
pushDistinctArray: function (array) { |
|
|
for (var i = 0, len = array.length; i < len; i++) { |
|
|
this.pushDistinct(array[i]); |
|
|
} |
|
|
} |
|
|
}); |
|
|
if (!Number.prototype.toFixed || (0.00008).toFixed(3) !== "0.000" || |
|
|
(0.9).toFixed(0) === "0" || (1.255).toFixed(2) !== "1.25" || |
|
|
(1000000000000000128).toFixed(0) !== "1000000000000000128") { |
|
|
(function () { |
|
|
var base, size, data, i; |
|
|
base = 1e7; |
|
|
size = 6; |
|
|
data = [0, 0, 0, 0, 0, 0]; |
|
|
function multiply (n, c) { |
|
|
var i = -1; |
|
|
while (++i < size) { |
|
|
c += n * data[i]; |
|
|
data[i] = c % base; |
|
|
c = Math.floor(c / base); |
|
|
} |
|
|
} |
|
|
|
|
|
function divide (n) { |
|
|
var i = size, c = 0; |
|
|
while (--i >= 0) { |
|
|
c += data[i]; |
|
|
data[i] = Math.floor(c / n); |
|
|
c = (c % n) * base; |
|
|
} |
|
|
} |
|
|
|
|
|
function toString () { |
|
|
var i = size; |
|
|
var s = ""; |
|
|
while (--i >= 0) { |
|
|
if (s !== "" || i === 0 || data[i] !== 0) { |
|
|
var t = String(data[i]); |
|
|
if (s === "") { |
|
|
s = t; |
|
|
} else { |
|
|
s += "0000000".slice(0, 7 - t.length) + t; |
|
|
} |
|
|
} |
|
|
} |
|
|
return s; |
|
|
} |
|
|
|
|
|
function pow (x, n, acc) { |
|
|
return (n === 0 ? acc : (n % 2 === 1 ? pow(x, n - 1, acc * x) |
|
|
: pow(x * x, n / 2, acc))); |
|
|
} |
|
|
|
|
|
function log (x) { |
|
|
var n = 0; |
|
|
while (x >= 4096) { |
|
|
n += 12; |
|
|
x /= 4096; |
|
|
} |
|
|
while (x >= 2) { |
|
|
n += 1; |
|
|
x /= 2; |
|
|
} |
|
|
return n; |
|
|
} |
|
|
|
|
|
Number.prototype.toFixed = function (fractionDigits) { |
|
|
var f, x, s, m, e, z, j, k; |
|
|
f = Number(fractionDigits); |
|
|
f = f !== f ? 0 : Math.floor(f); |
|
|
|
|
|
if (f < 0 || f > 20) { |
|
|
throw new RangeError("Number.toFixed called with invalid number of decimals"); |
|
|
} |
|
|
|
|
|
x = Number(this); |
|
|
|
|
|
if (x !== x) { |
|
|
return "NaN"; |
|
|
} |
|
|
|
|
|
if (x <= -1e21 || x > 1e21) { |
|
|
return String(x); |
|
|
} |
|
|
|
|
|
s = ""; |
|
|
|
|
|
if (x < 0) { |
|
|
s = "-"; |
|
|
x = -x; |
|
|
} |
|
|
|
|
|
m = "0"; |
|
|
|
|
|
if (x > 1e-21) { |
|
|
// 1e-21<x<1e21 |
|
|
// -70<log2(x)<70 |
|
|
e = log(x * pow(2, 69, 1)) - 69; |
|
|
z = (e < 0 ? x * pow(2, -e, 1) : x / pow(2, e, 1)); |
|
|
z *= 0x10000000000000;// Math.pow(2,52); |
|
|
e = 52 - e; |
|
|
|
|
|
// -18<e<122 |
|
|
// x=z/2^e |
|
|
if (e > 0) { |
|
|
multiply(0, z); |
|
|
j = f; |
|
|
|
|
|
while (j >= 7) { |
|
|
multiply(1e7, 0); |
|
|
j -= 7; |
|
|
} |
|
|
|
|
|
multiply(pow(10, j, 1), 0); |
|
|
j = e - 1; |
|
|
|
|
|
while (j >= 23) { |
|
|
divide(1 << 23); |
|
|
j -= 23; |
|
|
} |
|
|
divide(1 << j); |
|
|
multiply(1, 1); |
|
|
divide(2); |
|
|
m = toString(); |
|
|
} else { |
|
|
multiply(0, z); |
|
|
multiply(1 << (-e), 0); |
|
|
m = toString() + "0.00000000000000000000".slice(2, 2 + f); |
|
|
} |
|
|
} |
|
|
|
|
|
if (f > 0) { |
|
|
k = m.length; |
|
|
|
|
|
if (k <= f) { |
|
|
m = s + "0.0000000000000000000".slice(0, f - k + 2) + m; |
|
|
} else { |
|
|
m = s + m.slice(0, k - f) + "." + m.slice(k - f); |
|
|
} |
|
|
} else { |
|
|
m = s + m; |
|
|
} |
|
|
|
|
|
return m; |
|
|
}; |
|
|
|
|
|
})(); |
|
|
} |
|
|
|
|
|
|
|
|
/** |
|
|
** 加法函数,用来得到精确的加法结果 |
|
|
** 说明:javascript的加法结果会有误差,在两个浮点数相加的时候会比较明显。这个函数返回较为精确的加法结果。 |
|
|
** 调用:accAdd(arg1,arg2) |
|
|
** 返回值:arg1加上arg2的精确结果 |
|
|
**/ |
|
|
function accAdd (arg1, arg2) { |
|
|
var r1, r2, m, c; |
|
|
try { |
|
|
r1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r1 = 0; |
|
|
} |
|
|
try { |
|
|
r2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r2 = 0; |
|
|
} |
|
|
c = Math.abs(r1 - r2); |
|
|
m = Math.pow(10, Math.max(r1, r2)); |
|
|
if (c > 0) { |
|
|
var cm = Math.pow(10, c); |
|
|
if (r1 > r2) { |
|
|
arg1 = Number(arg1.toString().replace(".", "")); |
|
|
arg2 = Number(arg2.toString().replace(".", "")) * cm; |
|
|
} else { |
|
|
arg1 = Number(arg1.toString().replace(".", "")) * cm; |
|
|
arg2 = Number(arg2.toString().replace(".", "")); |
|
|
} |
|
|
} else { |
|
|
arg1 = Number(arg1.toString().replace(".", "")); |
|
|
arg2 = Number(arg2.toString().replace(".", "")); |
|
|
} |
|
|
return (arg1 + arg2) / m; |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个add方法,调用起来更加方便。 |
|
|
Number.prototype.add = function (arg) { |
|
|
return accAdd(arg, this); |
|
|
}; |
|
|
/** |
|
|
** 减法函数,用来得到精确的减法结果 |
|
|
** 说明:javascript的减法结果会有误差,在两个浮点数相减的时候会比较明显。这个函数返回较为精确的减法结果。 |
|
|
** 调用:accSub(arg1,arg2) |
|
|
** 返回值:arg1加上arg2的精确结果 |
|
|
**/ |
|
|
function accSub (arg1, arg2) { |
|
|
var r1, r2, m, n; |
|
|
try { |
|
|
r1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r1 = 0; |
|
|
} |
|
|
try { |
|
|
r2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r2 = 0; |
|
|
} |
|
|
m = Math.pow(10, Math.max(r1, r2)); // last modify by deeka //动态控制精度长度 |
|
|
n = (r1 >= r2) ? r1 : r2; |
|
|
return ((arg1 * m - arg2 * m) / m).toFixed(n); |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个mul方法,调用起来更加方便。 |
|
|
Number.prototype.sub = function (arg) { |
|
|
return accSub(this, arg); |
|
|
}; |
|
|
/** |
|
|
** 乘法函数,用来得到精确的乘法结果 |
|
|
** 说明:javascript的乘法结果会有误差,在两个浮点数相乘的时候会比较明显。这个函数返回较为精确的乘法结果。 |
|
|
** 调用:accMul(arg1,arg2) |
|
|
** 返回值:arg1乘以 arg2的精确结果 |
|
|
**/ |
|
|
function accMul (arg1, arg2) { |
|
|
var m = 0, s1 = arg1.toString(), s2 = arg2.toString(); |
|
|
try { |
|
|
m += s1.split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
try { |
|
|
m += s2.split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
return Number(s1.replace(".", "")) * Number(s2.replace(".", "")) / Math.pow(10, m); |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个mul方法,调用起来更加方便。 |
|
|
Number.prototype.mul = function (arg) { |
|
|
return accMul(arg, this); |
|
|
}; |
|
|
/** |
|
|
** 除法函数,用来得到精确的除法结果 |
|
|
** 说明:javascript的除法结果会有误差,在两个浮点数相除的时候会比较明显。这个函数返回较为精确的除法结果。 |
|
|
** 调用:accDiv(arg1,arg2) |
|
|
** 返回值:arg1除以arg2的精确结果 |
|
|
**/ |
|
|
function accDiv (arg1, arg2) { |
|
|
var t1 = 0, t2 = 0, r1, r2; |
|
|
try { |
|
|
t1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
try { |
|
|
t2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
with (Math) { |
|
|
r1 = Number(arg1.toString().replace(".", "")); |
|
|
r2 = Number(arg2.toString().replace(".", "")); |
|
|
return (t2 > t1) ? (r1 / r2) * pow(10, t2 - t1) : (r1 / r2) / pow(10, t1 - t2); |
|
|
} |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个div方法,调用起来更加方便。 |
|
|
Number.prototype.div = function (arg) { |
|
|
return accDiv(this, arg); |
|
|
};/** |
|
|
* 对字符串对象的扩展 |
|
|
* @class String |
|
|
*/ |
|
|
_.extend(String.prototype, { |
|
|
|
|
|
/** |
|
|
* 判断字符串是否已指定的字符串开始 |
|
|
* @param {String} startTag 指定的开始字符串 |
|
|
* @return {Boolean} 如果字符串以指定字符串开始则返回true,否则返回false |
|
|
*/ |
|
|
startWith: function (startTag) { |
|
|
if (startTag == null || startTag == "" || this.length === 0 || startTag.length > this.length) { |
|
|
return false; |
|
|
} |
|
|
return this.substr(0, startTag.length) == startTag; |
|
|
}, |
|
|
/** |
|
|
* 判断字符串是否以指定的字符串结束 |
|
|
* @param {String} endTag 指定的字符串 |
|
|
* @return {Boolean} 如果字符串以指定字符串结束则返回true,否则返回false |
|
|
*/ |
|
|
endWith: function (endTag) { |
|
|
if (endTag == null || endTag == "" || this.length === 0 || endTag.length > this.length) { |
|
|
return false; |
|
|
} |
|
|
return this.substring(this.length - endTag.length) == endTag; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 获取url中指定名字的参数 |
|
|
* @param {String} name 参数的名字 |
|
|
* @return {String} 参数的值 |
|
|
*/ |
|
|
getQuery: function (name) { |
|
|
var reg = new RegExp("(^|&)" + name + "=([^&]*)(&|$)"); |
|
|
var r = this.substr(this.indexOf("?") + 1).match(reg); |
|
|
if (r) { |
|
|
return unescape(r[2]); |
|
|
} |
|
|
return null; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给url加上给定的参数 |
|
|
* @param {Object} paras 参数对象,是一个键值对对象 |
|
|
* @return {String} 添加了给定参数的url |
|
|
*/ |
|
|
appendQuery: function (paras) { |
|
|
if (!paras) { |
|
|
return this; |
|
|
} |
|
|
var src = this; |
|
|
// 没有问号说明还没有参数 |
|
|
if (src.indexOf("?") === -1) { |
|
|
src += "?"; |
|
|
} |
|
|
// 如果以问号结尾,说明没有其他参数 |
|
|
if (src.endWith("?") !== false) { |
|
|
} else { |
|
|
src += "&"; |
|
|
} |
|
|
_.each(paras, function (value, name) { |
|
|
if (typeof(name) === "string") { |
|
|
src += name + "=" + value + "&"; |
|
|
} |
|
|
}); |
|
|
src = src.substr(0, src.length - 1); |
|
|
return src; |
|
|
}, |
|
|
/** |
|
|
* 将所有符合第一个字符串所表示的字符串替换成为第二个字符串 |
|
|
* @param {String} s1 要替换的字符串的正则表达式 |
|
|
* @param {String} s2 替换的结果字符串 |
|
|
* @returns {String} 替换后的字符串 |
|
|
*/ |
|
|
replaceAll: function (s1, s2) { |
|
|
return this.replace(new RegExp(s1, "gm"), s2); |
|
|
}, |
|
|
/** |
|
|
* 总是让字符串以指定的字符开头 |
|
|
* @param {String} start 指定的字符 |
|
|
* @returns {String} 以指定字符开头的字符串 |
|
|
*/ |
|
|
perfectStart: function (start) { |
|
|
if (this.startWith(start)) { |
|
|
return this; |
|
|
} |
|
|
return start + this; |
|
|
|
|
|
}, |
|
|
|
|
|
/** |
|
|
* 获取字符串中某字符串的所有项位置数组 |
|
|
* @param {String} sub 子字符串 |
|
|
* @return {Number[]} 子字符串在父字符串中出现的所有位置组成的数组 |
|
|
*/ |
|
|
allIndexOf: function (sub) { |
|
|
if (typeof sub !== "string") { |
|
|
return []; |
|
|
} |
|
|
var str = this; |
|
|
var location = []; |
|
|
var offset = 0; |
|
|
while (str.length > 0) { |
|
|
var loc = str.indexOf(sub); |
|
|
if (loc === -1) { |
|
|
break; |
|
|
} |
|
|
location.push(offset + loc); |
|
|
str = str.substring(loc + sub.length, str.length); |
|
|
offset += loc + sub.length; |
|
|
} |
|
|
return location; |
|
|
} |
|
|
}); |
|
|
/** Constants used for time computations */ |
|
|
Date.SECOND = 1000; |
|
|
Date.MINUTE = 60 * Date.SECOND; |
|
|
Date.HOUR = 60 * Date.MINUTE; |
|
|
Date.DAY = 24 * Date.HOUR; |
|
|
Date.WEEK = 7 * Date.DAY; |
|
|
|
|
|
/** |
|
|
* 获取时区 |
|
|
* @returns {String} |
|
|
*/ |
|
|
Date.prototype.getTimezone = function () { |
|
|
return this.toString().replace(/^.* (?:\((.*)\)|([A-Z]{1,4})(?:[\-+][0-9]{4})?(?: -?\d+)?)$/, "$1$2").replace(/[^A-Z]/g, ""); |
|
|
}; |
|
|
|
|
|
/** Returns the number of days in the current month */ |
|
|
Date.prototype.getMonthDays = function (month) { |
|
|
var year = this.getFullYear(); |
|
|
if (typeof month === "undefined") { |
|
|
month = this.getMonth(); |
|
|
} |
|
|
if (((0 == (year % 4)) && ( (0 != (year % 100)) || (0 == (year % 400)))) && month == 1) { |
|
|
return 29; |
|
|
} |
|
|
return Date._MD[month]; |
|
|
|
|
|
}; |
|
|
|
|
|
/** |
|
|
* 获取每月的最后一天 |
|
|
* @returns {Date} |
|
|
*/ |
|
|
Date.prototype.getLastDateOfMonth = function () { |
|
|
return BI.getDate(this.getFullYear(), this.getMonth(), this.getMonthDays()); |
|
|
}; |
|
|
|
|
|
/** Returns the number of day in the year. */ |
|
|
Date.prototype.getDayOfYear = function () { |
|
|
var now = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0); |
|
|
var then = BI.getDate(this.getFullYear(), 0, 0, 0, 0, 0); |
|
|
var time = now - then; |
|
|
return Math.floor(time / Date.DAY); |
|
|
}; |
|
|
|
|
|
/** Returns the number of the week in year, as defined in ISO 8601. */ |
|
|
Date.prototype.getWeekNumber = function () { |
|
|
var d = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0); |
|
|
// 周一是一周第一天 |
|
|
var week = d.getDay() === 0 ? 7 : d.getDay(); |
|
|
// var week = d.getDay(); |
|
|
if (this.getMonth() === 0 && this.getDate() <= week) { |
|
|
return 1; |
|
|
} |
|
|
d.setDate(this.getDate() - (week - 1)); |
|
|
var ms = d.valueOf(); // GMT |
|
|
d.setMonth(0); |
|
|
d.setDate(1); |
|
|
var offset = Math.floor((ms - d.valueOf()) / (7 * 864e5)) + 1; |
|
|
if (d.getDay() !== 1) { |
|
|
offset++; |
|
|
} |
|
|
return offset; |
|
|
}; |
|
|
|
|
|
Date.prototype.getQuarter = function () { |
|
|
return Math.floor(this.getMonth() / 3) + 1; |
|
|
}; |
|
|
|
|
|
// 离当前时间多少天的时间 |
|
|
Date.prototype.getOffsetDate = function (offset) { |
|
|
return BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()) + offset * 864e5); |
|
|
}; |
|
|
|
|
|
Date.prototype.getAfterMulQuarter = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
dt.setMonth(dt.getMonth() + n * 3); |
|
|
return dt; |
|
|
}; |
|
|
// 获得n个季度前的日期 |
|
|
Date.prototype.getBeforeMulQuarter = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
dt.setMonth(dt.getMonth() - n * 3); |
|
|
return dt; |
|
|
}; |
|
|
// 得到本季度的起始月份 |
|
|
Date.prototype.getQuarterStartMonth = function () { |
|
|
var quarterStartMonth = 0; |
|
|
var nowMonth = this.getMonth(); |
|
|
if (nowMonth < 3) { |
|
|
quarterStartMonth = 0; |
|
|
} |
|
|
if (2 < nowMonth && nowMonth < 6) { |
|
|
quarterStartMonth = 3; |
|
|
} |
|
|
if (5 < nowMonth && nowMonth < 9) { |
|
|
quarterStartMonth = 6; |
|
|
} |
|
|
if (nowMonth > 8) { |
|
|
quarterStartMonth = 9; |
|
|
} |
|
|
return quarterStartMonth; |
|
|
}; |
|
|
// 获得本季度的起始日期 |
|
|
Date.prototype.getQuarterStartDate = function () { |
|
|
return BI.getDate(this.getFullYear(), this.getQuarterStartMonth(), 1); |
|
|
}; |
|
|
// 得到本季度的结束日期 |
|
|
Date.prototype.getQuarterEndDate = function () { |
|
|
var quarterEndMonth = this.getQuarterStartMonth() + 2; |
|
|
return BI.getDate(this.getFullYear(), quarterEndMonth, this.getMonthDays(quarterEndMonth)); |
|
|
}; |
|
|
Date.prototype.getAfterMultiMonth = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
dt.setMonth(dt.getMonth() + n | 0); |
|
|
return dt; |
|
|
}; |
|
|
Date.prototype.getBeforeMultiMonth = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
dt.setMonth(dt.getMonth() - n | 0); |
|
|
return dt; |
|
|
}; |
|
|
|
|
|
// 指定日期n个月之前或之后的日期 |
|
|
Date.prototype.getOffsetMonth = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
var day = dt.getDate(); |
|
|
var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + parseInt(n), 1).getMonthDays(); |
|
|
if (day > monthDay) { |
|
|
day = monthDay; |
|
|
} |
|
|
dt.setDate(day); |
|
|
dt.setMonth(dt.getMonth() + parseInt(n)); |
|
|
return dt; |
|
|
}; |
|
|
|
|
|
// 获得本周的起始日期 |
|
|
Date.prototype.getWeekStartDate = function () { |
|
|
var w = this.getDay(); |
|
|
return this.getOffsetDate(w === 0 ? -6 : 1 - w); |
|
|
}; |
|
|
// 得到本周的结束日期 |
|
|
Date.prototype.getWeekEndDate = function () { |
|
|
var w = this.getDay(); |
|
|
return this.getOffsetDate(w === 0 ? 0 : 7 - w); |
|
|
}; |
|
|
|
|
|
/** Checks date and time equality */ |
|
|
Date.prototype.equalsTo = function (date) { |
|
|
return ((this.getFullYear() == date.getFullYear()) && |
|
|
(this.getMonth() == date.getMonth()) && |
|
|
(this.getDate() == date.getDate()) && |
|
|
(this.getHours() == date.getHours()) && |
|
|
(this.getMinutes() == date.getMinutes()) && |
|
|
(this.getSeconds() == date.getSeconds())); |
|
|
}; |
|
|
|
|
|
/** Set only the year, month, date parts (keep existing time) */ |
|
|
Date.prototype.setDateOnly = function (date) { |
|
|
var tmp = BI.getDate(date); |
|
|
this.setDate(1); |
|
|
this.setFullYear(tmp.getFullYear()); |
|
|
this.setMonth(tmp.getMonth()); |
|
|
this.setDate(tmp.getDate()); |
|
|
}; |
|
|
/** Prints the date in a string according to the given format. */ |
|
|
Date.prototype.print = function (str) { |
|
|
var m = this.getMonth(); |
|
|
var d = this.getDate(); |
|
|
var y = this.getFullYear(); |
|
|
var wn = this.getWeekNumber(); |
|
|
var qr = this.getQuarter(); |
|
|
var w = this.getDay(); |
|
|
var s = {}; |
|
|
var hr = this.getHours(); |
|
|
var pm = (hr >= 12); |
|
|
var ir = (pm) ? (hr - 12) : hr; |
|
|
var dy = this.getDayOfYear(); |
|
|
if (ir == 0) { |
|
|
ir = 12; |
|
|
} |
|
|
var min = this.getMinutes(); |
|
|
var sec = this.getSeconds(); |
|
|
s["%a"] = Date._SDN[w]; // abbreviated weekday name [FIXME: I18N] |
|
|
s["%A"] = Date._DN[w]; // full weekday name |
|
|
s["%b"] = Date._SMN[m]; // abbreviated month name [FIXME: I18N] |
|
|
s["%B"] = Date._MN[m]; // full month name |
|
|
// FIXME: %c : preferred date and time representation for the current locale |
|
|
s["%C"] = 1 + Math.floor(y / 100); // the century number |
|
|
s["%d"] = (d < 10) ? ("0" + d) : d; // the day of the month (range 01 to 31) |
|
|
s["%e"] = d; // the day of the month (range 1 to 31) |
|
|
// FIXME: %D : american date style: %m/%d/%y |
|
|
// FIXME: %E, %F, %G, %g, %h (man strftime) |
|
|
s["%H"] = (hr < 10) ? ("0" + hr) : hr; // hour, range 00 to 23 (24h format) |
|
|
s["%I"] = (ir < 10) ? ("0" + ir) : ir; // hour, range 01 to 12 (12h format) |
|
|
s["%j"] = (dy < 100) ? ((dy < 10) ? ("00" + dy) : ("0" + dy)) : dy; // day of the year (range 001 to 366) |
|
|
s["%k"] = hr; // hour, range 0 to 23 (24h format) |
|
|
s["%l"] = ir; // hour, range 1 to 12 (12h format) |
|
|
s["%X"] = (m < 9) ? ("0" + (1 + m)) : (1 + m); // month, range 01 to 12 |
|
|
s["%x"] = m + 1; // month, range 1 to 12 |
|
|
s["%M"] = (min < 10) ? ("0" + min) : min; // minute, range 00 to 59 |
|
|
s["%n"] = "\n"; // a newline character |
|
|
s["%p"] = pm ? "PM" : "AM"; |
|
|
s["%P"] = pm ? "pm" : "am"; |
|
|
// FIXME: %r : the time in am/pm notation %I:%M:%S %p |
|
|
// FIXME: %R : the time in 24-hour notation %H:%M |
|
|
s["%s"] = Math.floor(this.getTime() / 1000); |
|
|
s["%S"] = (sec < 10) ? ("0" + sec) : sec; // seconds, range 00 to 59 |
|
|
s["%t"] = "\t"; // a tab character |
|
|
// FIXME: %T : the time in 24-hour notation (%H:%M:%S) |
|
|
s["%U"] = s["%W"] = s["%V"] = (wn < 10) ? ("0" + wn) : wn; |
|
|
s["%u"] = w + 1; // the day of the week (range 1 to 7, 1 = MON) |
|
|
s["%w"] = w; // the day of the week (range 0 to 6, 0 = SUN) |
|
|
// FIXME: %x : preferred date representation for the current locale without the time |
|
|
// FIXME: %X : preferred time representation for the current locale without the date |
|
|
s["%y"] = ("" + y).substr(2, 2); // year without the century (range 00 to 99) |
|
|
s["%Y"] = y; // year with the century |
|
|
s["%%"] = "%"; // a literal '%' character |
|
|
s["%Q"] = qr; |
|
|
|
|
|
var re = /%./g; |
|
|
if (!BI.isKhtml()) { |
|
|
return str.replace(re, function (par) { |
|
|
return s[par] || par; |
|
|
}); |
|
|
} |
|
|
|
|
|
var a = str.match(re); |
|
|
for (var i = 0; i < a.length; i++) { |
|
|
var tmp = s[a[i]]; |
|
|
if (tmp) { |
|
|
re = new RegExp(a[i], "g"); |
|
|
str = str.replace(re, tmp); |
|
|
} |
|
|
} |
|
|
|
|
|
return str; |
|
|
}; |
|
|
Function.prototype.before = function (func) { |
|
|
var __self = this; |
|
|
return function () { |
|
|
if (func.apply(this, arguments) === false) { |
|
|
return false; |
|
|
} |
|
|
return __self.apply(this, arguments); |
|
|
}; |
|
|
}; |
|
|
|
|
|
Function.prototype.after = function (func) { |
|
|
var __self = this; |
|
|
return function () { |
|
|
var ret = __self.apply(this, arguments); |
|
|
if (ret === false) { |
|
|
return false; |
|
|
} |
|
|
func.apply(this, arguments); |
|
|
return ret; |
|
|
}; |
|
|
};/** |
|
|
* 基本函数 |
|
|
* Create By GUY 2014\11\17 |
|
|
* |
|
|
*/ |
|
|
|
|
|
if (!window.BI) { |
|
|
window.BI = {}; |
|
|
} |
|
|
|
|
|
!(function (undefined) { |
|
|
var traverse = function (func, context) { |
|
|
return function (value, key, obj) { |
|
|
return func.call(context, key, value, obj); |
|
|
}; |
|
|
}; |
|
|
var _apply = function (name) { |
|
|
return function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}; |
|
|
var _applyFunc = function (name) { |
|
|
return function () { |
|
|
var args = Array.prototype.slice.call(arguments, 0); |
|
|
args[1] = _.isFunction(args[1]) ? traverse(args[1], args[2]) : args[1]; |
|
|
return _[name].apply(_, args); |
|
|
}; |
|
|
}; |
|
|
|
|
|
// Utility |
|
|
_.extend(BI, { |
|
|
i18nText: function (key) { |
|
|
var localeText = (BI.i18n && BI.i18n[key]) || ""; |
|
|
if (!localeText) { |
|
|
localeText = key; |
|
|
} |
|
|
var len = arguments.length; |
|
|
if (len > 1) { |
|
|
for (var i = 1; i < len; i++) { |
|
|
var key = "{R" + i + "}"; |
|
|
localeText = localeText.replaceAll(key, arguments[i] + ""); |
|
|
} |
|
|
} |
|
|
return localeText; |
|
|
}, |
|
|
|
|
|
assert: function (v, is) { |
|
|
if (this.isFunction(is)) { |
|
|
if (!is(v)) { |
|
|
throw new Error(v + " error"); |
|
|
} else { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
if (!this.isArray(is)) { |
|
|
is = [is]; |
|
|
} |
|
|
if (!this.deepContains(is, v)) { |
|
|
throw new Error(v + " error"); |
|
|
} |
|
|
}, |
|
|
|
|
|
warn: function (message) { |
|
|
console.warn(message); |
|
|
}, |
|
|
|
|
|
UUID: function () { |
|
|
var f = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"]; |
|
|
var str = ""; |
|
|
for (var i = 0; i < 16; i++) { |
|
|
var r = parseInt(f.length * Math.random(), 10); |
|
|
str += f[r]; |
|
|
} |
|
|
return str; |
|
|
}, |
|
|
|
|
|
isWidget: function (widget) { |
|
|
return widget instanceof BI.Widget || (BI.View && widget instanceof BI.View); |
|
|
}, |
|
|
|
|
|
createWidgets: function (items, options) { |
|
|
if (!BI.isArray(items)) { |
|
|
throw new Error("cannot create Widgets"); |
|
|
} |
|
|
return BI.map(BI.flatten(items), function (i, item) { |
|
|
return BI.createWidget(item, BI.deepClone(options)); |
|
|
}); |
|
|
}, |
|
|
|
|
|
createItems: function (data, innerAttr, outerAttr) { |
|
|
innerAttr = BI.isArray(innerAttr) ? innerAttr : BI.makeArray(BI.flatten(data).length, innerAttr); |
|
|
outerAttr = BI.isArray(outerAttr) ? outerAttr : BI.makeArray(BI.flatten(data).length, outerAttr); |
|
|
return BI.map(data, function (i, item) { |
|
|
if (BI.isArray(item)) { |
|
|
return BI.createItems(item, innerAttr, outerAttr); |
|
|
} |
|
|
if (item instanceof BI.Widget) { |
|
|
return BI.extend({}, innerAttr.shift(), outerAttr.shift(), { |
|
|
type: null, |
|
|
el: item |
|
|
}); |
|
|
} |
|
|
if (innerAttr[0] instanceof BI.Widget) { |
|
|
outerAttr.shift(); |
|
|
return BI.extend({}, item, { |
|
|
el: innerAttr.shift() |
|
|
}); |
|
|
} |
|
|
if (item.el instanceof BI.Widget || (BI.View && item.el instanceof BI.View)) { |
|
|
innerAttr.shift(); |
|
|
return BI.extend({}, outerAttr.shift(), {type: null}, item); |
|
|
} |
|
|
if (item.el) { |
|
|
return BI.extend({}, outerAttr.shift(), item, { |
|
|
el: BI.extend({}, innerAttr.shift(), item.el) |
|
|
}); |
|
|
} |
|
|
return BI.extend({}, outerAttr.shift(), { |
|
|
el: BI.extend({}, innerAttr.shift(), item) |
|
|
}); |
|
|
}); |
|
|
}, |
|
|
|
|
|
// 用容器包装items |
|
|
packageItems: function (items, layouts) { |
|
|
for (var i = layouts.length - 1; i >= 0; i--) { |
|
|
items = BI.map(items, function (k, it) { |
|
|
return BI.extend({}, layouts[i], { |
|
|
items: [ |
|
|
BI.extend({}, layouts[i].el, { |
|
|
el: it |
|
|
}) |
|
|
] |
|
|
}); |
|
|
}); |
|
|
} |
|
|
return items; |
|
|
}, |
|
|
|
|
|
formatEL: function (obj) { |
|
|
if (obj && !obj.type && obj.el) { |
|
|
return obj; |
|
|
} |
|
|
return { |
|
|
el: obj |
|
|
}; |
|
|
}, |
|
|
|
|
|
// 剥开EL |
|
|
stripEL: function (obj) { |
|
|
return obj.type && obj || obj.el || obj; |
|
|
}, |
|
|
|
|
|
trans2Element: function (widgets) { |
|
|
return BI.map(widgets, function (i, wi) { |
|
|
return wi.element; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 集合相关方法 |
|
|
_.each(["where", "findWhere", "invoke", "pluck", "shuffle", "sample", "toArray", "size"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["get", "each", "map", "reduce", "reduceRight", "find", "filter", "reject", "every", "all", "some", "any", "max", "min", |
|
|
"sortBy", "groupBy", "indexBy", "countBy", "partition", "clamp"], function (name) { |
|
|
if (name === "any") { |
|
|
BI[name] = _applyFunc("some"); |
|
|
} else { |
|
|
BI[name] = _applyFunc(name); |
|
|
} |
|
|
}); |
|
|
_.extend(BI, { |
|
|
// 数数 |
|
|
count: function (from, to, predicate) { |
|
|
var t; |
|
|
if (predicate) { |
|
|
for (t = from; t < to; t++) { |
|
|
predicate(t); |
|
|
} |
|
|
} |
|
|
return to - from; |
|
|
}, |
|
|
|
|
|
// 倒数 |
|
|
inverse: function (from, to, predicate) { |
|
|
return BI.count(to, from, predicate); |
|
|
}, |
|
|
|
|
|
firstKey: function (obj) { |
|
|
var res = undefined; |
|
|
BI.any(obj, function (key, value) { |
|
|
res = key; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
lastKey: function (obj) { |
|
|
var res = undefined; |
|
|
BI.each(obj, function (key, value) { |
|
|
res = key; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
firstObject: function (obj) { |
|
|
var res = undefined; |
|
|
BI.any(obj, function (key, value) { |
|
|
res = value; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
lastObject: function (obj) { |
|
|
var res = undefined; |
|
|
BI.each(obj, function (key, value) { |
|
|
res = value; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
concat: function (obj1, obj2) { |
|
|
if (BI.isKey(obj1)) { |
|
|
return obj1 + "" + obj2; |
|
|
} |
|
|
if (BI.isArray(obj1)) { |
|
|
return obj1.concat(obj2); |
|
|
} |
|
|
if (BI.isObject(obj1)) { |
|
|
return _.extend({}, obj1, obj2); |
|
|
} |
|
|
}, |
|
|
|
|
|
backEach: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
predicate(index, obj[index], obj); |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
backAny: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
if (predicate(index, obj[index], obj)) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
backEvery: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
if (!predicate(index, obj[index], obj)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
backFindKey: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
var keys = _.keys(obj), key; |
|
|
for (var i = keys.length - 1; i >= 0; i--) { |
|
|
key = keys[i]; |
|
|
if (predicate(obj[key], key, obj)) { |
|
|
return key; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
backFind: function (obj, predicate, context) { |
|
|
var key; |
|
|
if (BI.isArray(obj)) { |
|
|
key = BI.findLastIndex(obj, predicate, context); |
|
|
} else { |
|
|
key = BI.backFindKey(obj, predicate, context); |
|
|
} |
|
|
if (key !== void 0 && key !== -1) { |
|
|
return obj[key]; |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (obj, target, context) { |
|
|
var isFunction = BI.isFunction(target); |
|
|
target = isFunction || BI.isArray(target) ? target : [target]; |
|
|
var i; |
|
|
if (BI.isArray(obj)) { |
|
|
for (i = 0; i < obj.length; i++) { |
|
|
if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) { |
|
|
obj.splice(i--, 1); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
BI.each(obj, function (i, v) { |
|
|
if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) { |
|
|
delete obj[i]; |
|
|
} |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
removeAt: function (obj, index) { |
|
|
index = BI.isArray(index) ? index : [index]; |
|
|
var isArray = BI.isArray(obj), i; |
|
|
for (i = 0; i < index.length; i++) { |
|
|
if (isArray) { |
|
|
obj[index[i]] = "$deleteIndex"; |
|
|
} else { |
|
|
delete obj[index[i]]; |
|
|
} |
|
|
} |
|
|
if (isArray) { |
|
|
BI.remove(obj, "$deleteIndex"); |
|
|
} |
|
|
}, |
|
|
|
|
|
string2Array: function (str) { |
|
|
return str.split("&-&"); |
|
|
}, |
|
|
|
|
|
array2String: function (array) { |
|
|
return array.join("&-&"); |
|
|
}, |
|
|
|
|
|
abc2Int: function (str) { |
|
|
var idx = 0, start = "A", str = str.toUpperCase(); |
|
|
for (var i = 0, len = str.length; i < len; ++i) { |
|
|
idx = str.charAt(i).charCodeAt(0) - start.charCodeAt(0) + 26 * idx + 1; |
|
|
if (idx > (2147483646 - str.charAt(i).charCodeAt(0) + start.charCodeAt(0)) / 26) { |
|
|
return 0; |
|
|
} |
|
|
} |
|
|
return idx; |
|
|
}, |
|
|
|
|
|
int2Abc: function (num) { |
|
|
var DIGITS = ["A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z"]; |
|
|
var idx = num, str = ""; |
|
|
if (num === 0) { |
|
|
return ""; |
|
|
} |
|
|
while (idx !== 0) { |
|
|
var t = idx % 26; |
|
|
if (t === 0) { |
|
|
t = 26; |
|
|
} |
|
|
str = DIGITS[t - 1] + str; |
|
|
idx = (idx - t) / 26; |
|
|
} |
|
|
return str; |
|
|
} |
|
|
}); |
|
|
|
|
|
// 数组相关的方法 |
|
|
_.each(["first", "initial", "last", "rest", "compact", "flatten", "without", "union", "intersection", |
|
|
"difference", "zip", "unzip", "object", "indexOf", "lastIndexOf", "sortedIndex", "range", "take", "takeRight"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["findIndex", "findLastIndex"], function (name) { |
|
|
BI[name] = _applyFunc(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
// 构建一个长度为length的数组 |
|
|
makeArray: function (length, value) { |
|
|
var res = []; |
|
|
for (var i = 0; i < length; i++) { |
|
|
if (BI.isNull(value)) { |
|
|
res.push(i); |
|
|
} else { |
|
|
res.push(BI.deepClone(value)); |
|
|
} |
|
|
} |
|
|
return res; |
|
|
}, |
|
|
|
|
|
makeObject: function (array, value) { |
|
|
var map = {}; |
|
|
for (var i = 0; i < array.length; i++) { |
|
|
if (BI.isNull(value)) { |
|
|
map[array[i]] = array[i]; |
|
|
} else { |
|
|
map[array[i]] = BI.deepClone(value); |
|
|
} |
|
|
} |
|
|
return map; |
|
|
}, |
|
|
|
|
|
makeArrayByArray: function (array, value) { |
|
|
var res = []; |
|
|
if (!array) { |
|
|
return res; |
|
|
} |
|
|
for (var i = 0, len = array.length; i < len; i++) { |
|
|
if (BI.isArray(array[i])) { |
|
|
res.push(arguments.callee(array[i], value)); |
|
|
} else { |
|
|
res.push(BI.deepClone(value)); |
|
|
} |
|
|
} |
|
|
return res; |
|
|
}, |
|
|
|
|
|
uniq: function (array, isSorted, iteratee, context) { |
|
|
if (array == null) { |
|
|
return []; |
|
|
} |
|
|
if (!_.isBoolean(isSorted)) { |
|
|
context = iteratee; |
|
|
iteratee = isSorted; |
|
|
isSorted = false; |
|
|
} |
|
|
iteratee && (iteratee = traverse(iteratee, context)); |
|
|
return _.uniq.call(_, array, isSorted, iteratee, context); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 对象相关方法 |
|
|
_.each(["keys", "allKeys", "values", "pairs", "invert", "create", "functions", "extend", "extendOwn", |
|
|
"defaults", "clone", "property", "propertyOf", "matcher", "isEqual", "isMatch", "isEmpty", |
|
|
"isElement", "isNumber", "isString", "isArray", "isObject", "isPlainObject", "isArguments", "isFunction", "isFinite", |
|
|
"isBoolean", "isDate", "isRegExp", "isError", "isNaN", "isUndefined", "zipObject", "cloneDeep"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["mapObject", "findKey", "pick", "omit", "tap"], function (name) { |
|
|
BI[name] = _applyFunc(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
|
|
|
inherit: function (sb, sp, overrides) { |
|
|
if (typeof sp === "object") { |
|
|
overrides = sp; |
|
|
sp = sb; |
|
|
sb = function () { |
|
|
return sp.apply(this, arguments); |
|
|
}; |
|
|
} |
|
|
var F = function () { |
|
|
}, spp = sp.prototype; |
|
|
F.prototype = spp; |
|
|
sb.prototype = new F(); |
|
|
sb.superclass = spp; |
|
|
_.extend(sb.prototype, overrides, { |
|
|
superclass: sp |
|
|
}); |
|
|
return sb; |
|
|
}, |
|
|
|
|
|
has: function (obj, keys) { |
|
|
if (BI.isArray(keys)) { |
|
|
if (keys.length === 0) { |
|
|
return false; |
|
|
} |
|
|
return BI.every(keys, function (i, key) { |
|
|
return _.has(obj, key); |
|
|
}); |
|
|
} |
|
|
return _.has.apply(_, arguments); |
|
|
}, |
|
|
|
|
|
// 数字和字符串可以作为key |
|
|
isKey: function (key) { |
|
|
return BI.isNumber(key) || (BI.isString(key) && key.length > 0); |
|
|
}, |
|
|
|
|
|
// 忽略大小写的等于 |
|
|
isCapitalEqual: function (a, b) { |
|
|
a = BI.isNull(a) ? a : ("" + a).toLowerCase(); |
|
|
b = BI.isNull(b) ? b : ("" + b).toLowerCase(); |
|
|
return BI.isEqual(a, b); |
|
|
}, |
|
|
|
|
|
isWidthOrHeight: function (w) { |
|
|
if (typeof w === "number") { |
|
|
return w >= 0; |
|
|
} else if (typeof w === "string") { |
|
|
return /^\d{1,3}%$/.exec(w) || w == "auto" || /^\d+px$/.exec(w); |
|
|
} |
|
|
}, |
|
|
|
|
|
isNotNull: function (obj) { |
|
|
return !BI.isNull(obj); |
|
|
}, |
|
|
|
|
|
isNull: function (obj) { |
|
|
return typeof obj === "undefined" || obj === null; |
|
|
}, |
|
|
|
|
|
isEmptyArray: function (arr) { |
|
|
return BI.isArray(arr) && BI.isEmpty(arr); |
|
|
}, |
|
|
|
|
|
isNotEmptyArray: function (arr) { |
|
|
return BI.isArray(arr) && !BI.isEmpty(arr); |
|
|
}, |
|
|
|
|
|
isEmptyObject: function (obj) { |
|
|
return BI.isEqual(obj, {}); |
|
|
}, |
|
|
|
|
|
isNotEmptyObject: function (obj) { |
|
|
return BI.isPlainObject(obj) && !BI.isEmptyObject(obj); |
|
|
}, |
|
|
|
|
|
isEmptyString: function (obj) { |
|
|
return BI.isString(obj) && obj.length === 0; |
|
|
}, |
|
|
|
|
|
isNotEmptyString: function (obj) { |
|
|
return BI.isString(obj) && !BI.isEmptyString(obj); |
|
|
}, |
|
|
|
|
|
isWindow: function () { |
|
|
return $.isWindow.apply($, arguments); |
|
|
} |
|
|
}); |
|
|
|
|
|
// deep方法 |
|
|
_.extend(BI, { |
|
|
deepClone: _.cloneDeep, |
|
|
|
|
|
isDeepMatch: function (object, attrs) { |
|
|
var keys = BI.keys(attrs), length = keys.length; |
|
|
if (object == null) { |
|
|
return !length; |
|
|
} |
|
|
var obj = Object(object); |
|
|
for (var i = 0; i < length; i++) { |
|
|
var key = keys[i]; |
|
|
if (!BI.isEqual(attrs[key], obj[key]) || !(key in obj)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
contains: function (obj, target, fromIndex) { |
|
|
if (!_.isArrayLike(obj)) obj = _.values(obj); |
|
|
return _.indexOf(obj, target, typeof fromIndex === "number" && fromIndex) >= 0; |
|
|
}, |
|
|
|
|
|
deepContains: function (obj, copy) { |
|
|
if (BI.isObject(copy)) { |
|
|
return BI.any(obj, function (i, v) { |
|
|
if (BI.isEqual(v, copy)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
} |
|
|
return BI.contains(obj, copy); |
|
|
}, |
|
|
|
|
|
deepIndexOf: function (obj, target) { |
|
|
for (var i = 0; i < obj.length; i++) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
return i; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
}, |
|
|
|
|
|
deepRemove: function (obj, target) { |
|
|
var done = false; |
|
|
var i; |
|
|
if (BI.isArray(obj)) { |
|
|
for (i = 0; i < obj.length; i++) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
obj.splice(i--, 1); |
|
|
done = true; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
BI.each(obj, function (i, v) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
delete obj[i]; |
|
|
done = true; |
|
|
} |
|
|
}); |
|
|
} |
|
|
return done; |
|
|
}, |
|
|
|
|
|
deepWithout: function (obj, target) { |
|
|
if (BI.isArray(obj)) { |
|
|
var result = []; |
|
|
for (var i = 0; i < obj.length; i++) { |
|
|
if (!BI.isEqual(target, obj[i])) { |
|
|
result.push(obj[i]); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
var result = {}; |
|
|
BI.each(obj, function (i, v) { |
|
|
if (!BI.isEqual(target, obj[i])) { |
|
|
result[i] = v; |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
|
|
|
}, |
|
|
|
|
|
deepUnique: function (array) { |
|
|
var result = []; |
|
|
BI.each(array, function (i, item) { |
|
|
if (!BI.deepContains(result, item)) { |
|
|
result.push(item); |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
// 比较两个对象得出不一样的key值 |
|
|
deepDiff: function (object, other) { |
|
|
object || (object = {}); |
|
|
other || (other = {}); |
|
|
var result = []; |
|
|
var used = []; |
|
|
for (var b in object) { |
|
|
if (this.has(object, b)) { |
|
|
if (!this.isEqual(object[b], other[b])) { |
|
|
result.push(b); |
|
|
} |
|
|
used.push(b); |
|
|
} |
|
|
} |
|
|
for (var b in other) { |
|
|
if (this.has(other, b) && !used.contains(b)) { |
|
|
result.push(b); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}, |
|
|
|
|
|
deepExtend: function () { |
|
|
var args = [].slice.call(arguments); |
|
|
args.unshift(true); |
|
|
return $.extend.apply($, args); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 通用方法 |
|
|
_.each(["uniqueId", "result", "chain", "iteratee", "escape", "unescape"], function (name) { |
|
|
BI[name] = function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// 事件相关方法 |
|
|
_.each(["bind", "once", "partial", "debounce", "throttle", "delay", "defer", "wrap"], function (name) { |
|
|
BI[name] = function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}); |
|
|
|
|
|
_.extend(BI, { |
|
|
nextTick: (function () { |
|
|
var callbacks = []; |
|
|
var pending = false; |
|
|
var timerFunc; |
|
|
|
|
|
function nextTickHandler () { |
|
|
pending = false; |
|
|
var copies = callbacks.slice(0); |
|
|
callbacks = []; |
|
|
for (var i = 0; i < copies.length; i++) { |
|
|
copies[i](); |
|
|
} |
|
|
} |
|
|
|
|
|
if (typeof Promise !== "undefined") { |
|
|
var p = Promise.resolve(); |
|
|
timerFunc = function () { |
|
|
p.then(nextTickHandler); |
|
|
}; |
|
|
} else |
|
|
|
|
|
/* istanbul ignore if */ |
|
|
if (typeof MutationObserver !== "undefined") { |
|
|
var counter = 1; |
|
|
var observer = new MutationObserver(nextTickHandler); |
|
|
var textNode = document.createTextNode(counter + ""); |
|
|
observer.observe(textNode, { |
|
|
characterData: true |
|
|
}); |
|
|
timerFunc = function () { |
|
|
counter = (counter + 1) % 2; |
|
|
textNode.data = counter + ""; |
|
|
}; |
|
|
} else { |
|
|
timerFunc = function () { |
|
|
setTimeout(nextTickHandler, 0); |
|
|
}; |
|
|
} |
|
|
return function queueNextTick (cb) { |
|
|
var _resolve; |
|
|
var args = [].slice.call(arguments, 1); |
|
|
callbacks.push(function () { |
|
|
if (cb) { |
|
|
cb.apply(null, args); |
|
|
} |
|
|
if (_resolve) { |
|
|
_resolve.apply(null, args); |
|
|
} |
|
|
}); |
|
|
if (!pending) { |
|
|
pending = true; |
|
|
timerFunc(); |
|
|
} |
|
|
if (!cb && typeof Promise !== "undefined") { |
|
|
return new Promise(function (resolve) { |
|
|
_resolve = resolve; |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})() |
|
|
}); |
|
|
|
|
|
// 数字相关方法 |
|
|
_.each(["random"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
getTime: function () { |
|
|
if (window.performance && window.performance.now) { |
|
|
return window.performance.now(); |
|
|
} |
|
|
if (window.performance && window.performance.webkitNow) { |
|
|
return window.performance.webkitNow(); |
|
|
} |
|
|
if (Date.now) { |
|
|
return Date.now(); |
|
|
} |
|
|
return BI.getDate().getTime(); |
|
|
|
|
|
|
|
|
}, |
|
|
|
|
|
parseInt: function (number) { |
|
|
var radix = 10; |
|
|
if (/^0x/g.test(number)) { |
|
|
radix = 16; |
|
|
} |
|
|
try { |
|
|
return parseInt(number, radix); |
|
|
} catch (e) { |
|
|
throw new Error(number + "parse int error"); |
|
|
return NaN; |
|
|
} |
|
|
}, |
|
|
|
|
|
parseSafeInt: function (value) { |
|
|
var MAX_SAFE_INTEGER = 9007199254740991; |
|
|
return value |
|
|
? this.clamp(this.parseInt(value), -MAX_SAFE_INTEGER, MAX_SAFE_INTEGER) |
|
|
: (value === 0 ? value : 0); |
|
|
}, |
|
|
|
|
|
parseFloat: function (number) { |
|
|
try { |
|
|
return parseFloat(number); |
|
|
} catch (e) { |
|
|
throw new Error(number + "parse float error"); |
|
|
return NaN; |
|
|
} |
|
|
}, |
|
|
|
|
|
isNaturalNumber: function (number) { |
|
|
if (/^\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isPositiveInteger: function (number) { |
|
|
if (/^\+?[1-9][0-9]*$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isNegativeInteger: function (number) { |
|
|
if (/^\-[1-9][0-9]*$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isInteger: function (number) { |
|
|
if (/^\-?\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isNumeric: function (number) { |
|
|
return $.isNumeric(number); |
|
|
}, |
|
|
|
|
|
isFloat: function (number) { |
|
|
if (/^([+-]?)\\d*\\.\\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isOdd: function (number) { |
|
|
if (!BI.isInteger(number)) { |
|
|
return false; |
|
|
} |
|
|
return number & 1 === 1; |
|
|
}, |
|
|
|
|
|
isEven: function (number) { |
|
|
if (!BI.isInteger(number)) { |
|
|
return false; |
|
|
} |
|
|
return number & 1 === 0; |
|
|
}, |
|
|
|
|
|
sum: function (array, iteratee, context) { |
|
|
var sum = 0; |
|
|
BI.each(array, function (i, item) { |
|
|
if (iteratee) { |
|
|
sum += Number(iteratee.apply(context, [i, item])); |
|
|
} else { |
|
|
sum += Number(item); |
|
|
} |
|
|
}); |
|
|
return sum; |
|
|
}, |
|
|
|
|
|
average: function (array, iteratee, context) { |
|
|
var sum = BI.sum(array, iteratee, context); |
|
|
return sum / array.length; |
|
|
} |
|
|
}); |
|
|
|
|
|
// 字符串相关方法 |
|
|
_.extend(BI, { |
|
|
trim: function () { |
|
|
return $.trim.apply($, arguments); |
|
|
}, |
|
|
|
|
|
toUpperCase: function (string) { |
|
|
return (string + "").toLocaleUpperCase(); |
|
|
}, |
|
|
|
|
|
toLowerCase: function (string) { |
|
|
return (string + "").toLocaleLowerCase(); |
|
|
}, |
|
|
|
|
|
isEndWithBlank: function (string) { |
|
|
return /(\s|\u00A0)$/.test(string); |
|
|
}, |
|
|
|
|
|
isLiteral: function (exp) { |
|
|
var literalValueRE = /^\s?(true|false|-?[\d\.]+|'[^']*'|"[^"]*")\s?$/; |
|
|
return literalValueRE.test(exp); |
|
|
}, |
|
|
|
|
|
stripQuotes: function (str) { |
|
|
var a = str.charCodeAt(0); |
|
|
var b = str.charCodeAt(str.length - 1); |
|
|
return a === b && (a === 0x22 || a === 0x27) |
|
|
? str.slice(1, -1) |
|
|
: str; |
|
|
}, |
|
|
|
|
|
// background-color => backgroundColor |
|
|
camelize: function (str) { |
|
|
return str.replace(/-(.)/g, function (_, character) { |
|
|
return character.toUpperCase(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
// backgroundColor => background-color |
|
|
hyphenate: function (str) { |
|
|
return str.replace(/([A-Z])/g, "-$1").toLowerCase(); |
|
|
}, |
|
|
|
|
|
isNotEmptyString: function (str) { |
|
|
return BI.isString(str) && !BI.isEmpty(str); |
|
|
}, |
|
|
|
|
|
isEmptyString: function (str) { |
|
|
return BI.isString(str) && BI.isEmpty(str); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串进行加密 {@link #decrypt} |
|
|
* @static |
|
|
* @param str 原始字符<EFBFBD>? |
|
|
* @param keyt 密钥 |
|
|
* @returns {String} 加密后的字符<EFBFBD>? |
|
|
*/ |
|
|
encrypt: function (str, keyt) { |
|
|
if (str == "") { |
|
|
return ""; |
|
|
} |
|
|
str = escape(str); |
|
|
if (!keyt || keyt == "") { |
|
|
keyt = "655"; |
|
|
} |
|
|
keyt = escape(keyt); |
|
|
if (keyt == null || keyt.length <= 0) { |
|
|
alert("Please enter a password with which to encrypt the message."); |
|
|
return null; |
|
|
} |
|
|
var prand = ""; |
|
|
for (var i = 0; i < keyt.length; i++) { |
|
|
prand += keyt.charCodeAt(i).toString(); |
|
|
} |
|
|
var sPos = Math.floor(prand.length / 5); |
|
|
var mult = parseInt(prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4) + prand.charAt(sPos * 5)); |
|
|
|
|
|
var incr = Math.ceil(keyt.length / 2); |
|
|
var modu = Math.pow(2, 31) - 1; |
|
|
if (mult < 2) { |
|
|
alert("Algorithm cannot find a suitable hash. Please choose a different password. \nPossible considerations are to choose a more complex or longer password."); |
|
|
return null; |
|
|
} |
|
|
// var salt = Math.round(Math.random() * 1000000000) % 100000000; |
|
|
var salt = 101; |
|
|
prand += salt; |
|
|
while (prand.length > 10) { |
|
|
prand = (parseInt(prand.substring(0, 10)) + parseInt(prand.substring(10, prand.length), 10)).toString(); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
var enc_chr = ""; |
|
|
var enc_str = ""; |
|
|
for (var i = 0; i < str.length; i++) { |
|
|
enc_chr = parseInt(str.charCodeAt(i) ^ Math.floor((prand / modu) * 255)); |
|
|
if (enc_chr < 16) { |
|
|
enc_str += "0" + enc_chr.toString(16); |
|
|
} else { |
|
|
enc_str += enc_chr.toString(16); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
} |
|
|
salt = salt.toString(16); |
|
|
while (salt.length < 8) { |
|
|
salt = "0" + salt; |
|
|
} |
|
|
enc_str += salt; |
|
|
return enc_str; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对加密后的字符串解密 {@link #encrypt} |
|
|
* @static |
|
|
* @param str 加密过的字符<EFBFBD>? |
|
|
* @param keyt 密钥 |
|
|
* @returns {String} 解密后的字符<EFBFBD>? |
|
|
*/ |
|
|
decrypt: function (str, keyt) { |
|
|
if (str == "") { |
|
|
return ""; |
|
|
} |
|
|
if (!keyt || keyt == "") { |
|
|
keyt = "655"; |
|
|
} |
|
|
keyt = escape(keyt); |
|
|
if (str == null || str.length < 8) { |
|
|
return; |
|
|
} |
|
|
if (keyt == null || keyt.length <= 0) { |
|
|
return; |
|
|
} |
|
|
var prand = ""; |
|
|
for (var i = 0; i < keyt.length; i++) { |
|
|
prand += keyt.charCodeAt(i).toString(); |
|
|
} |
|
|
var sPos = Math.floor(prand.length / 5); |
|
|
var tempmult = prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4); |
|
|
if (sPos * 5 < prand.length) { |
|
|
tempmult += prand.charAt(sPos * 5); |
|
|
} |
|
|
var mult = parseInt(tempmult); |
|
|
var incr = Math.round(keyt.length / 2); |
|
|
var modu = Math.pow(2, 31) - 1; |
|
|
var salt = parseInt(str.substring(str.length - 8, str.length), 16); |
|
|
str = str.substring(0, str.length - 8); |
|
|
prand += salt; |
|
|
while (prand.length > 10) { |
|
|
prand = (parseInt(prand.substring(0, 10), 10) + parseInt(prand.substring(10, prand.length), 10)).toString(); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
var enc_chr = ""; |
|
|
var enc_str = ""; |
|
|
for (var i = 0; i < str.length; i += 2) { |
|
|
enc_chr = parseInt(parseInt(str.substring(i, i + 2), 16) ^ Math.floor((prand / modu) * 255)); |
|
|
enc_str += String.fromCharCode(enc_chr); |
|
|
prand = (mult * prand + incr) % modu; |
|
|
} |
|
|
return unescape(enc_str); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串中的'和\做编码处理 |
|
|
* @static |
|
|
* @param {String} string 要做编码处理的字符串 |
|
|
* @return {String} 编码后的字符串 |
|
|
*/ |
|
|
escape: function (string) { |
|
|
return string.replace(/('|\\)/g, "\\$1"); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 让字符串通过指定字符做补齐的函数 |
|
|
* |
|
|
* var s = BI.leftPad('123', 5, '0');//s的值为:'00123' |
|
|
* |
|
|
* @static |
|
|
* @param {String} val 原始值 |
|
|
* @param {Number} size 总共需要的位数 |
|
|
* @param {String} ch 用于补齐的字符 |
|
|
* @return {String} 补齐后的字符串 |
|
|
*/ |
|
|
leftPad: function (val, size, ch) { |
|
|
var result = String(val); |
|
|
if (!ch) { |
|
|
ch = " "; |
|
|
} |
|
|
while (result.length < size) { |
|
|
result = ch + result; |
|
|
} |
|
|
return result.toString(); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串做替换的函数 |
|
|
* |
|
|
* var cls = 'my-class', text = 'Some text'; |
|
|
* var res = BI.format('<div class="{0}>{1}</div>"', cls, text); |
|
|
* //res的值为:'<div class="my-class">Some text</div>'; |
|
|
* |
|
|
* @static |
|
|
* @param {String} format 要做替换的字符串,替换字符串1,替换字符串2... |
|
|
* @return {String} 做了替换后的字符串 |
|
|
*/ |
|
|
format: function (format) { |
|
|
var args = Array.prototype.slice.call(arguments, 1); |
|
|
return format.replace(/\{(\d+)\}/g, function (m, i) { |
|
|
return args[i]; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 日期相关方法 |
|
|
_.extend(BI, { |
|
|
/** |
|
|
* 是否是闰年 |
|
|
* @param year |
|
|
* @returns {boolean} |
|
|
*/ |
|
|
isLeapYear: function (year) { |
|
|
return (year % 4 === 0 && year % 100 !== 0) || year % 400 === 0; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 检测是否在有效期 |
|
|
* |
|
|
* @param YY 年 |
|
|
* @param MM 月 |
|
|
* @param DD 日 |
|
|
* @param minDate '1900-01-01' |
|
|
* @param maxDate '2099-12-31' |
|
|
* @returns {Array} 若无效返回无效状态 |
|
|
*/ |
|
|
checkDateVoid: function (YY, MM, DD, minDate, maxDate) { |
|
|
var back = []; |
|
|
YY = YY | 0; |
|
|
MM = MM | 0; |
|
|
DD = DD | 0; |
|
|
minDate = BI.isString(minDate) ? minDate.match(/\d+/g) : minDate; |
|
|
maxDate = BI.isString(maxDate) ? maxDate.match(/\d+/g) : maxDate; |
|
|
if (YY < minDate[0]) { |
|
|
back = ["y"]; |
|
|
} else if (YY > maxDate[0]) { |
|
|
back = ["y", 1]; |
|
|
} else if (YY >= minDate[0] && YY <= maxDate[0]) { |
|
|
if (YY == minDate[0]) { |
|
|
if (MM < minDate[1]) { |
|
|
back = ["m"]; |
|
|
} else if (MM == minDate[1]) { |
|
|
if (DD < minDate[2]) { |
|
|
back = ["d"]; |
|
|
} |
|
|
} |
|
|
} |
|
|
if (YY == maxDate[0]) { |
|
|
if (MM > maxDate[1]) { |
|
|
back = ["m", 1]; |
|
|
} else if (MM == maxDate[1]) { |
|
|
if (DD > maxDate[2]) { |
|
|
back = ["d", 1]; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
return back; |
|
|
}, |
|
|
|
|
|
checkDateLegal: function (str) { |
|
|
var ar = str.match(/\d+/g); |
|
|
var YY = ar[0] | 0, MM = ar[1] | 0, DD = ar[2] | 0; |
|
|
if (ar.length <= 1) { |
|
|
return true; |
|
|
} |
|
|
if (ar.length <= 2) { |
|
|
return MM >= 1 && MM <= 12; |
|
|
} |
|
|
var MD = Date._MD.slice(0); |
|
|
MD[1] = BI.isLeapYear(YY) ? 29 : 28; |
|
|
return MM >= 1 && MM <= 12 && DD <= MD[MM - 1]; |
|
|
}, |
|
|
|
|
|
parseDateTime: function (str, fmt) { |
|
|
var today = BI.getDate(); |
|
|
var y = 0; |
|
|
var m = 0; |
|
|
var d = 1; |
|
|
// wei : 对于fmt为‘YYYYMM’或者‘YYYYMMdd’的格式,str的值为类似'201111'的形式,因为年月之间没有分隔符,所以正则表达式分割无效,导致bug7376。 |
|
|
var a = str.split(/\W+/); |
|
|
if (fmt.toLowerCase() == "%y%x" || fmt.toLowerCase() == "%y%x%d") { |
|
|
var yearlength = 4; |
|
|
var otherlength = 2; |
|
|
a[0] = str.substring(0, yearlength); |
|
|
a[1] = str.substring(yearlength, yearlength + otherlength); |
|
|
a[2] = str.substring(yearlength + otherlength, yearlength + otherlength * 2); |
|
|
} |
|
|
var b = fmt.match(/%./g); |
|
|
var i = 0, j = 0; |
|
|
var hr = 0; |
|
|
var min = 0; |
|
|
var sec = 0; |
|
|
for (i = 0; i < a.length; ++i) { |
|
|
switch (b[i]) { |
|
|
case "%d": |
|
|
case "%e": |
|
|
d = parseInt(a[i], 10); |
|
|
break; |
|
|
|
|
|
case "%X": |
|
|
m = parseInt(a[i], 10) - 1; |
|
|
break; |
|
|
case "%x": |
|
|
m = parseInt(a[i], 10) - 1; |
|
|
break; |
|
|
|
|
|
case "%Y": |
|
|
case "%y": |
|
|
y = parseInt(a[i], 10); |
|
|
(y < 100) && (y += (y > 29) ? 1900 : 2000); |
|
|
break; |
|
|
|
|
|
case "%b": |
|
|
case "%B": |
|
|
for (j = 0; j < 12; ++j) { |
|
|
if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) { |
|
|
m = j; |
|
|
break; |
|
|
} |
|
|
} |
|
|
break; |
|
|
|
|
|
case "%H": |
|
|
case "%I": |
|
|
case "%k": |
|
|
case "%l": |
|
|
hr = parseInt(a[i], 10); |
|
|
break; |
|
|
|
|
|
case "%P": |
|
|
case "%p": |
|
|
if (/pm/i.test(a[i]) && hr < 12) { |
|
|
hr += 12; |
|
|
} else if (/am/i.test(a[i]) && hr >= 12) { |
|
|
hr -= 12; |
|
|
} |
|
|
break; |
|
|
|
|
|
case "%M": |
|
|
min = parseInt(a[i], 10); |
|
|
case "%S": |
|
|
sec = parseInt(a[i], 10); |
|
|
break; |
|
|
} |
|
|
} |
|
|
// if (!a[i]) { |
|
|
// continue; |
|
|
// } |
|
|
if (isNaN(y)) { |
|
|
y = today.getFullYear(); |
|
|
} |
|
|
if (isNaN(m)) { |
|
|
m = today.getMonth(); |
|
|
} |
|
|
if (isNaN(d)) { |
|
|
d = today.getDate(); |
|
|
} |
|
|
if (isNaN(hr)) { |
|
|
hr = today.getHours(); |
|
|
} |
|
|
if (isNaN(min)) { |
|
|
min = today.getMinutes(); |
|
|
} |
|
|
if (isNaN(sec)) { |
|
|
sec = today.getSeconds(); |
|
|
} |
|
|
if (y != 0) { |
|
|
return BI.getDate(y, m, d, hr, min, sec); |
|
|
} |
|
|
y = 0; |
|
|
m = -1; |
|
|
d = 0; |
|
|
for (i = 0; i < a.length; ++i) { |
|
|
if (a[i].search(/[a-zA-Z]+/) != -1) { |
|
|
var t = -1; |
|
|
for (j = 0; j < 12; ++j) { |
|
|
if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) { |
|
|
t = j; |
|
|
break; |
|
|
} |
|
|
} |
|
|
if (t != -1) { |
|
|
if (m != -1) { |
|
|
d = m + 1; |
|
|
} |
|
|
m = t; |
|
|
} |
|
|
} else if (parseInt(a[i], 10) <= 12 && m == -1) { |
|
|
m = a[i] - 1; |
|
|
} else if (parseInt(a[i], 10) > 31 && y == 0) { |
|
|
y = parseInt(a[i], 10); |
|
|
(y < 100) && (y += (y > 29) ? 1900 : 2000); |
|
|
} else if (d == 0) { |
|
|
d = a[i]; |
|
|
} |
|
|
} |
|
|
if (y == 0) { |
|
|
y = today.getFullYear(); |
|
|
} |
|
|
if (m != -1 && d != 0) { |
|
|
return BI.getDate(y, m, d, hr, min, sec); |
|
|
} |
|
|
return today; |
|
|
}, |
|
|
|
|
|
getDate: function () { |
|
|
var length = arguments.length; |
|
|
var args = arguments; |
|
|
var dt; |
|
|
switch (length) { |
|
|
// new Date() |
|
|
case 0: |
|
|
dt = new Date(); |
|
|
break; |
|
|
// new Date(long) |
|
|
case 1: |
|
|
dt = new Date(args[0]); |
|
|
break; |
|
|
// new Date(year, month) |
|
|
case 2: |
|
|
dt = new Date(args[0], args[1]); |
|
|
break; |
|
|
// new Date(year, month, day) |
|
|
case 3: |
|
|
dt = new Date(args[0], args[1], args[2]); |
|
|
break; |
|
|
// new Date(year, month, day, hour) |
|
|
case 4: |
|
|
dt = new Date(args[0], args[1], args[2], args[3]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute) |
|
|
case 5: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second) |
|
|
case 6: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second, millisecond) |
|
|
case 7: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
break; |
|
|
default: |
|
|
dt = new Date(); |
|
|
break; |
|
|
} |
|
|
if (BI.isNotNull(Date.timeZone) && (arguments.length === 0 || (arguments.length === 1 && BI.isNumber(arguments[0])))) { |
|
|
var localTime = dt.getTime(); |
|
|
var localOffset = dt.getTimezoneOffset() * 60000; // 获得当地时间偏移的毫秒数 |
|
|
var utc = localTime + localOffset; // utc即GMT时间标准时区 |
|
|
return new Date(utc + Date.timeZone);// + Pool.timeZone.offset); |
|
|
} |
|
|
return dt; |
|
|
|
|
|
}, |
|
|
|
|
|
getTime: function () { |
|
|
var length = arguments.length; |
|
|
var args = arguments; |
|
|
var dt; |
|
|
switch (length) { |
|
|
// new Date() |
|
|
case 0: |
|
|
dt = new Date(); |
|
|
break; |
|
|
// new Date(long) |
|
|
case 1: |
|
|
dt = new Date(args[0]); |
|
|
break; |
|
|
// new Date(year, month) |
|
|
case 2: |
|
|
dt = new Date(args[0], args[1]); |
|
|
break; |
|
|
// new Date(year, month, day) |
|
|
case 3: |
|
|
dt = new Date(args[0], args[1], args[2]); |
|
|
break; |
|
|
// new Date(year, month, day, hour) |
|
|
case 4: |
|
|
dt = new Date(args[0], args[1], args[2], args[3]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute) |
|
|
case 5: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second) |
|
|
case 6: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second, millisecond) |
|
|
case 7: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
break; |
|
|
default: |
|
|
dt = new Date(); |
|
|
break; |
|
|
} |
|
|
if (BI.isNotNull(Date.timeZone)) { |
|
|
return dt.getTime() - Date.timeZone - dt.getTimezoneOffset() * 60000; |
|
|
} |
|
|
return dt.getTime(); |
|
|
|
|
|
} |
|
|
}); |
|
|
|
|
|
// 浏览器相关方法 |
|
|
_.extend(BI, { |
|
|
isIE: function () { |
|
|
if (this.__isIE == null) { |
|
|
this.__isIE = /(msie|trident)/i.test(navigator.userAgent.toLowerCase()); |
|
|
} |
|
|
return this.__isIE; |
|
|
}, |
|
|
|
|
|
getIEVersion: function () { |
|
|
if (this.__IEVersion != null) { |
|
|
return this.__IEVersion; |
|
|
} |
|
|
var version = 0; |
|
|
var agent = navigator.userAgent.toLowerCase(); |
|
|
var v1 = agent.match(/(?:msie\s([\w.]+))/); |
|
|
var v2 = agent.match(/(?:trident.*rv:([\w.]+))/); |
|
|
if (v1 && v2 && v1[1] && v2[1]) { |
|
|
version = Math.max(v1[1] * 1, v2[1] * 1); |
|
|
} else if (v1 && v1[1]) { |
|
|
version = v1[1] * 1; |
|
|
} else if (v2 && v2[1]) { |
|
|
version = v2[1] * 1; |
|
|
} else { |
|
|
version = 0; |
|
|
} |
|
|
return this.__IEVersion = version; |
|
|
}, |
|
|
|
|
|
isIE9Below: function () { |
|
|
if (!BI.isIE()) { |
|
|
return false; |
|
|
} |
|
|
return this.getIEVersion() < 9; |
|
|
}, |
|
|
|
|
|
isEdge: function () { |
|
|
return /edge/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isChrome: function () { |
|
|
return /chrome/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isFireFox: function () { |
|
|
return /firefox/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isOpera: function () { |
|
|
return /opera/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isSafari: function () { |
|
|
return /safari/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isKhtml: function () { |
|
|
return /Konqueror|Safari|KHTML/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isMac: function () { |
|
|
return /macintosh|mac os x/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isWindows: function () { |
|
|
return /windows|win32/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isSupportCss3: function (style) { |
|
|
var prefix = ["webkit", "Moz", "ms", "o"], |
|
|
i, len, |
|
|
humpString = [], |
|
|
htmlStyle = document.documentElement.style, |
|
|
_toHumb = function (string) { |
|
|
return string.replace(/-(\w)/g, function ($0, $1) { |
|
|
return $1.toUpperCase(); |
|
|
}); |
|
|
}; |
|
|
|
|
|
for (i in prefix) { |
|
|
humpString.push(_toHumb(prefix[i] + "-" + style)); |
|
|
} |
|
|
humpString.push(_toHumb(style)); |
|
|
|
|
|
for (i = 0, len = humpString.length; i < len; i++) { |
|
|
if (humpString[i] in htmlStyle) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
}); |
|
|
// BI请求 |
|
|
_.extend(BI, { |
|
|
|
|
|
ajax: function (option) { |
|
|
option || (option = {}); |
|
|
var async = option.async; |
|
|
option.data = BI.cjkEncodeDO(option.data || {}); |
|
|
|
|
|
$.ajax({ |
|
|
url: option.url, |
|
|
type: "POST", |
|
|
data: option.data, |
|
|
async: async, |
|
|
error: option.error, |
|
|
complete: function (res, status) { |
|
|
if (BI.isFunction(option.complete)) { |
|
|
option.complete(BI.jsonDecode(res.responseText), status); |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
}); |
|
|
})();/** |
|
|
* 客户端观察者,主要处理事件的添加、删除、执行等 |
|
|
* @class BI.OB |
|
|
* @abstract |
|
|
*/ |
|
|
BI.OB = function (config) { |
|
|
var props = this.props; |
|
|
if (BI.isFunction(this.props)) { |
|
|
props = this.props(config); |
|
|
} |
|
|
this.options = (window.$ || window._).extend(this._defaultConfig(config), props, config); |
|
|
this._init(); |
|
|
this._initRef(); |
|
|
}; |
|
|
_.extend(BI.OB.prototype, { |
|
|
props: {}, |
|
|
init: null, |
|
|
destroyed: null, |
|
|
|
|
|
_defaultConfig: function (config) { |
|
|
return {}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
this._initListeners(); |
|
|
this.init && this.init(); |
|
|
}, |
|
|
|
|
|
_initListeners: function () { |
|
|
var self = this; |
|
|
if (this.options.listeners != null) { |
|
|
_.each(this.options.listeners, function (lis) { |
|
|
(lis.target ? lis.target : self)[lis.once ? "once" : "on"] |
|
|
(lis.eventName, _.bind(lis.action, self)); |
|
|
}); |
|
|
delete this.options.listeners; |
|
|
} |
|
|
}, |
|
|
|
|
|
// 获得一个当前对象的引用 |
|
|
_initRef: function () { |
|
|
if (this.options.ref) { |
|
|
this.options.ref.call(this, this); |
|
|
} |
|
|
}, |
|
|
|
|
|
//释放当前对象 |
|
|
_purgeRef: function(){ |
|
|
if (this.options.ref) { |
|
|
this.options.ref.call(null); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getEvents: function () { |
|
|
if (!_.isArray(this.events)) { |
|
|
this.events = []; |
|
|
} |
|
|
return this.events; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给观察者绑定一个事件 |
|
|
* @param {String} eventName 事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数 |
|
|
*/ |
|
|
on: function (eventName, fn) { |
|
|
eventName = eventName.toLowerCase(); |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (!_.isArray(fns)) { |
|
|
fns = []; |
|
|
this._getEvents()[eventName] = fns; |
|
|
} |
|
|
fns.push(fn); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给观察者绑定一个只执行一次的事件 |
|
|
* @param {String} eventName 事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数 |
|
|
*/ |
|
|
once: function (eventName, fn) { |
|
|
var proxy = function () { |
|
|
fn.apply(this, arguments); |
|
|
this.un(eventName, proxy); |
|
|
}; |
|
|
this.on(eventName, proxy); |
|
|
}, |
|
|
/** |
|
|
* 解除观察者绑定的指定事件 |
|
|
* @param {String} eventName 要解除绑定事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数,该参数是可选的,没有该参数时,将解除绑定所有同名字的事件 |
|
|
*/ |
|
|
un: function (eventName, fn) { |
|
|
eventName = eventName.toLowerCase(); |
|
|
|
|
|
/* alex:如果fn是null,就是把eventName上面所有方法都un掉*/ |
|
|
if (fn == null) { |
|
|
delete this._getEvents()[eventName]; |
|
|
} else { |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (_.isArray(fns)) { |
|
|
var newFns = []; |
|
|
_.each(fns, function (ifn) { |
|
|
if (ifn != fn) { |
|
|
newFns.push(ifn); |
|
|
} |
|
|
}); |
|
|
this._getEvents()[eventName] = newFns; |
|
|
} |
|
|
} |
|
|
}, |
|
|
/** |
|
|
* 清除观察者的所有事件绑定 |
|
|
*/ |
|
|
purgeListeners: function () { |
|
|
/* alex:清空events*/ |
|
|
this.events = []; |
|
|
}, |
|
|
/** |
|
|
* 触发绑定过的事件 |
|
|
* |
|
|
* @param {String} eventName 要触发的事件的名字 |
|
|
* @returns {Boolean} 如果事件函数返回false,则返回false并中断其他同名事件的执行,否则执行所有的同名事件并返回true |
|
|
*/ |
|
|
fireEvent: function () { |
|
|
var eventName = arguments[0].toLowerCase(); |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (BI.isArray(fns)) { |
|
|
if (BI.isArguments(arguments[1])) { |
|
|
for (var i = 0; i < fns.length; i++) { |
|
|
if (fns[i].apply(this, arguments[1]) === false) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var args = Array.prototype.slice.call(arguments, 1); |
|
|
for (var i = 0; i < fns.length; i++) { |
|
|
if (fns[i].apply(this, args) === false) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
destroy: function () { |
|
|
this.destroyed && this.destroyed(); |
|
|
this._purgeRef(); |
|
|
this.purgeListeners(); |
|
|
} |
|
|
});(function () { |
|
|
if (!window.BI) { |
|
|
window.BI = {}; |
|
|
} |
|
|
|
|
|
function isEmpty (value) { |
|
|
// 判断是否为空值 |
|
|
var result = value === "" || value === null || value === undefined; |
|
|
return result; |
|
|
} |
|
|
|
|
|
// 判断是否是无效的日期 |
|
|
function isInvalidDate (date) { |
|
|
return date == "Invalid Date" || date == "NaN"; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 科学计数格式 |
|
|
*/ |
|
|
function _eFormat (text, fmt) { |
|
|
var e = fmt.indexOf("E"); |
|
|
var eleft = fmt.substr(0, e), eright = fmt.substr(e + 1); |
|
|
if (/^[0\.-]+$/.test(text)) { |
|
|
text = BI._numberFormat(0.0, eleft) + "E" + BI._numberFormat(0, eright); |
|
|
} else { |
|
|
var isNegative = text < 0; |
|
|
if (isNegative) { |
|
|
text = text.substr(1); |
|
|
} |
|
|
var elvl = (eleft.split(".")[0] || "").length; |
|
|
var point = text.indexOf("."); |
|
|
if (point < 0) { |
|
|
point = text.length; |
|
|
} |
|
|
var i = 0; // 第一个不为0的数的位置 |
|
|
text = text.replace(".", ""); |
|
|
for (var len = text.length; i < len; i++) { |
|
|
var ech = text.charAt(i); |
|
|
if (ech <= "9" && ech >= "1") { |
|
|
break; |
|
|
} |
|
|
} |
|
|
var right = point - i - elvl; |
|
|
var left = text.substr(i, elvl); |
|
|
var dis = i + elvl - text.length; |
|
|
if (dis > 0) { |
|
|
// 末位补全0 |
|
|
for (var k = 0; k < dis; k++) { |
|
|
left += "0"; |
|
|
} |
|
|
} else { |
|
|
left += "." + text.substr(i + elvl); |
|
|
} |
|
|
left = left.replace(/^[0]+/, ""); |
|
|
if (right < 0 && eright.indexOf("-") < 0) { |
|
|
eright += ";-" + eright; |
|
|
} |
|
|
text = BI._numberFormat(left, eleft) + "E" + BI._numberFormat(right, eright); |
|
|
if (isNegative) { |
|
|
text = "-" + text; |
|
|
} |
|
|
} |
|
|
return text; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 数字格式 |
|
|
*/ |
|
|
function _numberFormat (text, format) { |
|
|
var text = text + ""; |
|
|
// 数字格式,区分正负数 |
|
|
var numMod = format.indexOf(";"); |
|
|
if (numMod > -1) { |
|
|
if (text >= 0) { |
|
|
return _numberFormat(text + "", format.substring(0, numMod)); |
|
|
} |
|
|
return _numberFormat((-text) + "", format.substr(numMod + 1)); |
|
|
|
|
|
} |
|
|
// 兼容格式处理负数的情况(copy:fr-jquery.format.js) |
|
|
if (+text < 0 && format.charAt(0) !== "-") { |
|
|
return _numberFormat((-text) + "", "-" + format); |
|
|
} |
|
|
|
|
|
var tp = text.split("."), fp = format.split("."), |
|
|
tleft = tp[0] || "", fleft = fp[0] || "", |
|
|
tright = tp[1] || "", fright = fp[1] || ""; |
|
|
// 百分比,千分比的小数点移位处理 |
|
|
if (/[%‰]$/.test(format)) { |
|
|
var paddingZero = /[%]$/.test(format) ? "00" : "000"; |
|
|
tright += paddingZero; |
|
|
tleft += tright.substr(0, paddingZero.length); |
|
|
tleft = tleft.replace(/^0+/gi, ""); |
|
|
tright = tright.substr(paddingZero.length).replace(/0+$/gi, ""); |
|
|
} |
|
|
var right = _dealWithRight(tright, fright); |
|
|
if (right.leftPlus) { |
|
|
// 小数点后有进位 |
|
|
tleft = parseInt(tleft) + 1 + ""; |
|
|
|
|
|
tleft = isNaN(tleft) ? "1" : tleft; |
|
|
} |
|
|
right = right.num; |
|
|
var left = _dealWithLeft(tleft, fleft); |
|
|
if (!(/[0-9]/.test(left))) { |
|
|
left = left + "0"; |
|
|
} |
|
|
if (!(/[0-9]/.test(right))) { |
|
|
return left + right; |
|
|
} |
|
|
return left + "." + right; |
|
|
|
|
|
} |
|
|
|
|
|
/** |
|
|
* 处理小数点右边小数部分 |
|
|
* @param tright 右边内容 |
|
|
* @param fright 右边格式 |
|
|
* @returns {JSON} 返回处理结果和整数部分是否需要进位 |
|
|
* @private |
|
|
*/ |
|
|
function _dealWithRight (tright, fright) { |
|
|
var right = "", j = 0, i = 0; |
|
|
for (var len = fright.length; i < len; i++) { |
|
|
var ch = fright.charAt(i); |
|
|
var c = tright.charAt(j); |
|
|
switch (ch) { |
|
|
case "0": |
|
|
if (isEmpty(c)) { |
|
|
c = "0"; |
|
|
} |
|
|
right += c; |
|
|
j++; |
|
|
break; |
|
|
case "#": |
|
|
right += c; |
|
|
j++; |
|
|
break; |
|
|
default : |
|
|
right += ch; |
|
|
break; |
|
|
} |
|
|
} |
|
|
var rll = tright.substr(j); |
|
|
var result = {}; |
|
|
if (!isEmpty(rll) && rll.charAt(0) > 4) { |
|
|
// 有多余字符,需要四舍五入 |
|
|
result.leftPlus = true; |
|
|
var numReg = right.match(/^[0-9]+/); |
|
|
if (numReg) { |
|
|
var num = numReg[0]; |
|
|
var orilen = num.length; |
|
|
var newnum = parseInt(num) + 1 + ""; |
|
|
// 进位到整数部分 |
|
|
if (newnum.length > orilen) { |
|
|
newnum = newnum.substr(1); |
|
|
} else { |
|
|
newnum = BI.leftPad(newnum, orilen, "0"); |
|
|
result.leftPlus = false; |
|
|
} |
|
|
right = right.replace(/^[0-9]+/, newnum); |
|
|
} |
|
|
} |
|
|
result.num = right; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 处理小数点左边整数部分 |
|
|
* @param tleft 左边内容 |
|
|
* @param fleft 左边格式 |
|
|
* @returns {string} 返回处理结果 |
|
|
* @private |
|
|
*/ |
|
|
function _dealWithLeft (tleft, fleft) { |
|
|
var left = ""; |
|
|
var j = tleft.length - 1; |
|
|
var combo = -1, last = -1; |
|
|
var i = fleft.length - 1; |
|
|
for (; i >= 0; i--) { |
|
|
var ch = fleft.charAt(i); |
|
|
var c = tleft.charAt(j); |
|
|
switch (ch) { |
|
|
case "0": |
|
|
if (isEmpty(c)) { |
|
|
c = "0"; |
|
|
} |
|
|
last = -1; |
|
|
left = c + left; |
|
|
j--; |
|
|
break; |
|
|
case "#": |
|
|
last = i; |
|
|
left = c + left; |
|
|
j--; |
|
|
break; |
|
|
case ",": |
|
|
if (!isEmpty(c)) { |
|
|
// 计算一个,分隔区间的长度 |
|
|
var com = fleft.match(/,[#0]+/); |
|
|
if (com) { |
|
|
combo = com[0].length - 1; |
|
|
} |
|
|
left = "," + left; |
|
|
} |
|
|
break; |
|
|
default : |
|
|
left = ch + left; |
|
|
break; |
|
|
} |
|
|
} |
|
|
if (last > -1) { |
|
|
// 处理剩余字符 |
|
|
var tll = tleft.substr(0, j + 1); |
|
|
left = left.substr(0, last) + tll + left.substr(last); |
|
|
} |
|
|
if (combo > 0) { |
|
|
// 处理,分隔区间 |
|
|
var res = left.match(/[0-9]+,/); |
|
|
if (res) { |
|
|
res = res[0]; |
|
|
var newstr = "", n = res.length - 1 - combo; |
|
|
for (; n >= 0; n = n - combo) { |
|
|
newstr = res.substr(n, combo) + "," + newstr; |
|
|
} |
|
|
var lres = res.substr(0, n + combo); |
|
|
if (!isEmpty(lres)) { |
|
|
newstr = lres + "," + newstr; |
|
|
} |
|
|
} |
|
|
left = left.replace(/[0-9]+,/, newstr); |
|
|
} |
|
|
return left; |
|
|
} |
|
|
|
|
|
BI.cjkEncode = function (text) { |
|
|
// alex:如果非字符串,返回其本身(cjkEncode(234) 返回 ""是不对的) |
|
|
if (typeof text !== "string") { |
|
|
return text; |
|
|
} |
|
|
|
|
|
var newText = ""; |
|
|
for (var i = 0; i < text.length; i++) { |
|
|
var code = text.charCodeAt(i); |
|
|
if (code >= 128 || code === 91 || code === 93) {// 91 is "[", 93 is "]". |
|
|
newText += "[" + code.toString(16) + "]"; |
|
|
} else { |
|
|
newText += text.charAt(i); |
|
|
} |
|
|
} |
|
|
|
|
|
return newText; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 将cjkEncode处理过的字符串转化为原始字符串 |
|
|
* |
|
|
* @static |
|
|
* @param text 需要做解码的字符串 |
|
|
* @return {String} 解码后的字符串 |
|
|
*/ |
|
|
BI.cjkDecode = function (text) { |
|
|
if (text == null) { |
|
|
return ""; |
|
|
} |
|
|
// 查找没有 "[", 直接返回. kunsnat:数字的时候, 不支持indexOf方法, 也是直接返回. |
|
|
if (!isNaN(text) || text.indexOf("[") == -1) { |
|
|
return text; |
|
|
} |
|
|
|
|
|
var newText = ""; |
|
|
for (var i = 0; i < text.length; i++) { |
|
|
var ch = text.charAt(i); |
|
|
if (ch == "[") { |
|
|
var rightIdx = text.indexOf("]", i + 1); |
|
|
if (rightIdx > i + 1) { |
|
|
var subText = text.substring(i + 1, rightIdx); |
|
|
// james:主要是考虑[CDATA[]]这样的值的出现 |
|
|
if (subText.length > 0) { |
|
|
ch = String.fromCharCode(eval("0x" + subText)); |
|
|
} |
|
|
|
|
|
i = rightIdx; |
|
|
} |
|
|
} |
|
|
|
|
|
newText += ch; |
|
|
} |
|
|
|
|
|
return newText; |
|
|
}; |
|
|
|
|
|
// replace the html special tags |
|
|
BI.htmlEncode = function (text) { |
|
|
return (text == null) ? "" : String(text).replace(/&/g, "&").replace(/\"/g, """).replace(/</g, "<").replace(/>/g, ">").replace(/\s/g, " "); |
|
|
}; |
|
|
// html decode |
|
|
BI.htmlDecode = function (text) { |
|
|
return (text == null) ? "" : String(text).replace(/&/g, "&").replace(/"/g, "\"").replace(/</g, "<").replace(/>/g, ">").replace(/ /g, " "); |
|
|
}; |
|
|
|
|
|
BI.cjkEncodeDO = function (o) { |
|
|
if (BI.isPlainObject(o)) { |
|
|
var result = {}; |
|
|
_.each(o, function (v, k) { |
|
|
if (!(typeof v === "string")) { |
|
|
v = BI.jsonEncode(v); |
|
|
} |
|
|
// wei:bug 43338,如果key是中文,cjkencode后o的长度就加了1,ie9以下版本死循环,所以新建对象result。 |
|
|
k = BI.cjkEncode(k); |
|
|
result[k] = BI.cjkEncode(v); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
return o; |
|
|
}; |
|
|
|
|
|
BI.jsonEncode = function (o) { |
|
|
// james:这个Encode是抄的EXT的 |
|
|
var useHasOwn = !!{}.hasOwnProperty; |
|
|
|
|
|
// crashes Safari in some instances |
|
|
// var validRE = /^("(\\.|[^"\\\n\r])*?"|[,:{}\[\]0-9.\-+Eaeflnr-u \n\r\t])+?$/; |
|
|
|
|
|
var m = { |
|
|
"\b": "\\b", |
|
|
"\t": "\\t", |
|
|
"\n": "\\n", |
|
|
"\f": "\\f", |
|
|
"\r": "\\r", |
|
|
"\"": "\\\"", |
|
|
"\\": "\\\\" |
|
|
}; |
|
|
|
|
|
var encodeString = function (s) { |
|
|
if (/["\\\x00-\x1f]/.test(s)) { |
|
|
return "\"" + s.replace(/([\x00-\x1f\\"])/g, function (a, b) { |
|
|
var c = m[b]; |
|
|
if (c) { |
|
|
return c; |
|
|
} |
|
|
c = b.charCodeAt(); |
|
|
return "\\u00" + |
|
|
Math.floor(c / 16).toString(16) + |
|
|
(c % 16).toString(16); |
|
|
}) + "\""; |
|
|
} |
|
|
return "\"" + s + "\""; |
|
|
}; |
|
|
|
|
|
var encodeArray = function (o) { |
|
|
var a = ["["], b, i, l = o.length, v; |
|
|
for (i = 0; i < l; i += 1) { |
|
|
v = o[i]; |
|
|
switch (typeof v) { |
|
|
case "undefined": |
|
|
case "function": |
|
|
case "unknown": |
|
|
break; |
|
|
default: |
|
|
if (b) { |
|
|
a.push(","); |
|
|
} |
|
|
a.push(v === null ? "null" : BI.jsonEncode(v)); |
|
|
b = true; |
|
|
} |
|
|
} |
|
|
a.push("]"); |
|
|
return a.join(""); |
|
|
}; |
|
|
|
|
|
if (typeof o === "undefined" || o === null) { |
|
|
return "null"; |
|
|
} else if (BI.isArray(o)) { |
|
|
return encodeArray(o); |
|
|
} else if (o instanceof Date) { |
|
|
/* |
|
|
* alex:原来只是把年月日时分秒简单地拼成一个String,无法decode |
|
|
* 现在这么处理就可以decode了,但是JS.jsonDecode和Java.JSONObject也要跟着改一下 |
|
|
*/ |
|
|
return BI.jsonEncode({ |
|
|
__time__: o.getTime() |
|
|
}); |
|
|
} else if (typeof o === "string") { |
|
|
return encodeString(o); |
|
|
} else if (typeof o === "number") { |
|
|
return isFinite(o) ? String(o) : "null"; |
|
|
} else if (typeof o === "boolean") { |
|
|
return String(o); |
|
|
} else if (BI.isFunction(o)) { |
|
|
return String(o); |
|
|
} |
|
|
var a = ["{"], b, i, v; |
|
|
for (i in o) { |
|
|
if (!useHasOwn || o.hasOwnProperty(i)) { |
|
|
v = o[i]; |
|
|
switch (typeof v) { |
|
|
case "undefined": |
|
|
case "unknown": |
|
|
break; |
|
|
default: |
|
|
if (b) { |
|
|
a.push(","); |
|
|
} |
|
|
a.push(BI.jsonEncode(i), ":", |
|
|
v === null ? "null" : BI.jsonEncode(v)); |
|
|
b = true; |
|
|
} |
|
|
} |
|
|
} |
|
|
a.push("}"); |
|
|
return a.join(""); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.jsonDecode = function (text) { |
|
|
|
|
|
try { |
|
|
// 注意0啊 |
|
|
// var jo = $.parseJSON(text) || {}; |
|
|
var jo = $ ? $.parseJSON(text) : window.JSON.parse(text); |
|
|
if (jo == null) { |
|
|
jo = {}; |
|
|
} |
|
|
} catch (e) { |
|
|
/* |
|
|
* richie:浏览器只支持标准的JSON字符串转换,而jQuery会默认调用浏览器的window.JSON.parse()函数进行解析 |
|
|
* 比如:var str = "{'a':'b'}",这种形式的字符串转换为JSON就会抛异常 |
|
|
*/ |
|
|
try { |
|
|
jo = new Function("return " + text)() || {}; |
|
|
} catch (e) { |
|
|
// do nothing |
|
|
} |
|
|
if (jo == null) { |
|
|
jo = []; |
|
|
} |
|
|
} |
|
|
if (!_hasDateInJson(text)) { |
|
|
return jo; |
|
|
} |
|
|
|
|
|
function _hasDateInJson (json) { |
|
|
if (!json || typeof json !== "string") { |
|
|
return false; |
|
|
} |
|
|
return json.indexOf("__time__") != -1; |
|
|
} |
|
|
|
|
|
return (function (o) { |
|
|
if (typeof o === "string") { |
|
|
return o; |
|
|
} |
|
|
if (o && o.__time__ != null) { |
|
|
return new Date(o.__time__); |
|
|
} |
|
|
for (var a in o) { |
|
|
if (o[a] == o || typeof o[a] === "object" || _.isFunction(o[a])) { |
|
|
break; |
|
|
} |
|
|
o[a] = arguments.callee(o[a]); |
|
|
} |
|
|
|
|
|
return o; |
|
|
})(jo); |
|
|
}; |
|
|
|
|
|
BI.contentFormat = function (cv, fmt) { |
|
|
if (isEmpty(cv)) { |
|
|
// 原值为空,返回空字符 |
|
|
return ""; |
|
|
} |
|
|
var text = cv.toString(); |
|
|
if (isEmpty(fmt)) { |
|
|
// 格式为空,返回原字符 |
|
|
return text; |
|
|
} |
|
|
if (fmt.match(/^T/)) { |
|
|
// T - 文本格式 |
|
|
return text; |
|
|
} else if (fmt.match(/^D/)) { |
|
|
// D - 日期(时间)格式 |
|
|
if (!(cv instanceof Date)) { |
|
|
if (typeof cv === "number") { |
|
|
// 毫秒数类型 |
|
|
cv = new Date(cv); |
|
|
} else { |
|
|
// 字符串类型,如yyyyMMdd、MMddyyyy等这样无分隔符的结构 |
|
|
cv = Date.parseDate(cv + "", Date.patterns.ISO8601Long); |
|
|
} |
|
|
} |
|
|
if (!BI.isNull(cv)) { |
|
|
var needTrim = fmt.match(/^DT/); |
|
|
text = BI.date2Str(cv, fmt.substring(needTrim ? 2 : 1)); |
|
|
} |
|
|
} else if (fmt.match(/E/)) { |
|
|
// 科学计数格式 |
|
|
text = _eFormat(text, fmt); |
|
|
} else { |
|
|
// 数字格式 |
|
|
var s = []; |
|
|
BI.clamp(s); |
|
|
text = _numberFormat(text, fmt); |
|
|
} |
|
|
// ¤ - 货币格式 |
|
|
text = text.replace(/¤/g, "¥"); |
|
|
return text; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 将Java提供的日期格式字符串装换为JS识别的日期格式字符串 |
|
|
* @class FR.parseFmt |
|
|
* @param fmt 日期格式 |
|
|
* @returns {String} |
|
|
*/ |
|
|
BI.parseFmt = function (fmt) { |
|
|
if (!fmt) { |
|
|
return ""; |
|
|
} |
|
|
//日期 |
|
|
fmt = String(fmt) |
|
|
//年 |
|
|
.replace(/y{4,}/g, "%Y")//yyyy的时候替换为Y |
|
|
.replace(/y{2}/g, "%y")//yy的时候替换为y |
|
|
//月 |
|
|
.replace(/M{4,}/g, "%b")//MMMM的时候替换为b,八 |
|
|
.replace(/M{3}/g, "%B")//MMM的时候替换为M,八月 |
|
|
.replace(/M{2}/g, "%X")//MM的时候替换为X,08 |
|
|
.replace(/M{1}/g, "%x")//M的时候替换为x,8 |
|
|
.replace(/a{1}/g, "%p"); |
|
|
//天 |
|
|
if (new RegExp("d{2,}", "g").test(fmt)) { |
|
|
fmt = fmt.replace(/d{2,}/g, "%d");//dd的时候替换为d |
|
|
} else { |
|
|
fmt = fmt.replace(/d{1}/g, "%e");//d的时候替换为j |
|
|
} |
|
|
//时 |
|
|
if (new RegExp("h{2,}", "g").test(fmt)) {//12小时制 |
|
|
fmt = fmt.replace(/h{2,}/g, "%I"); |
|
|
} else { |
|
|
fmt = fmt.replace(/h{1}/g, "%I"); |
|
|
} |
|
|
if (new RegExp("H{2,}", "g").test(fmt)) {//24小时制 |
|
|
fmt = fmt.replace(/H{2,}/g, "%H"); |
|
|
} else { |
|
|
fmt = fmt.replace(/H{1}/g, "%H"); |
|
|
} |
|
|
fmt = fmt.replace(/m{2,}/g, "%M")//分 |
|
|
//秒 |
|
|
.replace(/s{2,}/g, "%S"); |
|
|
|
|
|
return fmt; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 把字符串按照对应的格式转化成日期对象 |
|
|
* |
|
|
* @example |
|
|
* var result = FR.str2Date('2013-12-12', 'yyyy-MM-dd');//Thu Dec 12 2013 00:00:00 GMT+0800 |
|
|
* |
|
|
* @class FR.str2Date |
|
|
* @param str 字符串 |
|
|
* @param format 日期格式 |
|
|
* @returns {*} |
|
|
*/ |
|
|
BI.str2Date = function (str, format) { |
|
|
if (typeof str != "string" || typeof format != "string") { |
|
|
return null; |
|
|
} |
|
|
var fmt = BI.parseFmt(format); |
|
|
return BI.parseDateTime(str, fmt); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 把日期对象按照指定格式转化成字符串 |
|
|
* |
|
|
* @example |
|
|
* var date = new Date('Thu Dec 12 2013 00:00:00 GMT+0800'); |
|
|
* var result = BI.date2Str(date, 'yyyy-MM-dd');//2013-12-12 |
|
|
* |
|
|
* @class BI.date2Str |
|
|
* @param date 日期 |
|
|
* @param format 日期格式 |
|
|
* @returns {String} |
|
|
*/ |
|
|
BI.date2Str = function (date, format) { |
|
|
if (!date) { |
|
|
return ""; |
|
|
} |
|
|
// O(len(format)) |
|
|
var len = format.length, result = ""; |
|
|
if (len > 0) { |
|
|
var flagch = format.charAt(0), start = 0, str = flagch; |
|
|
for (var i = 1; i < len; i++) { |
|
|
var ch = format.charAt(i); |
|
|
if (flagch !== ch) { |
|
|
result += compileJFmt({ |
|
|
char: flagch, |
|
|
str: str, |
|
|
len: i - start |
|
|
}, date); |
|
|
flagch = ch; |
|
|
start = i; |
|
|
str = flagch; |
|
|
} else { |
|
|
str += ch; |
|
|
} |
|
|
} |
|
|
result += compileJFmt({ |
|
|
char: flagch, |
|
|
str: str, |
|
|
len: len - start |
|
|
}, date); |
|
|
} |
|
|
return result; |
|
|
|
|
|
function compileJFmt (jfmt, date) { |
|
|
var str = jfmt.str, len = jfmt.len, ch = jfmt["char"]; |
|
|
switch (ch) { |
|
|
case "E": // 星期 |
|
|
str = Date._DN[date.getDay()]; |
|
|
break; |
|
|
case "y": // 年 |
|
|
if (len <= 3) { |
|
|
str = (date.getFullYear() + "").slice(2, 4); |
|
|
} else { |
|
|
str = date.getFullYear(); |
|
|
} |
|
|
break; |
|
|
case "M": // 月 |
|
|
if (len > 2) { |
|
|
str = Date._MN[date.getMonth()]; |
|
|
} else if (len < 2) { |
|
|
str = date.getMonth() + 1; |
|
|
} else { |
|
|
str = BI.leftPad(date.getMonth() + 1 + "", 2, "0"); |
|
|
} |
|
|
break; |
|
|
case "d": // 日 |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getDate() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getDate(); |
|
|
} |
|
|
break; |
|
|
case "h": // 时(12) |
|
|
var hour = date.getHours() % 12; |
|
|
if (hour === 0) { |
|
|
hour = 12; |
|
|
} |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(hour + "", 2, "0"); |
|
|
} else { |
|
|
str = hour; |
|
|
} |
|
|
break; |
|
|
case "H": // 时(24) |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getHours() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getHours(); |
|
|
} |
|
|
break; |
|
|
case "m": |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getMinutes() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getMinutes(); |
|
|
} |
|
|
break; |
|
|
case "s": |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getSeconds() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getSeconds(); |
|
|
} |
|
|
break; |
|
|
case "a": |
|
|
str = date.getHours() < 12 ? "am" : "pm"; |
|
|
break; |
|
|
case "z": |
|
|
str = date.getTimezone(); |
|
|
break; |
|
|
default: |
|
|
str = jfmt.str; |
|
|
break; |
|
|
} |
|
|
return str; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.object2Number = function (value) { |
|
|
if (value == null) { |
|
|
return 0; |
|
|
} |
|
|
if (typeof value === "number") { |
|
|
return value; |
|
|
} |
|
|
var str = value + ""; |
|
|
if (str.indexOf(".") === -1) { |
|
|
return parseInt(str); |
|
|
} |
|
|
return parseFloat(str); |
|
|
}; |
|
|
|
|
|
BI.object2Date = function (obj) { |
|
|
if (obj == null) { |
|
|
return new Date(); |
|
|
} |
|
|
if (obj instanceof Date) { |
|
|
return obj; |
|
|
} else if (typeof obj === "number") { |
|
|
return new Date(obj); |
|
|
} |
|
|
var str = obj + ""; |
|
|
str = str.replace(/-/g, "/"); |
|
|
var dt = new Date(str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
|
|
|
return new Date(); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.object2Time = function (obj) { |
|
|
if (obj == null) { |
|
|
return new Date(); |
|
|
} |
|
|
if (obj instanceof Date) { |
|
|
return obj; |
|
|
} |
|
|
var str = obj + ""; |
|
|
str = str.replace(/-/g, "/"); |
|
|
var dt = new Date(str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
if (str.indexOf("/") === -1 && str.indexOf(":") !== -1) { |
|
|
dt = new Date("1970/01/01 " + str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
} |
|
|
dt = BI.parseDateTime(str, "HH:mm:ss"); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
return new Date(); |
|
|
|
|
|
}; |
|
|
})(); |
|
|
(function () { |
|
|
var constantInjection = {}; |
|
|
BI.constant = function (xtype, cls) { |
|
|
if (constantInjection[xtype] != null) { |
|
|
throw ("constant:[" + xtype + "] has been registed"); |
|
|
} |
|
|
constantInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var modelInjection = {}; |
|
|
BI.model = function (xtype, cls) { |
|
|
if (modelInjection[xtype] != null) { |
|
|
throw ("model:[" + xtype + "] has been registed"); |
|
|
} |
|
|
modelInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var storeInjection = {}; |
|
|
BI.store = function (xtype, cls) { |
|
|
if (storeInjection[xtype] != null) { |
|
|
throw ("store:[" + xtype + "] has been registed"); |
|
|
} |
|
|
storeInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var serviceInjection = {}; |
|
|
BI.service = function (xtype, cls) { |
|
|
if (serviceInjection[xtype] != null) { |
|
|
throw ("service:[" + xtype + "] has been registed"); |
|
|
} |
|
|
serviceInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var providerInjection = {}; |
|
|
BI.provider = function (xtype, cls) { |
|
|
if (providerInjection[xtype] != null) { |
|
|
throw ("provider:[" + xtype + "] has been registed"); |
|
|
} |
|
|
providerInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
BI.config = function (type, configFn) { |
|
|
if (constantInjection[type]) { |
|
|
return constantInjection[type] = configFn(constantInjection[type]); |
|
|
} |
|
|
if (providerInjection[type]) { |
|
|
if (!providers[type]) { |
|
|
providers[type] = new providerInjection[type](); |
|
|
} |
|
|
return configFn(providers[type]); |
|
|
} |
|
|
BI.Plugin.configWidget(type, configFn); |
|
|
}; |
|
|
|
|
|
var actions = {}; |
|
|
BI.action = function (type, actionFn) { |
|
|
if (!actions[type]) { |
|
|
actions[type] = []; |
|
|
} |
|
|
actions[type].push(actionFn); |
|
|
return function () { |
|
|
actions[type].remove(actionFn); |
|
|
if (actions[type].length === 0) { |
|
|
delete actions[type]; |
|
|
} |
|
|
}; |
|
|
}; |
|
|
|
|
|
var points = {}; |
|
|
BI.point = function (type, action, pointFn, after) { |
|
|
if (!points[type]) { |
|
|
points[type] = {}; |
|
|
} |
|
|
if (!points[type][action]) { |
|
|
points[type][action] = {}; |
|
|
} |
|
|
if (!points[type][action][after ? "after" : "before"]) { |
|
|
points[type][action][after ? "after" : "before"] = []; |
|
|
} |
|
|
points[type][action][after ? "after" : "before"].push(pointFn); |
|
|
}; |
|
|
|
|
|
BI.Constants = { |
|
|
getConstant: function (type) { |
|
|
return constantInjection[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var callPoint = function (inst, type) { |
|
|
if (points[type]) { |
|
|
for (var action in points[type]) { |
|
|
var bfns = points[type][action].before; |
|
|
if (bfns) { |
|
|
BI.aspect.before(inst, action, function (bfns) { |
|
|
return function () { |
|
|
for (var i = 0, len = bfns.length; i < len; i++) { |
|
|
try { |
|
|
bfns[i].apply(inst, arguments); |
|
|
} catch (e) { |
|
|
console.error(e); |
|
|
} |
|
|
} |
|
|
}; |
|
|
}(bfns)); |
|
|
} |
|
|
var afns = points[type][action].after; |
|
|
if (afns) { |
|
|
BI.aspect.after(inst, action, function (afns) { |
|
|
return function () { |
|
|
for (var i = 0, len = afns.length; i < len; i++) { |
|
|
try { |
|
|
afns[i].apply(inst, arguments); |
|
|
} catch (e) { |
|
|
console.error(e); |
|
|
} |
|
|
} |
|
|
} |
|
|
}(afns)); |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Models = { |
|
|
getModel: function (type, config) { |
|
|
var inst = new modelInjection[type](config); |
|
|
callPoint(inst, type); |
|
|
return inst; |
|
|
} |
|
|
}; |
|
|
|
|
|
var stores = {}; |
|
|
|
|
|
BI.Stores = { |
|
|
getStore: function (type, config) { |
|
|
if (stores[type]) { |
|
|
return stores[type]; |
|
|
} |
|
|
stores[type] = new storeInjection[type](config); |
|
|
callPoint(stores[type], type); |
|
|
return stores[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var services = {}; |
|
|
|
|
|
BI.Services = { |
|
|
getService: function (type, config) { |
|
|
if (services[type]) { |
|
|
return services[type]; |
|
|
} |
|
|
services[type] = new serviceInjection[type](config); |
|
|
callPoint(services[type], type); |
|
|
return services[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var providers = {}, providerInstance = {}; |
|
|
|
|
|
BI.Providers = { |
|
|
getProvider: function (type, config) { |
|
|
if (!providers[type]) { |
|
|
providers[type] = new providerInjection[type](); |
|
|
} |
|
|
if (!providerInstance[type]) { |
|
|
providerInstance[type] = new providers[type].$get()(config); |
|
|
} |
|
|
return providerInstance[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Actions = { |
|
|
runAction: function (type, config) { |
|
|
BI.each(actions[type], function (i, act) { |
|
|
act(config); |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
(function (window, undefined) { |
|
|
function aspect (type) { |
|
|
return function (target, methodName, advice) { |
|
|
var exist = target[methodName], |
|
|
dispatcher; |
|
|
|
|
|
if (!exist || exist.target != target) { |
|
|
dispatcher = target[methodName] = function () { |
|
|
// before methods |
|
|
var beforeArr = dispatcher.before; |
|
|
var args = arguments, next; |
|
|
for (var l = beforeArr.length; l--;) { |
|
|
next = beforeArr[l].advice.apply(this, args); |
|
|
if (next === false) { |
|
|
return false; |
|
|
} |
|
|
args = next || args; |
|
|
} |
|
|
// target method |
|
|
var rs = dispatcher.method.apply(this, args); |
|
|
// after methods |
|
|
var afterArr = dispatcher.after; |
|
|
for (var i = 0, ii = afterArr.length; i < ii; i++) { |
|
|
next = afterArr[i].advice.call(this, rs, args); |
|
|
if (rs === false) { |
|
|
return false; |
|
|
} |
|
|
args = next || args; |
|
|
} |
|
|
return rs; |
|
|
}; |
|
|
|
|
|
dispatcher.before = []; |
|
|
dispatcher.after = []; |
|
|
|
|
|
if (exist) { |
|
|
dispatcher.method = exist; |
|
|
} |
|
|
dispatcher.target = target; |
|
|
} |
|
|
|
|
|
var aspectArr = (dispatcher || exist)[type]; |
|
|
var obj = { |
|
|
advice: advice, |
|
|
_index: aspectArr.length, |
|
|
remove: function () { |
|
|
aspectArr.splice(this._index, 1); |
|
|
} |
|
|
}; |
|
|
aspectArr.push(obj); |
|
|
|
|
|
return obj; |
|
|
}; |
|
|
} |
|
|
|
|
|
BI.aspect = { |
|
|
before: aspect("before"), |
|
|
after: aspect("after") |
|
|
}; |
|
|
|
|
|
return BI.aspect; |
|
|
|
|
|
})(window); |
|
|
!(function () { |
|
|
|
|
|
var _keyStr = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/="; |
|
|
|
|
|
|
|
|
// private method for UTF-8 encoding |
|
|
var _utf8_encode = function (string) { |
|
|
string = string.replace(/\r\n/g, "\n"); |
|
|
var utftext = ""; |
|
|
|
|
|
for (var n = 0; n < string.length; n++) { |
|
|
|
|
|
var c = string.charCodeAt(n); |
|
|
|
|
|
if (c < 128) { |
|
|
utftext += String.fromCharCode(c); |
|
|
} else if ((c > 127) && (c < 2048)) { |
|
|
utftext += String.fromCharCode((c >> 6) | 192); |
|
|
utftext += String.fromCharCode((c & 63) | 128); |
|
|
} else { |
|
|
utftext += String.fromCharCode((c >> 12) | 224); |
|
|
utftext += String.fromCharCode(((c >> 6) & 63) | 128); |
|
|
utftext += String.fromCharCode((c & 63) | 128); |
|
|
} |
|
|
|
|
|
} |
|
|
|
|
|
return utftext; |
|
|
}; |
|
|
|
|
|
// private method for UTF-8 decoding |
|
|
var _utf8_decode = function (utftext) { |
|
|
var string = ""; |
|
|
var i = 0; |
|
|
var c = 0, c3 = 0, c2 = 0; |
|
|
|
|
|
while (i < utftext.length) { |
|
|
|
|
|
c = utftext.charCodeAt(i); |
|
|
|
|
|
if (c < 128) { |
|
|
string += String.fromCharCode(c); |
|
|
i++; |
|
|
} else if ((c > 191) && (c < 224)) { |
|
|
c2 = utftext.charCodeAt(i + 1); |
|
|
string += String.fromCharCode(((c & 31) << 6) | (c2 & 63)); |
|
|
i += 2; |
|
|
} else { |
|
|
c2 = utftext.charCodeAt(i + 1); |
|
|
c3 = utftext.charCodeAt(i + 2); |
|
|
string += String.fromCharCode(((c & 15) << 12) | ((c2 & 63) << 6) | (c3 & 63)); |
|
|
i += 3; |
|
|
} |
|
|
|
|
|
} |
|
|
return string; |
|
|
}; |
|
|
|
|
|
_.extend(BI, { |
|
|
|
|
|
encode: function (input) { |
|
|
var output = ""; |
|
|
var chr1, chr2, chr3, enc1, enc2, enc3, enc4; |
|
|
var i = 0; |
|
|
|
|
|
input = _utf8_encode(input); |
|
|
|
|
|
while (i < input.length) { |
|
|
|
|
|
chr1 = input.charCodeAt(i++); |
|
|
chr2 = input.charCodeAt(i++); |
|
|
chr3 = input.charCodeAt(i++); |
|
|
|
|
|
enc1 = chr1 >> 2; |
|
|
enc2 = ((chr1 & 3) << 4) | (chr2 >> 4); |
|
|
enc3 = ((chr2 & 15) << 2) | (chr3 >> 6); |
|
|
enc4 = chr3 & 63; |
|
|
|
|
|
if (isNaN(chr2)) { |
|
|
enc3 = enc4 = 64; |
|
|
} else if (isNaN(chr3)) { |
|
|
enc4 = 64; |
|
|
} |
|
|
|
|
|
output = output + _keyStr.charAt(enc1) + _keyStr.charAt(enc2) + _keyStr.charAt(enc3) + _keyStr.charAt(enc4); |
|
|
|
|
|
} |
|
|
|
|
|
return output; |
|
|
}, |
|
|
|
|
|
// public method for decoding |
|
|
decode: function (input) { |
|
|
var output = ""; |
|
|
var chr1, chr2, chr3; |
|
|
var enc1, enc2, enc3, enc4; |
|
|
var i = 0; |
|
|
|
|
|
input = input.replace(/[^A-Za-z0-9\+\/\=]/g, ""); |
|
|
|
|
|
while (i < input.length) { |
|
|
|
|
|
enc1 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc2 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc3 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc4 = _keyStr.indexOf(input.charAt(i++)); |
|
|
|
|
|
chr1 = (enc1 << 2) | (enc2 >> 4); |
|
|
chr2 = ((enc2 & 15) << 4) | (enc3 >> 2); |
|
|
chr3 = ((enc3 & 3) << 6) | enc4; |
|
|
|
|
|
output = output + String.fromCharCode(chr1); |
|
|
|
|
|
if (enc3 != 64) { |
|
|
output = output + String.fromCharCode(chr2); |
|
|
} |
|
|
if (enc4 != 64) { |
|
|
output = output + String.fromCharCode(chr3); |
|
|
} |
|
|
|
|
|
} |
|
|
|
|
|
output = _utf8_decode(output); |
|
|
|
|
|
return output; |
|
|
|
|
|
} |
|
|
}); |
|
|
})(); |
|
|
BI.Cache = { |
|
|
_prefix: "bi", |
|
|
setUsername: function (username) { |
|
|
localStorage.setItem(BI.Cache._prefix + ".username", (username + "" || "").toUpperCase()); |
|
|
}, |
|
|
getUsername: function () { |
|
|
return localStorage.getItem(BI.Cache._prefix + ".username") || ""; |
|
|
}, |
|
|
_getKeyPrefix: function () { |
|
|
return BI.Cache.getUsername() + "." + BI.Cache._prefix + "."; |
|
|
}, |
|
|
_generateKey: function (key) { |
|
|
return BI.Cache._getKeyPrefix() + (key || ""); |
|
|
}, |
|
|
getItem: function (key) { |
|
|
return localStorage.getItem(BI.Cache._generateKey(key)); |
|
|
}, |
|
|
setItem: function (key, value) { |
|
|
localStorage.setItem(BI.Cache._generateKey(key), value); |
|
|
}, |
|
|
removeItem: function (key) { |
|
|
localStorage.removeItem(BI.Cache._generateKey(key)); |
|
|
}, |
|
|
clear: function () { |
|
|
for (var i = localStorage.length; i >= 0; i--) { |
|
|
var key = localStorage.key(i); |
|
|
if (key) { |
|
|
if (key.indexOf(BI.Cache._getKeyPrefix()) === 0) { |
|
|
localStorage.removeItem(key); |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
keys: function () { |
|
|
var result = []; |
|
|
for (var i = localStorage.length; i >= 0; i--) { |
|
|
var key = localStorage.key(i); |
|
|
if (key) { |
|
|
var prefix = BI.Cache._getKeyPrefix(); |
|
|
if (key.indexOf(prefix) === 0) { |
|
|
result[result.length] = key.substring(prefix.length); |
|
|
} |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}, |
|
|
|
|
|
addCookie: function (name, value, path, expiresHours) { |
|
|
var cookieString = name + "=" + escape(value); |
|
|
// 判断是否设置过期时间 |
|
|
if (expiresHours && expiresHours > 0) { |
|
|
var date = new Date(); |
|
|
date.setTime(BI.getTime() + expiresHours * 3600 * 1000); |
|
|
cookieString = cookieString + "; expires=" + date.toGMTString(); |
|
|
} |
|
|
if (path) { |
|
|
cookieString = cookieString + "; path=" + path; |
|
|
} |
|
|
document.cookie = cookieString; |
|
|
}, |
|
|
getCookie: function (name) { |
|
|
var arr, reg = new RegExp("(^| )" + name + "=([^;]*)(;|$)"); |
|
|
if (arr = document.cookie.match(reg)) {return unescape(arr[2]);} |
|
|
return null; |
|
|
}, |
|
|
deleteCookie: function (name, path) { |
|
|
var date = new Date(); |
|
|
date.setTime(BI.getTime() - 10000); |
|
|
var cookieString = name + "=v; expires=" + date.toGMTString(); |
|
|
if (path) { |
|
|
cookieString = cookieString + "; path=" + path; |
|
|
} |
|
|
document.cookie = cookieString; |
|
|
} |
|
|
};BI.CellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize) { |
|
|
this._cellSizeGetter = cellSizeGetter; |
|
|
this._cellCount = cellCount; |
|
|
this._estimatedCellSize = estimatedCellSize; |
|
|
this._cellSizeAndPositionData = {}; |
|
|
this._lastMeasuredIndex = -1; |
|
|
}; |
|
|
|
|
|
BI.CellSizeAndPositionManager.prototype = { |
|
|
constructor: BI.CellSizeAndPositionManager, |
|
|
configure: function (cellCount, estimatedCellSize) { |
|
|
this._cellCount = cellCount; |
|
|
this._estimatedCellSize = estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getCellCount: function () { |
|
|
return this._cellCount; |
|
|
}, |
|
|
|
|
|
getEstimatedCellSize: function () { |
|
|
return this._estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getLastMeasuredIndex: function () { |
|
|
return this._lastMeasuredIndex; |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfCell: function (index) { |
|
|
if (index < 0 || index >= this._cellCount) { |
|
|
return; |
|
|
} |
|
|
if (index > this._lastMeasuredIndex) { |
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
var offset = lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size; |
|
|
|
|
|
for (var i = this._lastMeasuredIndex + 1; i <= index; i++) { |
|
|
var size = this._cellSizeGetter(i); |
|
|
|
|
|
if (size == null || isNaN(size)) { |
|
|
continue; |
|
|
} |
|
|
|
|
|
this._cellSizeAndPositionData[i] = { |
|
|
offset: offset, |
|
|
size: size |
|
|
}; |
|
|
|
|
|
offset += size; |
|
|
} |
|
|
|
|
|
this._lastMeasuredIndex = index; |
|
|
} |
|
|
return this._cellSizeAndPositionData[index]; |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfLastMeasuredCell: function () { |
|
|
return this._lastMeasuredIndex >= 0 |
|
|
? this._cellSizeAndPositionData[this._lastMeasuredIndex] |
|
|
: { |
|
|
offset: 0, |
|
|
size: 0 |
|
|
}; |
|
|
}, |
|
|
|
|
|
getTotalSize: function () { |
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
return lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size + (this._cellCount - this._lastMeasuredIndex - 1) * this._estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) { |
|
|
var datum = this.getSizeAndPositionOfCell(targetIndex); |
|
|
var maxOffset = datum.offset; |
|
|
var minOffset = maxOffset - containerSize + datum.size; |
|
|
|
|
|
var idealOffset; |
|
|
|
|
|
switch (align) { |
|
|
case "start": |
|
|
idealOffset = maxOffset; |
|
|
break; |
|
|
case "end": |
|
|
idealOffset = minOffset; |
|
|
break; |
|
|
case "center": |
|
|
idealOffset = maxOffset - ((containerSize - datum.size) / 2); |
|
|
break; |
|
|
default: |
|
|
idealOffset = Math.max(minOffset, Math.min(maxOffset, currentOffset)); |
|
|
break; |
|
|
} |
|
|
|
|
|
var totalSize = this.getTotalSize(); |
|
|
|
|
|
return Math.max(0, Math.min(totalSize - containerSize, idealOffset)); |
|
|
}, |
|
|
|
|
|
getVisibleCellRange: function (containerSize, offset) { |
|
|
var totalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === 0) { |
|
|
return {}; |
|
|
} |
|
|
|
|
|
var maxOffset = offset + containerSize; |
|
|
var start = this._findNearestCell(offset); |
|
|
|
|
|
var datum = this.getSizeAndPositionOfCell(start); |
|
|
offset = datum.offset + datum.size; |
|
|
|
|
|
var stop = start; |
|
|
|
|
|
while (offset < maxOffset && stop < this._cellCount - 1) { |
|
|
stop++; |
|
|
offset += this.getSizeAndPositionOfCell(stop).size; |
|
|
} |
|
|
|
|
|
return { |
|
|
start: start, |
|
|
stop: stop |
|
|
}; |
|
|
}, |
|
|
|
|
|
resetCell: function (index) { |
|
|
this._lastMeasuredIndex = Math.min(this._lastMeasuredIndex, index - 1); |
|
|
}, |
|
|
|
|
|
_binarySearch: function (high, low, offset) { |
|
|
var middle; |
|
|
var currentOffset; |
|
|
|
|
|
while (low <= high) { |
|
|
middle = low + Math.floor((high - low) / 2); |
|
|
currentOffset = this.getSizeAndPositionOfCell(middle).offset; |
|
|
|
|
|
if (currentOffset === offset) { |
|
|
return middle; |
|
|
} else if (currentOffset < offset) { |
|
|
low = middle + 1; |
|
|
} else if (currentOffset > offset) { |
|
|
high = middle - 1; |
|
|
} |
|
|
} |
|
|
|
|
|
if (low > 0) { |
|
|
return low - 1; |
|
|
} |
|
|
}, |
|
|
|
|
|
_exponentialSearch: function (index, offset) { |
|
|
var interval = 1; |
|
|
|
|
|
while (index < this._cellCount && this.getSizeAndPositionOfCell(index).offset < offset) { |
|
|
index += interval; |
|
|
interval *= 2; |
|
|
} |
|
|
|
|
|
return this._binarySearch(Math.min(index, this._cellCount - 1), Math.floor(index / 2), offset); |
|
|
}, |
|
|
|
|
|
_findNearestCell: function (offset) { |
|
|
if (isNaN(offset)) { |
|
|
return; |
|
|
} |
|
|
|
|
|
offset = Math.max(0, offset); |
|
|
|
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
var lastMeasuredIndex = Math.max(0, this._lastMeasuredIndex); |
|
|
|
|
|
if (lastMeasuredCellSizeAndPosition.offset >= offset) { |
|
|
return this._binarySearch(lastMeasuredIndex, 0, offset); |
|
|
} |
|
|
return this._exponentialSearch(lastMeasuredIndex, offset); |
|
|
|
|
|
} |
|
|
}; |
|
|
|
|
|
BI.ScalingCellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize, maxScrollSize) { |
|
|
this._cellSizeAndPositionManager = new BI.CellSizeAndPositionManager(cellCount, cellSizeGetter, estimatedCellSize); |
|
|
this._maxScrollSize = maxScrollSize || 10000000; |
|
|
}; |
|
|
|
|
|
BI.ScalingCellSizeAndPositionManager.prototype = { |
|
|
constructor: BI.ScalingCellSizeAndPositionManager, |
|
|
|
|
|
configure: function () { |
|
|
this._cellSizeAndPositionManager.configure.apply(this._cellSizeAndPositionManager, arguments); |
|
|
}, |
|
|
|
|
|
getCellCount: function () { |
|
|
return this._cellSizeAndPositionManager.getCellCount(); |
|
|
}, |
|
|
|
|
|
getEstimatedCellSize: function () { |
|
|
return this._cellSizeAndPositionManager.getEstimatedCellSize(); |
|
|
}, |
|
|
|
|
|
getLastMeasuredIndex: function () { |
|
|
return this._cellSizeAndPositionManager.getLastMeasuredIndex(); |
|
|
}, |
|
|
|
|
|
getOffsetAdjustment: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (safeTotalSize - totalSize)); |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfCell: function (index) { |
|
|
return this._cellSizeAndPositionManager.getSizeAndPositionOfCell(index); |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfLastMeasuredCell: function () { |
|
|
return this._cellSizeAndPositionManager.getSizeAndPositionOfLastMeasuredCell(); |
|
|
}, |
|
|
|
|
|
getTotalSize: function () { |
|
|
return Math.min(this._maxScrollSize, this._cellSizeAndPositionManager.getTotalSize()); |
|
|
}, |
|
|
|
|
|
getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) { |
|
|
currentOffset = this._safeOffsetToOffset(containerSize, currentOffset); |
|
|
|
|
|
var offset = this._cellSizeAndPositionManager.getUpdatedOffsetForIndex(align, containerSize, currentOffset, targetIndex); |
|
|
|
|
|
return this._offsetToSafeOffset(containerSize, offset); |
|
|
}, |
|
|
|
|
|
getVisibleCellRange: function (containerSize, offset) { |
|
|
offset = this._safeOffsetToOffset(containerSize, offset); |
|
|
|
|
|
return this._cellSizeAndPositionManager.getVisibleCellRange(containerSize, offset); |
|
|
}, |
|
|
|
|
|
resetCell: function (index) { |
|
|
this._cellSizeAndPositionManager.resetCell(index); |
|
|
}, |
|
|
|
|
|
_getOffsetPercentage: function (containerSize, offset, totalSize) { |
|
|
return totalSize <= containerSize |
|
|
? 0 |
|
|
: offset / (totalSize - containerSize); |
|
|
}, |
|
|
|
|
|
_offsetToSafeOffset: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === safeTotalSize) { |
|
|
return offset; |
|
|
} |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, totalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (safeTotalSize - containerSize)); |
|
|
|
|
|
}, |
|
|
|
|
|
_safeOffsetToOffset: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === safeTotalSize) { |
|
|
return offset; |
|
|
} |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (totalSize - containerSize)); |
|
|
|
|
|
} |
|
|
};/** |
|
|
* 汉字拼音索引 |
|
|
*/ |
|
|
|
|
|
!(function () { |
|
|
var _ChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY"; |
|
|
|
|
|
// 此处收录了375个多音字,数据来自于http://www.51window.net/page/pinyin |
|
|
var oMultiDiff = { |
|
|
19969: "DZ", |
|
|
19975: "WM", |
|
|
19988: "QJ", |
|
|
20048: "YL", |
|
|
20056: "SC", |
|
|
20060: "NM", |
|
|
20094: "QG", |
|
|
20127: "QJ", |
|
|
20167: "QC", |
|
|
20193: "YG", |
|
|
20250: "KH", |
|
|
20256: "ZC", |
|
|
20282: "SC", |
|
|
20285: "QJG", |
|
|
20291: "TD", |
|
|
20314: "YD", |
|
|
20315: "BF", |
|
|
20340: "NE", |
|
|
20375: "TD", |
|
|
20389: "YJ", |
|
|
20391: "CZ", |
|
|
20415: "PB", |
|
|
20446: "YS", |
|
|
20447: "SQ", |
|
|
20504: "TC", |
|
|
20608: "KG", |
|
|
20854: "QJ", |
|
|
20857: "ZC", |
|
|
20911: "PF", |
|
|
20985: "AW", |
|
|
21032: "PB", |
|
|
21048: "XQ", |
|
|
21049: "SC", |
|
|
21089: "YS", |
|
|
21119: "JC", |
|
|
21242: "SB", |
|
|
21273: "SC", |
|
|
21305: "YP", |
|
|
21306: "QO", |
|
|
21330: "ZC", |
|
|
21333: "SDC", |
|
|
21345: "QK", |
|
|
21378: "CA", |
|
|
21397: "SC", |
|
|
21414: "XS", |
|
|
21442: "SC", |
|
|
21477: "JG", |
|
|
21480: "TD", |
|
|
21484: "ZS", |
|
|
21494: "YX", |
|
|
21505: "YX", |
|
|
21512: "HG", |
|
|
21523: "XH", |
|
|
21537: "PB", |
|
|
21542: "PF", |
|
|
21549: "KH", |
|
|
21571: "E", |
|
|
21574: "DA", |
|
|
21588: "TD", |
|
|
21589: "O", |
|
|
21618: "ZC", |
|
|
21621: "KHA", |
|
|
21632: "ZJ", |
|
|
21654: "KG", |
|
|
21679: "LKG", |
|
|
21683: "KH", |
|
|
21710: "A", |
|
|
21719: "YH", |
|
|
21734: "WOE", |
|
|
21769: "A", |
|
|
21780: "WN", |
|
|
21804: "XH", |
|
|
21834: "A", |
|
|
21899: "ZD", |
|
|
21903: "RN", |
|
|
21908: "WO", |
|
|
21939: "ZC", |
|
|
21956: "SA", |
|
|
21964: "YA", |
|
|
21970: "TD", |
|
|
22003: "A", |
|
|
22031: "JG", |
|
|
22040: "XS", |
|
|
22060: "ZC", |
|
|
22066: "ZC", |
|
|
22079: "MH", |
|
|
22129: "XJ", |
|
|
22179: "XA", |
|
|
22237: "NJ", |
|
|
22244: "TD", |
|
|
22280: "JQ", |
|
|
22300: "YH", |
|
|
22313: "XW", |
|
|
22331: "YQ", |
|
|
22343: "YJ", |
|
|
22351: "PH", |
|
|
22395: "DC", |
|
|
22412: "TD", |
|
|
22484: "PB", |
|
|
22500: "PB", |
|
|
22534: "ZD", |
|
|
22549: "DH", |
|
|
22561: "PB", |
|
|
22612: "TD", |
|
|
22771: "KQ", |
|
|
22831: "HB", |
|
|
22841: "JG", |
|
|
22855: "QJ", |
|
|
22865: "XQ", |
|
|
23013: "ML", |
|
|
23081: "WM", |
|
|
23487: "SX", |
|
|
23558: "QJ", |
|
|
23561: "YW", |
|
|
23586: "YW", |
|
|
23614: "YW", |
|
|
23615: "SN", |
|
|
23631: "PB", |
|
|
23646: "ZS", |
|
|
23663: "ZT", |
|
|
23673: "YG", |
|
|
23762: "TD", |
|
|
23769: "ZS", |
|
|
23780: "QJ", |
|
|
23884: "QK", |
|
|
24055: "XH", |
|
|
24113: "DC", |
|
|
24162: "ZC", |
|
|
24191: "GA", |
|
|
24273: "QJ", |
|
|
24324: "NL", |
|
|
24377: "TD", |
|
|
24378: "QJ", |
|
|
24439: "PF", |
|
|
24554: "ZS", |
|
|
24683: "TD", |
|
|
24694: "WE", |
|
|
24733: "LK", |
|
|
24925: "TN", |
|
|
25094: "ZG", |
|
|
25100: "XQ", |
|
|
25103: "XH", |
|
|
25153: "PB", |
|
|
25170: "PB", |
|
|
25179: "KG", |
|
|
25203: "PB", |
|
|
25240: "ZS", |
|
|
25282: "FB", |
|
|
25303: "NA", |
|
|
25324: "KG", |
|
|
25341: "ZY", |
|
|
25373: "WZ", |
|
|
25375: "XJ", |
|
|
25384: "A", |
|
|
25457: "A", |
|
|
25528: "SD", |
|
|
25530: "SC", |
|
|
25552: "TD", |
|
|
25774: "ZC", |
|
|
25874: "ZC", |
|
|
26044: "YW", |
|
|
26080: "WM", |
|
|
26292: "PB", |
|
|
26333: "PB", |
|
|
26355: "ZY", |
|
|
26366: "CZ", |
|
|
26397: "ZC", |
|
|
26399: "QJ", |
|
|
26415: "ZS", |
|
|
26451: "SB", |
|
|
26526: "ZC", |
|
|
26552: "JG", |
|
|
26561: "TD", |
|
|
26588: "JG", |
|
|
26597: "CZ", |
|
|
26629: "ZS", |
|
|
26638: "YL", |
|
|
26646: "XQ", |
|
|
26653: "KG", |
|
|
26657: "XJ", |
|
|
26727: "HG", |
|
|
26894: "ZC", |
|
|
26937: "ZS", |
|
|
26946: "ZC", |
|
|
26999: "KJ", |
|
|
27099: "KJ", |
|
|
27449: "YQ", |
|
|
27481: "XS", |
|
|
27542: "ZS", |
|
|
27663: "ZS", |
|
|
27748: "TS", |
|
|
27784: "SC", |
|
|
27788: "ZD", |
|
|
27795: "TD", |
|
|
27812: "O", |
|
|
27850: "PB", |
|
|
27852: "MB", |
|
|
27895: "SL", |
|
|
27898: "PL", |
|
|
27973: "QJ", |
|
|
27981: "KH", |
|
|
27986: "HX", |
|
|
27994: "XJ", |
|
|
28044: "YC", |
|
|
28065: "WG", |
|
|
28177: "SM", |
|
|
28267: "QJ", |
|
|
28291: "KH", |
|
|
28337: "ZQ", |
|
|
28463: "TL", |
|
|
28548: "DC", |
|
|
28601: "TD", |
|
|
28689: "PB", |
|
|
28805: "JG", |
|
|
28820: "QG", |
|
|
28846: "PB", |
|
|
28952: "TD", |
|
|
28975: "ZC", |
|
|
29100: "A", |
|
|
29325: "QJ", |
|
|
29575: "SL", |
|
|
29602: "FB", |
|
|
30010: "TD", |
|
|
30044: "CX", |
|
|
30058: "PF", |
|
|
30091: "YSP", |
|
|
30111: "YN", |
|
|
30229: "XJ", |
|
|
30427: "SC", |
|
|
30465: "SX", |
|
|
30631: "YQ", |
|
|
30655: "QJ", |
|
|
30684: "QJG", |
|
|
30707: "SD", |
|
|
30729: "XH", |
|
|
30796: "LG", |
|
|
30917: "PB", |
|
|
31074: "NM", |
|
|
31085: "JZ", |
|
|
31109: "SC", |
|
|
31181: "ZC", |
|
|
31192: "MLB", |
|
|
31293: "JQ", |
|
|
31400: "YX", |
|
|
31584: "YJ", |
|
|
31896: "ZN", |
|
|
31909: "ZY", |
|
|
31995: "XJ", |
|
|
32321: "PF", |
|
|
32327: "ZY", |
|
|
32418: "HG", |
|
|
32420: "XQ", |
|
|
32421: "HG", |
|
|
32438: "LG", |
|
|
32473: "GJ", |
|
|
32488: "TD", |
|
|
32521: "QJ", |
|
|
32527: "PB", |
|
|
32562: "ZSQ", |
|
|
32564: "JZ", |
|
|
32735: "ZD", |
|
|
32793: "PB", |
|
|
33071: "PF", |
|
|
33098: "XL", |
|
|
33100: "YA", |
|
|
33152: "PB", |
|
|
33261: "CX", |
|
|
33324: "BP", |
|
|
33333: "TD", |
|
|
33406: "YA", |
|
|
33426: "WM", |
|
|
33432: "PB", |
|
|
33445: "JG", |
|
|
33486: "ZN", |
|
|
33493: "TS", |
|
|
33507: "QJ", |
|
|
33540: "QJ", |
|
|
33544: "ZC", |
|
|
33564: "XQ", |
|
|
33617: "YT", |
|
|
33632: "QJ", |
|
|
33636: "XH", |
|
|
33637: "YX", |
|
|
33694: "WG", |
|
|
33705: "PF", |
|
|
33728: "YW", |
|
|
33882: "SR", |
|
|
34067: "WM", |
|
|
34074: "YW", |
|
|
34121: "QJ", |
|
|
34255: "ZC", |
|
|
34259: "XL", |
|
|
34425: "JH", |
|
|
34430: "XH", |
|
|
34485: "KH", |
|
|
34503: "YS", |
|
|
34532: "HG", |
|
|
34552: "XS", |
|
|
34558: "YE", |
|
|
34593: "ZL", |
|
|
34660: "YQ", |
|
|
34892: "XH", |
|
|
34928: "SC", |
|
|
34999: "QJ", |
|
|
35048: "PB", |
|
|
35059: "SC", |
|
|
35098: "ZC", |
|
|
35203: "TQ", |
|
|
35265: "JX", |
|
|
35299: "JX", |
|
|
35782: "SZ", |
|
|
35828: "YS", |
|
|
35830: "E", |
|
|
35843: "TD", |
|
|
35895: "YG", |
|
|
35977: "MH", |
|
|
36158: "JG", |
|
|
36228: "QJ", |
|
|
36426: "XQ", |
|
|
36466: "DC", |
|
|
36710: "JC", |
|
|
36711: "ZYG", |
|
|
36767: "PB", |
|
|
36866: "SK", |
|
|
36951: "YW", |
|
|
37034: "YX", |
|
|
37063: "XH", |
|
|
37218: "ZC", |
|
|
37325: "ZC", |
|
|
38063: "PB", |
|
|
38079: "TD", |
|
|
38085: "QY", |
|
|
38107: "DC", |
|
|
38116: "TD", |
|
|
38123: "YD", |
|
|
38224: "HG", |
|
|
38241: "XTC", |
|
|
38271: "ZC", |
|
|
38415: "YE", |
|
|
38426: "KH", |
|
|
38461: "YD", |
|
|
38463: "AE", |
|
|
38466: "PB", |
|
|
38477: "XJ", |
|
|
38518: "YT", |
|
|
38551: "WK", |
|
|
38585: "ZC", |
|
|
38704: "XS", |
|
|
38739: "LJ", |
|
|
38761: "GJ", |
|
|
38808: "SQ", |
|
|
39048: "JG", |
|
|
39049: "XJ", |
|
|
39052: "HG", |
|
|
39076: "CZ", |
|
|
39271: "XT", |
|
|
39534: "TD", |
|
|
39552: "TD", |
|
|
39584: "PB", |
|
|
39647: "SB", |
|
|
39730: "LG", |
|
|
39748: "TPB", |
|
|
40109: "ZQ", |
|
|
40479: "ND", |
|
|
40516: "HG", |
|
|
40536: "HG", |
|
|
40583: "QJ", |
|
|
40765: "YQ", |
|
|
40784: "QJ", |
|
|
40840: "YK", |
|
|
40863: "QJG" |
|
|
}; |
|
|
|
|
|
var _checkPYCh = function (ch) { |
|
|
var uni = ch.charCodeAt(0); |
|
|
// 如果不在汉字处理范围之内,返回原字符,也可以调用自己的处理函数 |
|
|
if (uni > 40869 || uni < 19968) {return ch;} // dealWithOthers(ch); |
|
|
return (oMultiDiff[uni] ? oMultiDiff[uni] : (_ChineseFirstPY.charAt(uni - 19968))); |
|
|
}; |
|
|
|
|
|
var _mkPYRslt = function (arr) { |
|
|
var arrRslt = [""], k; |
|
|
for (var i = 0, len = arr.length; i < len; i++) { |
|
|
var str = arr[i]; |
|
|
var strlen = str.length; |
|
|
if (strlen == 1) { |
|
|
for (k = 0; k < arrRslt.length; k++) { |
|
|
arrRslt[k] += str; |
|
|
} |
|
|
} else { |
|
|
var tmpArr = arrRslt.slice(0); |
|
|
arrRslt = []; |
|
|
for (k = 0; k < strlen; k++) { |
|
|
// 复制一个相同的arrRslt |
|
|
var tmp = tmpArr.slice(0); |
|
|
// 把当前字符str[k]添加到每个元素末尾 |
|
|
for (var j = 0; j < tmp.length; j++) { |
|
|
tmp[j] += str.charAt(k); |
|
|
} |
|
|
// 把复制并修改后的数组连接到arrRslt上 |
|
|
arrRslt = arrRslt.concat(tmp); |
|
|
} |
|
|
} |
|
|
} |
|
|
return arrRslt.join("").toLowerCase(); |
|
|
}; |
|
|
|
|
|
_.extend(BI, { |
|
|
makeFirstPY: function (str) { |
|
|
if (typeof (str) !== "string") {return "" + str;} |
|
|
var arrResult = []; // 保存中间结果的数组 |
|
|
for (var i = 0, len = str.length; i < len; i++) { |
|
|
// 获得unicode码 |
|
|
var ch = str.charAt(i); |
|
|
// 检查该unicode码是否在处理范围之内,在则返回该码对映汉字的拼音首字母,不在则调用其它函数处理 |
|
|
arrResult.push(_checkPYCh(ch)); |
|
|
} |
|
|
// 处理arrResult,返回所有可能的拼音首字母串数组 |
|
|
return _mkPYRslt(arrResult); |
|
|
} |
|
|
}); |
|
|
})();/** |
|
|
* Detect Element Resize. |
|
|
* Forked in order to guard against unsafe 'window' and 'document' references. |
|
|
* |
|
|
* https://github.com/sdecima/javascript-detect-element-resize |
|
|
* Sebastian Decima |
|
|
* |
|
|
* version: 0.5.3 |
|
|
**/ |
|
|
!(function () { |
|
|
// Check `document` and `window` in case of server-side rendering |
|
|
var _window; |
|
|
if (typeof window !== "undefined") { |
|
|
_window = window; |
|
|
} else if (typeof self !== "undefined") { |
|
|
_window = self; |
|
|
} else { |
|
|
_window = this; |
|
|
} |
|
|
|
|
|
var addEventListener = typeof document !== "undefined" && document.addEventListener; |
|
|
var stylesCreated = false; |
|
|
|
|
|
if (addEventListener) { |
|
|
var requestFrame = (function () { |
|
|
var raf = _window.requestAnimationFrame || _window.mozRequestAnimationFrame || _window.webkitRequestAnimationFrame || |
|
|
function (fn) { |
|
|
return _window.setTimeout(fn, 20); |
|
|
}; |
|
|
return function (fn) { |
|
|
return raf(fn); |
|
|
}; |
|
|
})(); |
|
|
|
|
|
var cancelFrame = (function () { |
|
|
var cancel = _window.cancelAnimationFrame || _window.mozCancelAnimationFrame || _window.webkitCancelAnimationFrame || |
|
|
_window.clearTimeout; |
|
|
return function (id) { |
|
|
return cancel(id); |
|
|
}; |
|
|
})(); |
|
|
|
|
|
var resetTriggers = function (element) { |
|
|
var triggers = element.__resizeTriggers__, |
|
|
expand = triggers.firstElementChild, |
|
|
contract = triggers.lastElementChild, |
|
|
expandChild = expand.firstElementChild; |
|
|
contract.scrollLeft = contract.scrollWidth; |
|
|
contract.scrollTop = contract.scrollHeight; |
|
|
expandChild.style.width = expand.offsetWidth + 1 + "px"; |
|
|
expandChild.style.height = expand.offsetHeight + 1 + "px"; |
|
|
expand.scrollLeft = expand.scrollWidth; |
|
|
expand.scrollTop = expand.scrollHeight; |
|
|
}; |
|
|
|
|
|
var checkTriggers = function (element) { |
|
|
return element.offsetWidth !== element.__resizeLast__.width || |
|
|
element.offsetHeight !== element.__resizeLast__.height; |
|
|
}; |
|
|
|
|
|
var scrollListener = function (e) { |
|
|
var element = this; |
|
|
resetTriggers(this); |
|
|
if (this.__resizeRAF__) cancelFrame(this.__resizeRAF__); |
|
|
this.__resizeRAF__ = requestFrame(function () { |
|
|
if (checkTriggers(element)) { |
|
|
element.__resizeLast__.width = element.offsetWidth; |
|
|
element.__resizeLast__.height = element.offsetHeight; |
|
|
element.__resizeListeners__.forEach(function (fn) { |
|
|
fn.call(element, e); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
}; |
|
|
|
|
|
/* Detect CSS Animations support to detect element display/re-attach */ |
|
|
var animation = false, |
|
|
animationstring = "animation", |
|
|
keyframeprefix = "", |
|
|
animationstartevent = "animationstart", |
|
|
domPrefixes = "Webkit Moz O ms".split(" "), |
|
|
startEvents = "webkitAnimationStart animationstart oAnimationStart MSAnimationStart".split(" "), |
|
|
pfx = ""; |
|
|
{ |
|
|
var elm = document.createElement("fakeelement"); |
|
|
if (elm.style.animationName !== undefined) { |
|
|
animation = true; |
|
|
} |
|
|
|
|
|
if (animation === false) { |
|
|
for (var i = 0; i < domPrefixes.length; i++) { |
|
|
if (elm.style[domPrefixes[i] + "AnimationName"] !== undefined) { |
|
|
pfx = domPrefixes[i]; |
|
|
animationstring = pfx + "Animation"; |
|
|
keyframeprefix = "-" + pfx.toLowerCase() + "-"; |
|
|
animationstartevent = startEvents[i]; |
|
|
animation = true; |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
var animationName = "resizeanim"; |
|
|
var animationKeyframes = "@" + keyframeprefix + "keyframes " + animationName + " { from { opacity: 0; } to { opacity: 0; } } "; |
|
|
var animationStyle = keyframeprefix + "animation: 1ms " + animationName + "; "; |
|
|
} |
|
|
|
|
|
var createStyles = function () { |
|
|
if (!stylesCreated) { |
|
|
// opacity:0 works around a chrome bug https://code.google.com/p/chromium/issues/detail?id=286360 |
|
|
var css = (animationKeyframes ? animationKeyframes : "") + |
|
|
".resize-triggers { " + (animationStyle ? animationStyle : "") + "visibility: hidden; opacity: 0; } " + |
|
|
".resize-triggers, .resize-triggers > div, .contract-trigger:before { content: \" \"; display: block; position: absolute; top: 0; left: 0; height: 100%; width: 100%; overflow: hidden; } .resize-triggers > div { background: #eee; overflow: auto; } .contract-trigger:before { width: 200%; height: 200%; }", |
|
|
head = document.head || document.getElementsByTagName("head")[0], |
|
|
style = document.createElement("style"); |
|
|
|
|
|
style.type = "text/css"; |
|
|
if (style.styleSheet) { |
|
|
style.styleSheet.cssText = css; |
|
|
} else { |
|
|
style.appendChild(document.createTextNode(css)); |
|
|
} |
|
|
|
|
|
head.appendChild(style); |
|
|
stylesCreated = true; |
|
|
} |
|
|
}; |
|
|
|
|
|
var addResizeListener = function (element, fn) { |
|
|
if (addEventListener) { |
|
|
if (!element.__resizeTriggers__) { |
|
|
if (getComputedStyle(element).position === "static") element.style.position = "relative"; |
|
|
createStyles(); |
|
|
element.__resizeLast__ = {}; |
|
|
element.__resizeListeners__ = []; |
|
|
(element.__resizeTriggers__ = document.createElement("div")).className = "resize-triggers"; |
|
|
element.__resizeTriggers__.innerHTML = "<div class=\"expand-trigger\"><div></div></div>" + |
|
|
"<div class=\"contract-trigger\"></div>"; |
|
|
element.appendChild(element.__resizeTriggers__); |
|
|
resetTriggers(element); |
|
|
element.addEventListener("scroll", scrollListener, true); |
|
|
|
|
|
/* Listen for a css animation to detect element display/re-attach */ |
|
|
animationstartevent && element.__resizeTriggers__.addEventListener(animationstartevent, function (e) { |
|
|
if (e.animationName === animationName) {resetTriggers(element);} |
|
|
}); |
|
|
} |
|
|
element.__resizeListeners__.push(fn); |
|
|
|
|
|
} else { |
|
|
element.attachEvent("onresize", fn); |
|
|
} |
|
|
}; |
|
|
|
|
|
var removeResizeListener = function (element, fn) { |
|
|
if (addEventListener) { |
|
|
element.__resizeListeners__.splice(element.__resizeListeners__.indexOf(fn), 1); |
|
|
if (!element.__resizeListeners__.length) { |
|
|
element.removeEventListener("scroll", scrollListener, true); |
|
|
element.__resizeTriggers__ = !element.removeChild(element.__resizeTriggers__); |
|
|
} |
|
|
} else { |
|
|
element.detachEvent("onresize", fn); |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.ResizeDetector = { |
|
|
addResizeListener: function (widget, fn) { |
|
|
addResizeListener(widget.element[0], fn); |
|
|
return function () { |
|
|
removeResizeListener(widget.element[0], fn); |
|
|
}; |
|
|
}, |
|
|
removeResizeListener: function (widget, fn) { |
|
|
removeResizeListener(widget.element[0], fn); |
|
|
} |
|
|
}; |
|
|
}()); |
|
|
|
|
|
(function () { |
|
|
function defaultComparator (a, b) { |
|
|
return a < b; |
|
|
} |
|
|
|
|
|
BI.Heap = function (items, comparator) { |
|
|
this._items = items || []; |
|
|
this._size = this._items.length; |
|
|
this._comparator = comparator || defaultComparator; |
|
|
this._heapify(); |
|
|
}; |
|
|
|
|
|
BI.Heap.prototype = { |
|
|
constructor: BI.Heap, |
|
|
empty: function () { |
|
|
return this._size === 0; |
|
|
}, |
|
|
|
|
|
pop: function () { |
|
|
if (this._size === 0) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var elt = this._items[0]; |
|
|
|
|
|
var lastElt = this._items.pop(); |
|
|
this._size--; |
|
|
|
|
|
if (this._size > 0) { |
|
|
this._items[0] = lastElt; |
|
|
this._sinkDown(0); |
|
|
} |
|
|
|
|
|
return elt; |
|
|
}, |
|
|
|
|
|
push: function (item) { |
|
|
this._items[this._size++] = item; |
|
|
this._bubbleUp(this._size - 1); |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
peek: function () { |
|
|
if (this._size === 0) { |
|
|
return; |
|
|
} |
|
|
|
|
|
return this._items[0]; |
|
|
}, |
|
|
|
|
|
_heapify: function () { |
|
|
for (var index = Math.floor((this._size + 1) / 2); index >= 0; index--) { |
|
|
this._sinkDown(index); |
|
|
} |
|
|
}, |
|
|
|
|
|
_bubbleUp: function (index) { |
|
|
var elt = this._items[index]; |
|
|
while (index > 0) { |
|
|
var parentIndex = Math.floor((index + 1) / 2) - 1; |
|
|
var parentElt = this._items[parentIndex]; |
|
|
|
|
|
// if parentElt < elt, stop |
|
|
if (this._comparator(parentElt, elt)) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// swap |
|
|
this._items[parentIndex] = elt; |
|
|
this._items[index] = parentElt; |
|
|
index = parentIndex; |
|
|
} |
|
|
}, |
|
|
|
|
|
_sinkDown: function (index) { |
|
|
var elt = this._items[index]; |
|
|
|
|
|
while (true) { |
|
|
var leftChildIndex = 2 * (index + 1) - 1; |
|
|
var rightChildIndex = 2 * (index + 1); |
|
|
var swapIndex = -1; |
|
|
|
|
|
if (leftChildIndex < this._size) { |
|
|
var leftChild = this._items[leftChildIndex]; |
|
|
if (this._comparator(leftChild, elt)) { |
|
|
swapIndex = leftChildIndex; |
|
|
} |
|
|
} |
|
|
|
|
|
if (rightChildIndex < this._size) { |
|
|
var rightChild = this._items[rightChildIndex]; |
|
|
if (this._comparator(rightChild, elt)) { |
|
|
if (swapIndex === -1 || |
|
|
this._comparator(rightChild, this._items[swapIndex])) { |
|
|
swapIndex = rightChildIndex; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// if we don't have a swap, stop |
|
|
if (swapIndex === -1) { |
|
|
return; |
|
|
} |
|
|
|
|
|
this._items[index] = this._items[swapIndex]; |
|
|
this._items[swapIndex] = elt; |
|
|
index = swapIndex; |
|
|
} |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
(function () { |
|
|
var clamp = function (min, value, max) { |
|
|
if (value < min) { |
|
|
return min; |
|
|
} |
|
|
if (value > max) { |
|
|
return max; |
|
|
} |
|
|
return value; |
|
|
}; |
|
|
|
|
|
var BUFFER_ROWS = 5; |
|
|
var NO_ROWS_SCROLL_RESULT = { |
|
|
index: 0, |
|
|
offset: 0, |
|
|
position: 0, |
|
|
contentHeight: 0 |
|
|
}; |
|
|
|
|
|
BI.TableScrollHelper = function (rowCount, |
|
|
defaultRowHeight, |
|
|
viewportHeight, |
|
|
rowHeightGetter) { |
|
|
this._rowOffsets = BI.PrefixIntervalTree.uniform(rowCount, defaultRowHeight); |
|
|
this._storedHeights = new Array(rowCount); |
|
|
for (var i = 0; i < rowCount; ++i) { |
|
|
this._storedHeights[i] = defaultRowHeight; |
|
|
} |
|
|
this._rowCount = rowCount; |
|
|
this._position = 0; |
|
|
this._contentHeight = rowCount * defaultRowHeight; |
|
|
this._defaultRowHeight = defaultRowHeight; |
|
|
this._rowHeightGetter = rowHeightGetter ? |
|
|
rowHeightGetter : function () { |
|
|
return defaultRowHeight; |
|
|
}; |
|
|
this._viewportHeight = viewportHeight; |
|
|
|
|
|
this._updateHeightsInViewport(0, 0); |
|
|
}; |
|
|
|
|
|
BI.TableScrollHelper.prototype = { |
|
|
constructor: BI.TableScrollHelper, |
|
|
setRowHeightGetter: function (rowHeightGetter) { |
|
|
this._rowHeightGetter = rowHeightGetter; |
|
|
}, |
|
|
|
|
|
setViewportHeight: function (viewportHeight) { |
|
|
this._viewportHeight = viewportHeight; |
|
|
}, |
|
|
|
|
|
getContentHeight: function () { |
|
|
return this._contentHeight; |
|
|
}, |
|
|
|
|
|
_updateHeightsInViewport: function (firstRowIndex, |
|
|
firstRowOffset) { |
|
|
var top = firstRowOffset; |
|
|
var index = firstRowIndex; |
|
|
while (top <= this._viewportHeight && index < this._rowCount) { |
|
|
this._updateRowHeight(index); |
|
|
top += this._storedHeights[index]; |
|
|
index++; |
|
|
} |
|
|
}, |
|
|
|
|
|
_updateHeightsAboveViewport: function (firstRowIndex) { |
|
|
var index = firstRowIndex - 1; |
|
|
while (index >= 0 && index >= firstRowIndex - BUFFER_ROWS) { |
|
|
var delta = this._updateRowHeight(index); |
|
|
this._position += delta; |
|
|
index--; |
|
|
} |
|
|
}, |
|
|
|
|
|
_updateRowHeight: function (rowIndex) { |
|
|
if (rowIndex < 0 || rowIndex >= this._rowCount) { |
|
|
return 0; |
|
|
} |
|
|
var newHeight = this._rowHeightGetter(rowIndex); |
|
|
if (newHeight !== this._storedHeights[rowIndex]) { |
|
|
var change = newHeight - this._storedHeights[rowIndex]; |
|
|
this._rowOffsets.set(rowIndex, newHeight); |
|
|
this._storedHeights[rowIndex] = newHeight; |
|
|
this._contentHeight += change; |
|
|
return change; |
|
|
} |
|
|
return 0; |
|
|
}, |
|
|
|
|
|
getRowPosition: function (rowIndex) { |
|
|
this._updateRowHeight(rowIndex); |
|
|
return this._rowOffsets.sumUntil(rowIndex); |
|
|
}, |
|
|
|
|
|
scrollBy: function (delta) { |
|
|
if (this._rowCount === 0) { |
|
|
return NO_ROWS_SCROLL_RESULT; |
|
|
} |
|
|
var firstRow = this._rowOffsets.greatestLowerBound(this._position); |
|
|
firstRow = clamp(firstRow, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var firstRowPosition = this._rowOffsets.sumUntil(firstRow); |
|
|
var rowIndex = firstRow; |
|
|
var position = this._position; |
|
|
|
|
|
var rowHeightChange = this._updateRowHeight(rowIndex); |
|
|
if (firstRowPosition !== 0) { |
|
|
position += rowHeightChange; |
|
|
} |
|
|
var visibleRowHeight = this._storedHeights[rowIndex] - |
|
|
(position - firstRowPosition); |
|
|
|
|
|
if (delta >= 0) { |
|
|
|
|
|
while (delta > 0 && rowIndex < this._rowCount) { |
|
|
if (delta < visibleRowHeight) { |
|
|
position += delta; |
|
|
delta = 0; |
|
|
} else { |
|
|
delta -= visibleRowHeight; |
|
|
position += visibleRowHeight; |
|
|
rowIndex++; |
|
|
} |
|
|
if (rowIndex < this._rowCount) { |
|
|
this._updateRowHeight(rowIndex); |
|
|
visibleRowHeight = this._storedHeights[rowIndex]; |
|
|
} |
|
|
} |
|
|
} else if (delta < 0) { |
|
|
delta = -delta; |
|
|
var invisibleRowHeight = this._storedHeights[rowIndex] - visibleRowHeight; |
|
|
|
|
|
while (delta > 0 && rowIndex >= 0) { |
|
|
if (delta < invisibleRowHeight) { |
|
|
position -= delta; |
|
|
delta = 0; |
|
|
} else { |
|
|
position -= invisibleRowHeight; |
|
|
delta -= invisibleRowHeight; |
|
|
rowIndex--; |
|
|
} |
|
|
if (rowIndex >= 0) { |
|
|
var change = this._updateRowHeight(rowIndex); |
|
|
invisibleRowHeight = this._storedHeights[rowIndex]; |
|
|
position += change; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
var maxPosition = this._contentHeight - this._viewportHeight; |
|
|
position = clamp(position, 0, maxPosition); |
|
|
this._position = position; |
|
|
var firstRowIndex = this._rowOffsets.greatestLowerBound(position); |
|
|
firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex); |
|
|
var firstRowOffset = firstRowPosition - position; |
|
|
|
|
|
this._updateHeightsInViewport(firstRowIndex, firstRowOffset); |
|
|
this._updateHeightsAboveViewport(firstRowIndex); |
|
|
|
|
|
return { |
|
|
index: firstRowIndex, |
|
|
offset: firstRowOffset, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
}, |
|
|
|
|
|
_getRowAtEndPosition: function (rowIndex) { |
|
|
// We need to update enough rows above the selected one to be sure that when |
|
|
// we scroll to selected position all rows between first shown and selected |
|
|
// one have most recent heights computed and will not resize |
|
|
this._updateRowHeight(rowIndex); |
|
|
var currentRowIndex = rowIndex; |
|
|
var top = this._storedHeights[currentRowIndex]; |
|
|
while (top < this._viewportHeight && currentRowIndex >= 0) { |
|
|
currentRowIndex--; |
|
|
if (currentRowIndex >= 0) { |
|
|
this._updateRowHeight(currentRowIndex); |
|
|
top += this._storedHeights[currentRowIndex]; |
|
|
} |
|
|
} |
|
|
var position = this._rowOffsets.sumTo(rowIndex) - this._viewportHeight; |
|
|
if (position < 0) { |
|
|
position = 0; |
|
|
} |
|
|
return position; |
|
|
}, |
|
|
|
|
|
scrollTo: function (position) { |
|
|
if (this._rowCount === 0) { |
|
|
return NO_ROWS_SCROLL_RESULT; |
|
|
} |
|
|
if (position <= 0) { |
|
|
// If position less than or equal to 0 first row should be fully visible |
|
|
// on top |
|
|
this._position = 0; |
|
|
this._updateHeightsInViewport(0, 0); |
|
|
|
|
|
return { |
|
|
index: 0, |
|
|
offset: 0, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
} else if (position >= this._contentHeight - this._viewportHeight) { |
|
|
// If position is equal to or greater than max scroll value, we need |
|
|
// to make sure to have bottom border of last row visible. |
|
|
var rowIndex = this._rowCount - 1; |
|
|
position = this._getRowAtEndPosition(rowIndex); |
|
|
} |
|
|
this._position = position; |
|
|
|
|
|
var firstRowIndex = this._rowOffsets.greatestLowerBound(position); |
|
|
firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex); |
|
|
var firstRowOffset = firstRowPosition - position; |
|
|
|
|
|
this._updateHeightsInViewport(firstRowIndex, firstRowOffset); |
|
|
this._updateHeightsAboveViewport(firstRowIndex); |
|
|
|
|
|
return { |
|
|
index: firstRowIndex, |
|
|
offset: firstRowOffset, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Allows to scroll to selected row with specified offset. It always |
|
|
* brings that row to top of viewport with that offset |
|
|
*/ |
|
|
scrollToRow: function (rowIndex, offset) { |
|
|
rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
offset = clamp(offset, -this._storedHeights[rowIndex], 0); |
|
|
var firstRow = this._rowOffsets.sumUntil(rowIndex); |
|
|
return this.scrollTo(firstRow - offset); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Allows to scroll to selected row by bringing it to viewport with minimal |
|
|
* scrolling. This that if row is fully visible, scroll will not be changed. |
|
|
* If top border of row is above top of viewport it will be scrolled to be |
|
|
* fully visible on the top of viewport. If the bottom border of row is |
|
|
* below end of viewport, it will be scrolled up to be fully visible on the |
|
|
* bottom of viewport. |
|
|
*/ |
|
|
scrollRowIntoView: function (rowIndex) { |
|
|
rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var rowBegin = this._rowOffsets.sumUntil(rowIndex); |
|
|
var rowEnd = rowBegin + this._storedHeights[rowIndex]; |
|
|
if (rowBegin < this._position) { |
|
|
return this.scrollTo(rowBegin); |
|
|
} else if (this._position + this._viewportHeight < rowEnd) { |
|
|
var position = this._getRowAtEndPosition(rowIndex); |
|
|
return this.scrollTo(position); |
|
|
} |
|
|
return this.scrollTo(this._position); |
|
|
} |
|
|
}; |
|
|
|
|
|
})(); |
|
|
// Data structure that allows to store values and assign positions to them |
|
|
// in a way to minimize changing positions of stored values when new ones are |
|
|
// added or when some values are replaced. Stored elements are alwasy assigned |
|
|
// a consecutive set of positoins startin from 0 up to count of elements less 1 |
|
|
// Following actions can be executed |
|
|
// * get position assigned to given value (null if value is not stored) |
|
|
// * create new entry for new value and get assigned position back |
|
|
// * replace value that is furthest from specified value range with new value |
|
|
// and get it's position back |
|
|
// All operations take amortized log(n) time where n is number of elements in |
|
|
// the set. |
|
|
BI.IntegerBufferSet = function () { |
|
|
this._valueToPositionMap = {}; |
|
|
this._size = 0; |
|
|
this._smallValues = new BI.Heap( |
|
|
[], // Initial data in the heap |
|
|
this._smallerComparator |
|
|
); |
|
|
this._largeValues = new BI.Heap( |
|
|
[], // Initial data in the heap |
|
|
this._greaterComparator |
|
|
); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.IntegerBufferSet.prototype = { |
|
|
constructor: BI.IntegerBufferSet, |
|
|
getSize: function () /* number*/ { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
getValuePosition: function (/* number*/ value) /* ?number*/ { |
|
|
if (this._valueToPositionMap[value] === undefined) { |
|
|
return null; |
|
|
} |
|
|
return this._valueToPositionMap[value]; |
|
|
}, |
|
|
|
|
|
getNewPositionForValue: function (/* number*/ value) /* number*/ { |
|
|
var newPosition = this._size; |
|
|
this._size++; |
|
|
this._pushToHeaps(newPosition, value); |
|
|
this._valueToPositionMap[value] = newPosition; |
|
|
return newPosition; |
|
|
}, |
|
|
|
|
|
replaceFurthestValuePosition: function (/* number*/ lowValue, |
|
|
/* number*/ highValue, |
|
|
/* number*/ newValue) /* ?number*/ { |
|
|
this._cleanHeaps(); |
|
|
if (this._smallValues.empty() || this._largeValues.empty()) { |
|
|
// Threre are currently no values stored. We will have to create new |
|
|
// position for this value. |
|
|
return null; |
|
|
} |
|
|
|
|
|
var minValue = this._smallValues.peek().value; |
|
|
var maxValue = this._largeValues.peek().value; |
|
|
if (minValue >= lowValue && maxValue <= highValue) { |
|
|
// All values currently stored are necessary, we can't reuse any of them. |
|
|
return null; |
|
|
} |
|
|
|
|
|
var valueToReplace; |
|
|
if (lowValue - minValue > maxValue - highValue) { |
|
|
// minValue is further from provided range. We will reuse it's position. |
|
|
valueToReplace = minValue; |
|
|
this._smallValues.pop(); |
|
|
} else { |
|
|
valueToReplace = maxValue; |
|
|
this._largeValues.pop(); |
|
|
} |
|
|
var position = this._valueToPositionMap[valueToReplace]; |
|
|
delete this._valueToPositionMap[valueToReplace]; |
|
|
this._valueToPositionMap[newValue] = position; |
|
|
this._pushToHeaps(position, newValue); |
|
|
|
|
|
return position; |
|
|
}, |
|
|
|
|
|
_pushToHeaps: function (/* number*/ position, /* number*/ value) { |
|
|
var element = { |
|
|
position: position, |
|
|
value: value |
|
|
}; |
|
|
// We can reuse the same object in both heaps, because we don't mutate them |
|
|
this._smallValues.push(element); |
|
|
this._largeValues.push(element); |
|
|
}, |
|
|
|
|
|
_cleanHeaps: function () { |
|
|
// We not usually only remove object from one heap while moving value. |
|
|
// Here we make sure that there is no stale data on top of heaps. |
|
|
this._cleanHeap(this._smallValues); |
|
|
this._cleanHeap(this._largeValues); |
|
|
var minHeapSize = |
|
|
Math.min(this._smallValues.size(), this._largeValues.size()); |
|
|
var maxHeapSize = |
|
|
Math.max(this._smallValues.size(), this._largeValues.size()); |
|
|
if (maxHeapSize > 10 * minHeapSize) { |
|
|
// There are many old values in one of heaps. We nned to get rid of them |
|
|
// to not use too avoid memory leaks |
|
|
this._recreateHeaps(); |
|
|
} |
|
|
}, |
|
|
|
|
|
_recreateHeaps: function () { |
|
|
var sourceHeap = this._smallValues.size() < this._largeValues.size() ? |
|
|
this._smallValues : |
|
|
this._largeValues; |
|
|
var newSmallValues = new Heap( |
|
|
[], // Initial data in the heap |
|
|
this._smallerComparator |
|
|
); |
|
|
var newLargeValues = new Heap( |
|
|
[], // Initial datat in the heap |
|
|
this._greaterComparator |
|
|
); |
|
|
while (!sourceHeap.empty()) { |
|
|
var element = sourceHeap.pop(); |
|
|
// Push all stil valid elements to new heaps |
|
|
if (this._valueToPositionMap[element.value] !== undefined) { |
|
|
newSmallValues.push(element); |
|
|
newLargeValues.push(element); |
|
|
} |
|
|
} |
|
|
this._smallValues = newSmallValues; |
|
|
this._largeValues = newLargeValues; |
|
|
}, |
|
|
|
|
|
_cleanHeap: function (/* object*/ heap) { |
|
|
while (!heap.empty() && |
|
|
this._valueToPositionMap[heap.peek().value] === undefined) { |
|
|
heap.pop(); |
|
|
} |
|
|
}, |
|
|
|
|
|
_smallerComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ { |
|
|
return lhs.value < rhs.value; |
|
|
}, |
|
|
|
|
|
_greaterComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ { |
|
|
return lhs.value > rhs.value; |
|
|
} |
|
|
}; |
|
|
|
|
|
!(function () { |
|
|
BI.LinkHashMap = function () { |
|
|
this.array = []; |
|
|
this.map = {}; |
|
|
}; |
|
|
BI.LinkHashMap.prototype = { |
|
|
constructor: BI.LinkHashMap, |
|
|
has: function (key) { |
|
|
if (key in this.map) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
add: function (key, value) { |
|
|
if (typeof key === "undefined") { |
|
|
return; |
|
|
} |
|
|
if (key in this.map) { |
|
|
this.map[key] = value; |
|
|
} else { |
|
|
this.array.push(key); |
|
|
this.map[key] = value; |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (key) { |
|
|
if (key in this.map) { |
|
|
delete this.map[key]; |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
if (this.array[i] == key) { |
|
|
this.array.splice(i, 1); |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this.array.length; |
|
|
}, |
|
|
|
|
|
each: function (fn, scope) { |
|
|
var scope = scope || window; |
|
|
var fn = fn || null; |
|
|
if (fn == null || typeof (fn) !== "function") { |
|
|
return; |
|
|
} |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
var key = this.array[i]; |
|
|
var value = this.map[key]; |
|
|
var re = fn.call(scope, key, value, i, this.array, this.map); |
|
|
if (re == false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
get: function (key) { |
|
|
return this.map[key]; |
|
|
}, |
|
|
|
|
|
toArray: function () { |
|
|
var array = []; |
|
|
this.each(function (key, value) { |
|
|
array.push(value); |
|
|
}); |
|
|
return array; |
|
|
} |
|
|
}; |
|
|
})();window.BI = window.BI || {}; |
|
|
|
|
|
_.extend(BI, { |
|
|
$defaultImport: function (options, type) { |
|
|
var config; |
|
|
if (BI.isObject(options)) { |
|
|
config = $.extend({ |
|
|
op: "resource", |
|
|
path: null, |
|
|
type: null, |
|
|
must: false |
|
|
}, options); |
|
|
config.url = BI.servletURL + "?op=" + config.op + "&resource=" + config.path; |
|
|
} else { |
|
|
config = { |
|
|
url: BI.servletURL + "?op=resource&resource=" + options, |
|
|
type: arguments[1], |
|
|
must: arguments[2] |
|
|
}; |
|
|
} |
|
|
this.$import(config.url, config.type, config.must); |
|
|
}, |
|
|
$import: function () { |
|
|
var _LOADED = {}; // alex:保存加载过的 |
|
|
function loadReady (src, must) { |
|
|
var $scripts = $("head script, body script"); |
|
|
$.each($scripts, function (i, item) { |
|
|
if (item.src.indexOf(src) != -1) { |
|
|
_LOADED[src] = true; |
|
|
} |
|
|
}); |
|
|
var $links = $("head link"); |
|
|
$.each($links, function (i, item) { |
|
|
if (item.href.indexOf(src) != -1 && must) { |
|
|
_LOADED[src] = false; |
|
|
$(item).remove(); |
|
|
} |
|
|
}); |
|
|
} |
|
|
|
|
|
// must=true 强行加载 |
|
|
return function (src, ext, must) { |
|
|
loadReady(src, must); |
|
|
// alex:如果已经加载过了的,直接return |
|
|
if (_LOADED[src] === true) { |
|
|
return; |
|
|
} |
|
|
if (ext === "css") { |
|
|
var link = document.createElement("link"); |
|
|
link.rel = "stylesheet"; |
|
|
link.type = "text/css"; |
|
|
link.href = src; |
|
|
var head = document.getElementsByTagName("head")[0]; |
|
|
head.appendChild(link); |
|
|
_LOADED[src] = true; |
|
|
} else { |
|
|
// alex:这里用同步调用的方式,必须等待ajax完成 |
|
|
$.ajax({ |
|
|
url: src, |
|
|
dataType: "script", // alex:指定dataType为script,jquery会帮忙做globalEval的事情 |
|
|
async: false, |
|
|
cache: true, |
|
|
complete: function (res, status) { |
|
|
/* |
|
|
* alex:发现jquery会很智能地判断一下返回的数据类型是不是script,然后做一个globalEval |
|
|
* 所以当status为success时就不需要再把其中的内容加到script里面去了 |
|
|
*/ |
|
|
if (status == "success") { |
|
|
_LOADED[src] = true; |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
}; |
|
|
}() |
|
|
}); |
|
|
!(function () { |
|
|
BI.LRU = function (limit) { |
|
|
this.size = 0; |
|
|
this.limit = limit; |
|
|
this.head = this.tail = undefined; |
|
|
this._keymap = {}; |
|
|
}; |
|
|
|
|
|
var p = BI.LRU.prototype; |
|
|
|
|
|
p.put = function (key, value) { |
|
|
var removed; |
|
|
if (this.size === this.limit) { |
|
|
removed = this.shift(); |
|
|
} |
|
|
|
|
|
var entry = this.get(key, true); |
|
|
if (!entry) { |
|
|
entry = { |
|
|
key: key |
|
|
}; |
|
|
this._keymap[key] = entry; |
|
|
if (this.tail) { |
|
|
this.tail.newer = entry; |
|
|
entry.older = this.tail; |
|
|
} else { |
|
|
this.head = entry; |
|
|
} |
|
|
this.tail = entry; |
|
|
this.size++; |
|
|
} |
|
|
entry.value = value; |
|
|
|
|
|
return removed; |
|
|
}; |
|
|
|
|
|
p.shift = function () { |
|
|
var entry = this.head; |
|
|
if (entry) { |
|
|
this.head = this.head.newer; |
|
|
this.head.older = undefined; |
|
|
entry.newer = entry.older = undefined; |
|
|
this._keymap[entry.key] = undefined; |
|
|
this.size--; |
|
|
} |
|
|
return entry; |
|
|
}; |
|
|
|
|
|
|
|
|
p.get = function (key, returnEntry) { |
|
|
var entry = this._keymap[key]; |
|
|
if (entry === undefined) return; |
|
|
if (entry === this.tail) { |
|
|
return returnEntry |
|
|
? entry |
|
|
: entry.value; |
|
|
} |
|
|
// HEAD--------------TAIL |
|
|
// <.older .newer> |
|
|
// <--- add direction -- |
|
|
// A B C <D> E |
|
|
if (entry.newer) { |
|
|
if (entry === this.head) { |
|
|
this.head = entry.newer; |
|
|
} |
|
|
entry.newer.older = entry.older; // C <-- E. |
|
|
} |
|
|
if (entry.older) { |
|
|
entry.older.newer = entry.newer; // C. --> E |
|
|
} |
|
|
entry.newer = undefined; // D --x |
|
|
entry.older = this.tail; // D. --> E |
|
|
if (this.tail) { |
|
|
this.tail.newer = entry; // E. <-- D |
|
|
} |
|
|
this.tail = entry; |
|
|
return returnEntry |
|
|
? entry |
|
|
: entry.value; |
|
|
}; |
|
|
|
|
|
p.has = function (key) { |
|
|
return this._keymap[key] != null; |
|
|
}; |
|
|
})(); |
|
|
!(function () { |
|
|
var MD5 = function (hexcase) { |
|
|
this.hexcase = !hexcase ? 0 : 1; |
|
|
/* hex output format. 0 - lowercase; 1 - uppercase */ |
|
|
this.b64pad = ""; |
|
|
/* base-64 pad character. "=" for strict RFC compliance */ |
|
|
this.chrsz = 8; |
|
|
/* bits per input character. 8 - ASCII; 16 - Unicode */ |
|
|
}; |
|
|
|
|
|
/* |
|
|
* These are the functions you'll usually want to call |
|
|
* They take string arguments and return either hex or base-64 encoded strings |
|
|
*/ |
|
|
MD5.prototype.hex_md5 = function (s) { |
|
|
return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.hex_md5_salt = function (s) { |
|
|
var md5ed = this.hex_md5(s); |
|
|
|
|
|
var items1 = []; |
|
|
var items2 = []; |
|
|
for (var i = 0; i < md5ed.length; i++) { |
|
|
if (i % 2 === 0) { |
|
|
items1.push(md5ed.charAt(i)); |
|
|
} else { |
|
|
items2.push(md5ed.charAt(i)); |
|
|
} |
|
|
} |
|
|
var result = ":" + items1.join("") + items2.join(""); |
|
|
return result; |
|
|
}; |
|
|
|
|
|
MD5.prototype.b64_md5 = function (s) { |
|
|
return this.binl2b64(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.hex_hmac_md5 = function (key, data) { |
|
|
return this.binl2hex(this.core_hmac_md5(key, data)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.b64_hmac_md5 = function (key, data) { |
|
|
return this.binl2b64(this.core_hmac_md5(key, data)); |
|
|
}; |
|
|
|
|
|
/* Backwards compatibility - same as hex_md5() */ |
|
|
MD5.prototype.calcMD5 = function (s) { |
|
|
return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.core_md5 = function (x, len) { |
|
|
/* append padding */ |
|
|
x[len >> 5] |= 0x80 << ((len) % 32); |
|
|
x[(((len + 64) >>> 9) << 4) + 14] = len; |
|
|
|
|
|
var a = 1732584193; |
|
|
var b = -271733879; |
|
|
var c = -1732584194; |
|
|
var d = 271733878; |
|
|
|
|
|
for (var i = 0; i < x.length; i += 16) { |
|
|
var olda = a; |
|
|
var oldb = b; |
|
|
var oldc = c; |
|
|
var oldd = d; |
|
|
|
|
|
a = this.md5_ff(a, b, c, d, x[i + 0], 7, -680876936); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 1], 12, -389564586); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 2], 17, 606105819); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 3], 22, -1044525330); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 4], 7, -176418897); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 5], 12, 1200080426); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 6], 17, -1473231341); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 7], 22, -45705983); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 8], 7, 1770035416); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 9], 12, -1958414417); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 10], 17, -42063); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 11], 22, -1990404162); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 12], 7, 1804603682); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 13], 12, -40341101); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 14], 17, -1502002290); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 15], 22, 1236535329); |
|
|
|
|
|
a = this.md5_gg(a, b, c, d, x[i + 1], 5, -165796510); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 6], 9, -1069501632); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 11], 14, 643717713); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 0], 20, -373897302); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 5], 5, -701558691); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 10], 9, 38016083); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 15], 14, -660478335); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 4], 20, -405537848); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 9], 5, 568446438); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 14], 9, -1019803690); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 3], 14, -187363961); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 8], 20, 1163531501); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 13], 5, -1444681467); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 2], 9, -51403784); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 7], 14, 1735328473); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 12], 20, -1926607734); |
|
|
|
|
|
a = this.md5_hh(a, b, c, d, x[i + 5], 4, -378558); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 8], 11, -2022574463); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 11], 16, 1839030562); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 14], 23, -35309556); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 1], 4, -1530992060); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 4], 11, 1272893353); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 7], 16, -155497632); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 10], 23, -1094730640); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 13], 4, 681279174); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 0], 11, -358537222); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 3], 16, -722521979); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 6], 23, 76029189); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 9], 4, -640364487); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 12], 11, -421815835); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 15], 16, 530742520); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 2], 23, -995338651); |
|
|
|
|
|
a = this.md5_ii(a, b, c, d, x[i + 0], 6, -198630844); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 7], 10, 1126891415); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 14], 15, -1416354905); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 5], 21, -57434055); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 12], 6, 1700485571); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 3], 10, -1894986606); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 10], 15, -1051523); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 1], 21, -2054922799); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 8], 6, 1873313359); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 15], 10, -30611744); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 6], 15, -1560198380); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 13], 21, 1309151649); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 4], 6, -145523070); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 11], 10, -1120210379); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 2], 15, 718787259); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 9], 21, -343485551); |
|
|
|
|
|
a = this.safe_add(a, olda); |
|
|
b = this.safe_add(b, oldb); |
|
|
c = this.safe_add(c, oldc); |
|
|
d = this.safe_add(d, oldd); |
|
|
} |
|
|
return Array(a, b, c, d); |
|
|
|
|
|
}; |
|
|
|
|
|
/* |
|
|
* These functions implement the four basic operations the algorithm uses. |
|
|
*/ |
|
|
MD5.prototype.md5_cmn = function (q, a, b, x, s, t) { |
|
|
return this.safe_add(this.bit_rol(this.safe_add(this.safe_add(a, q), this.safe_add(x, t)), s), b); |
|
|
}; |
|
|
MD5.prototype.md5_ff = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn((b & c) | ((~b) & d), a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_gg = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn((b & d) | (c & (~d)), a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_hh = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn(b ^ c ^ d, a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_ii = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn(c ^ (b | (~d)), a, b, x, s, t); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Calculate the HMAC-MD5, of a key and some data |
|
|
*/ |
|
|
MD5.prototype.core_hmac_md5 = function (key, data) { |
|
|
var bkey = this.str2binl(key); |
|
|
if (bkey.length > 16) {bkey = this.core_md5(bkey, key.length * this.chrsz);} |
|
|
|
|
|
var ipad = Array(16), opad = Array(16); |
|
|
for (var i = 0; i < 16; i++) { |
|
|
ipad[i] = bkey[i] ^ 0x36363636; |
|
|
opad[i] = bkey[i] ^ 0x5C5C5C5C; |
|
|
} |
|
|
|
|
|
var hash = this.core_md5(ipad.concat(this.str2binl(data)), 512 + data.length * this.chrsz); |
|
|
return this.core_md5(opad.concat(hash), 512 + 128); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Add integers, wrapping at 2^32. This uses 16-bit operations internally |
|
|
* to work around bugs in some JS interpreters. |
|
|
*/ |
|
|
MD5.prototype.safe_add = function (x, y) { |
|
|
var lsw = (x & 0xFFFF) + (y & 0xFFFF); |
|
|
var msw = (x >> 16) + (y >> 16) + (lsw >> 16); |
|
|
return (msw << 16) | (lsw & 0xFFFF); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Bitwise rotate a 32-bit number to the left. |
|
|
*/ |
|
|
MD5.prototype.bit_rol = function (num, cnt) { |
|
|
return (num << cnt) | (num >>> (32 - cnt)); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert a string to an array of little-endian words |
|
|
* If chrsz is ASCII, characters >255 have their hi-byte silently ignored. |
|
|
*/ |
|
|
MD5.prototype.str2binl = function (str) { |
|
|
var bin = Array(); |
|
|
var mask = (1 << this.chrsz) - 1; |
|
|
for (var i = 0; i < str.length * this.chrsz; i += this.chrsz) {bin[i >> 5] |= (str.charCodeAt(i / this.chrsz) & mask) << (i % 32);} |
|
|
return bin; |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert an array of little-endian words to a hex string. |
|
|
*/ |
|
|
MD5.prototype.binl2hex = function (binarray) { |
|
|
var hex_tab = this.hexcase ? "0123456789ABCDEF" : "0123456789abcdef"; |
|
|
var str = ""; |
|
|
for (var i = 0; i < binarray.length * 4; i++) { |
|
|
str += hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8 + 4)) & 0xF) |
|
|
+ hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8)) & 0xF); |
|
|
} |
|
|
return str; |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert an array of little-endian words to a base-64 string |
|
|
*/ |
|
|
MD5.prototype.binl2b64 = function (binarray) { |
|
|
var tab = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/"; |
|
|
var str = ""; |
|
|
for (var i = 0; i < binarray.length * 4; i += 3) { |
|
|
var triplet = (((binarray[i >> 2] >> 8 * (i % 4)) & 0xFF) << 16) |
|
|
| (((binarray[i + 1 >> 2] >> 8 * ((i + 1) % 4)) & 0xFF) << 8) |
|
|
| ((binarray[i + 2 >> 2] >> 8 * ((i + 2) % 4)) & 0xFF); |
|
|
for (var j = 0; j < 4; j++) { |
|
|
if (i * 8 + j * 6 > binarray.length * 32) {str += this.b64pad;} else {str += tab.charAt((triplet >> 6 * (3 - j)) & 0x3F);} |
|
|
} |
|
|
} |
|
|
return str; |
|
|
}; |
|
|
BI.MD5 = new MD5(); |
|
|
})();// 线段树 |
|
|
(function () { |
|
|
var parent = function (node) { |
|
|
return Math.floor(node / 2); |
|
|
}; |
|
|
|
|
|
var Int32Array = window.Int32Array || function (size) { |
|
|
var xs = []; |
|
|
for (var i = size - 1; i >= 0; --i) { |
|
|
xs[i] = 0; |
|
|
} |
|
|
return xs; |
|
|
}; |
|
|
|
|
|
var ceilLog2 = function (x) { |
|
|
var y = 1; |
|
|
while (y < x) { |
|
|
y *= 2; |
|
|
} |
|
|
return y; |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree = function (xs) { |
|
|
this._size = xs.length; |
|
|
this._half = ceilLog2(this._size); |
|
|
this._heap = new Int32Array(2 * this._half); |
|
|
|
|
|
var i; |
|
|
for (i = 0; i < this._size; ++i) { |
|
|
this._heap[this._half + i] = xs[i]; |
|
|
} |
|
|
|
|
|
for (i = this._half - 1; i > 0; --i) { |
|
|
this._heap[i] = this._heap[2 * i] + this._heap[2 * i + 1]; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.prototype = { |
|
|
constructor: BI.PrefixIntervalTree, |
|
|
set: function (index, value) { |
|
|
var node = this._half + index; |
|
|
this._heap[node] = value; |
|
|
|
|
|
node = parent(node); |
|
|
for (; node !== 0; node = parent(node)) { |
|
|
this._heap[node] = |
|
|
this._heap[2 * node] + this._heap[2 * node + 1]; |
|
|
} |
|
|
}, |
|
|
|
|
|
get: function (index) { |
|
|
var node = this._half + index; |
|
|
return this._heap[node]; |
|
|
}, |
|
|
|
|
|
getSize: function () { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* get(0) + get(1) + ... + get(end - 1). |
|
|
*/ |
|
|
sumUntil: function (end) { |
|
|
if (end === 0) { |
|
|
return 0; |
|
|
} |
|
|
|
|
|
var node = this._half + end - 1; |
|
|
var sum = this._heap[node]; |
|
|
for (; node !== 1; node = parent(node)) { |
|
|
if (node % 2 === 1) { |
|
|
sum += this._heap[node - 1]; |
|
|
} |
|
|
} |
|
|
|
|
|
return sum; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* get(0) + get(1) + ... + get(inclusiveEnd). |
|
|
*/ |
|
|
sumTo: function (inclusiveEnd) { |
|
|
return this.sumUntil(inclusiveEnd + 1); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* sum get(begin) + get(begin + 1) + ... + get(end - 1). |
|
|
*/ |
|
|
sum: function (begin, end) { |
|
|
return this.sumUntil(end) - this.sumUntil(begin); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and sumUntil(i) <= t, or |
|
|
* -1 if no such i exists. |
|
|
*/ |
|
|
greatestLowerBound: function (t) { |
|
|
if (t < 0) { |
|
|
return -1; |
|
|
} |
|
|
|
|
|
var node = 1; |
|
|
if (this._heap[node] <= t) { |
|
|
return this._size; |
|
|
} |
|
|
|
|
|
while (node < this._half) { |
|
|
var leftSum = this._heap[2 * node]; |
|
|
if (t < leftSum) { |
|
|
node = 2 * node; |
|
|
} else { |
|
|
node = 2 * node + 1; |
|
|
t -= leftSum; |
|
|
} |
|
|
} |
|
|
|
|
|
return node - this._half; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and sumUntil(i) < t, or |
|
|
* -1 if no such i exists. |
|
|
*/ |
|
|
greatestStrictLowerBound: function (t) { |
|
|
if (t <= 0) { |
|
|
return -1; |
|
|
} |
|
|
|
|
|
var node = 1; |
|
|
if (this._heap[node] < t) { |
|
|
return this._size; |
|
|
} |
|
|
|
|
|
while (node < this._half) { |
|
|
var leftSum = this._heap[2 * node]; |
|
|
if (t <= leftSum) { |
|
|
node = 2 * node; |
|
|
} else { |
|
|
node = 2 * node + 1; |
|
|
t -= leftSum; |
|
|
} |
|
|
} |
|
|
|
|
|
return node - this._half; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and t <= sumUntil(i), or |
|
|
* size + 1 if no such i exists. |
|
|
*/ |
|
|
leastUpperBound: function (t) { |
|
|
return this.greatestStrictLowerBound(t) + 1; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and t < sumUntil(i), or |
|
|
* size + 1 if no such i exists. |
|
|
*/ |
|
|
leastStrictUpperBound: function (t) { |
|
|
return this.greatestLowerBound(t) + 1; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.uniform = function (size, initialValue) { |
|
|
var xs = []; |
|
|
for (var i = size - 1; i >= 0; --i) { |
|
|
xs[i] = initialValue; |
|
|
} |
|
|
|
|
|
return new BI.PrefixIntervalTree(xs); |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.empty = function (size) { |
|
|
return BI.PrefixIntervalTree.uniform(size, 0); |
|
|
}; |
|
|
|
|
|
})(); |
|
|
|
|
|
!(function () { |
|
|
BI.Queue = function (capacity) { |
|
|
this.capacity = capacity; |
|
|
this.array = []; |
|
|
}; |
|
|
BI.Queue.prototype = { |
|
|
constructor: BI.Queue, |
|
|
|
|
|
contains: function (v) { |
|
|
return this.array.contains(v); |
|
|
}, |
|
|
|
|
|
indexOf: function (v) { |
|
|
return this.array.contains(v); |
|
|
}, |
|
|
|
|
|
getElementByIndex: function (index) { |
|
|
return this.array[index]; |
|
|
}, |
|
|
|
|
|
push: function (v) { |
|
|
this.array.push(v); |
|
|
if (this.capacity && this.array.length > this.capacity) { |
|
|
this.array.shift(); |
|
|
} |
|
|
}, |
|
|
|
|
|
pop: function () { |
|
|
this.array.pop(); |
|
|
}, |
|
|
|
|
|
shift: function () { |
|
|
this.array.shift(); |
|
|
}, |
|
|
|
|
|
unshift: function (v) { |
|
|
this.array.unshift(v); |
|
|
if (this.capacity && this.array.length > this.capacity) { |
|
|
this.array.pop(); |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (v) { |
|
|
this.array.remove(v); |
|
|
}, |
|
|
|
|
|
splice: function () { |
|
|
this.array.splice.apply(this.array, arguments); |
|
|
}, |
|
|
|
|
|
slice: function () { |
|
|
this.array.slice.apply(this.array, arguments); |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this.array.length; |
|
|
}, |
|
|
|
|
|
each: function (fn, scope) { |
|
|
var scope = scope || window; |
|
|
var fn = fn || null; |
|
|
if (fn == null || typeof (fn) !== "function") { |
|
|
return; |
|
|
} |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
var re = fn.call(scope, i, this.array[i], this.array); |
|
|
if (re == false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
toArray: function () { |
|
|
return this.array; |
|
|
}, |
|
|
|
|
|
fromArray: function (array) { |
|
|
var self = this; |
|
|
BI.each(array, function (i, v) { |
|
|
self.push(v); |
|
|
}); |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.array.clear(); |
|
|
} |
|
|
}; |
|
|
})();!(function () { |
|
|
var Section = function (height, width, x, y) { |
|
|
this.height = height; |
|
|
this.width = width; |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
|
|
|
this._indexMap = {}; |
|
|
this._indices = []; |
|
|
}; |
|
|
|
|
|
Section.prototype = { |
|
|
constructor: Section, |
|
|
addCellIndex: function (index) { |
|
|
if (!this._indexMap[index]) { |
|
|
this._indexMap[index] = true; |
|
|
this._indices.push(index); |
|
|
} |
|
|
}, |
|
|
|
|
|
getCellIndices: function () { |
|
|
return this._indices; |
|
|
} |
|
|
}; |
|
|
|
|
|
var SECTION_SIZE = 100; |
|
|
BI.SectionManager = function (sectionSize) { |
|
|
this._sectionSize = sectionSize || SECTION_SIZE; |
|
|
this._cellMetadata = []; |
|
|
this._sections = {}; |
|
|
}; |
|
|
|
|
|
BI.SectionManager.prototype = { |
|
|
constructor: BI.SectionManager, |
|
|
getCellIndices: function (height, width, x, y) { |
|
|
var indices = {}; |
|
|
|
|
|
BI.each(this.getSections(height, width, x, y), function (i, section) { |
|
|
BI.each(section.getCellIndices(), function (j, index) { |
|
|
indices[index] = index; |
|
|
}); |
|
|
}); |
|
|
|
|
|
return BI.map(BI.keys(indices), function (i, index) { |
|
|
return indices[index]; |
|
|
}); |
|
|
}, |
|
|
|
|
|
getCellMetadata: function (index) { |
|
|
return this._cellMetadata[index]; |
|
|
}, |
|
|
|
|
|
getSections: function (height, width, x, y) { |
|
|
var sectionXStart = Math.floor(x / this._sectionSize); |
|
|
var sectionXStop = Math.floor((x + width - 1) / this._sectionSize); |
|
|
var sectionYStart = Math.floor(y / this._sectionSize); |
|
|
var sectionYStop = Math.floor((y + height - 1) / this._sectionSize); |
|
|
|
|
|
var sections = []; |
|
|
|
|
|
for (var sectionX = sectionXStart; sectionX <= sectionXStop; sectionX++) { |
|
|
for (var sectionY = sectionYStart; sectionY <= sectionYStop; sectionY++) { |
|
|
var key = sectionX + "." + sectionY; |
|
|
|
|
|
if (!this._sections[key]) { |
|
|
this._sections[key] = new Section(this._sectionSize, this._sectionSize, sectionX * this._sectionSize, sectionY * this._sectionSize); |
|
|
} |
|
|
|
|
|
sections.push(this._sections[key]); |
|
|
} |
|
|
} |
|
|
|
|
|
return sections; |
|
|
}, |
|
|
|
|
|
getTotalSectionCount: function () { |
|
|
return BI.size(this._sections); |
|
|
}, |
|
|
|
|
|
registerCell: function (cellMetadatum, index) { |
|
|
this._cellMetadata[index] = cellMetadatum; |
|
|
|
|
|
BI.each(this.getSections(cellMetadatum.height, cellMetadatum.width, cellMetadatum.x, cellMetadatum.y), function (i, section) { |
|
|
section.addCellIndex(index); |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
(function () { |
|
|
var clamp = function (value, min, max) { |
|
|
if (value < min) { |
|
|
return min; |
|
|
} |
|
|
if (value > max) { |
|
|
return max; |
|
|
} |
|
|
return value; |
|
|
}; |
|
|
var MIN_BUFFER_ROWS = 6; |
|
|
var MAX_BUFFER_ROWS = 10; |
|
|
|
|
|
BI.TableRowBuffer = function (rowsCount, |
|
|
defaultRowHeight, |
|
|
viewportHeight, |
|
|
rowHeightGetter) { |
|
|
this._bufferSet = new BI.IntegerBufferSet(); |
|
|
this._defaultRowHeight = defaultRowHeight; |
|
|
this._viewportRowsBegin = 0; |
|
|
this._viewportRowsEnd = 0; |
|
|
this._maxVisibleRowCount = Math.ceil(viewportHeight / defaultRowHeight) + 1; |
|
|
// this._bufferRowsCount = Math.floor(this._maxVisibleRowCount / 2); |
|
|
this._bufferRowsCount = clamp( |
|
|
Math.floor(this._maxVisibleRowCount / 2), |
|
|
MIN_BUFFER_ROWS, |
|
|
MAX_BUFFER_ROWS |
|
|
); |
|
|
this._rowsCount = rowsCount; |
|
|
this._rowHeightGetter = rowHeightGetter; |
|
|
this._rows = []; |
|
|
this._viewportHeight = viewportHeight; |
|
|
|
|
|
}; |
|
|
BI.TableRowBuffer.prototype = { |
|
|
constructor: BI.TableRowBuffer, |
|
|
|
|
|
getRowsWithUpdatedBuffer: function () { |
|
|
var remainingBufferRows = 2 * this._bufferRowsCount; |
|
|
var bufferRowIndex = |
|
|
Math.max(this._viewportRowsBegin - this._bufferRowsCount, 0); |
|
|
while (bufferRowIndex < this._viewportRowsBegin) { |
|
|
this._addRowToBuffer( |
|
|
bufferRowIndex, |
|
|
this._viewportRowsBegin, |
|
|
this._viewportRowsEnd - 1 |
|
|
); |
|
|
bufferRowIndex++; |
|
|
remainingBufferRows--; |
|
|
} |
|
|
bufferRowIndex = this._viewportRowsEnd; |
|
|
while (bufferRowIndex < this._rowsCount && remainingBufferRows > 0) { |
|
|
this._addRowToBuffer( |
|
|
bufferRowIndex, |
|
|
this._viewportRowsBegin, |
|
|
this._viewportRowsEnd - 1 |
|
|
); |
|
|
bufferRowIndex++; |
|
|
remainingBufferRows--; |
|
|
} |
|
|
return this._rows; |
|
|
}, |
|
|
|
|
|
getRows: function (firstRowIndex, |
|
|
firstRowOffset) { |
|
|
var top = firstRowOffset; |
|
|
var totalHeight = top; |
|
|
var rowIndex = firstRowIndex; |
|
|
var endIndex = |
|
|
Math.min(firstRowIndex + this._maxVisibleRowCount, this._rowsCount); |
|
|
|
|
|
this._viewportRowsBegin = firstRowIndex; |
|
|
while (rowIndex < endIndex || |
|
|
(totalHeight < this._viewportHeight && rowIndex < this._rowsCount)) { |
|
|
this._addRowToBuffer( |
|
|
rowIndex, |
|
|
firstRowIndex, |
|
|
endIndex - 1 |
|
|
); |
|
|
totalHeight += this._rowHeightGetter(rowIndex); |
|
|
++rowIndex; |
|
|
// Store index after the last viewport row as end, to be able to |
|
|
// distinguish when there are no rows rendered in viewport |
|
|
this._viewportRowsEnd = rowIndex; |
|
|
} |
|
|
|
|
|
return this._rows; |
|
|
}, |
|
|
|
|
|
_addRowToBuffer: function (rowIndex, |
|
|
firstViewportRowIndex, |
|
|
lastViewportRowIndex) { |
|
|
var rowPosition = this._bufferSet.getValuePosition(rowIndex); |
|
|
var viewportRowsCount = lastViewportRowIndex - firstViewportRowIndex + 1; |
|
|
var allowedRowsCount = viewportRowsCount + this._bufferRowsCount * 2; |
|
|
if (rowPosition === null && |
|
|
this._bufferSet.getSize() >= allowedRowsCount) { |
|
|
rowPosition = |
|
|
this._bufferSet.replaceFurthestValuePosition( |
|
|
firstViewportRowIndex, |
|
|
lastViewportRowIndex, |
|
|
rowIndex |
|
|
); |
|
|
} |
|
|
if (rowPosition === null) { |
|
|
// We can't reuse any of existing positions for this row. We have to |
|
|
// create new position |
|
|
rowPosition = this._bufferSet.getNewPositionForValue(rowIndex); |
|
|
this._rows[rowPosition] = rowIndex; |
|
|
} else { |
|
|
// This row already is in the table with rowPosition position or it |
|
|
// can replace row that is in that position |
|
|
this._rows[rowPosition] = rowIndex; |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
})(); |
|
|
|
|
|
(function () { |
|
|
BI.Tree = function () { |
|
|
this.root = new BI.Node(BI.UUID()); |
|
|
}; |
|
|
|
|
|
BI.Tree.prototype = { |
|
|
constructor: BI.Tree, |
|
|
addNode: function (node, newNode, index) { |
|
|
if (BI.isNull(newNode)) { |
|
|
this.root.addChild(node, index); |
|
|
} else if (BI.isNull(node)) { |
|
|
this.root.addChild(newNode, index); |
|
|
} else { |
|
|
node.addChild(newNode, index); |
|
|
} |
|
|
}, |
|
|
|
|
|
isRoot: function (node) { |
|
|
return node === this.root; |
|
|
}, |
|
|
|
|
|
getRoot: function () { |
|
|
return this.root; |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.root.clear(); |
|
|
}, |
|
|
|
|
|
initTree: function (nodes) { |
|
|
var self = this; |
|
|
this.clear(); |
|
|
var queue = []; |
|
|
BI.each(nodes, function (i, node) { |
|
|
var n = new BI.Node(node); |
|
|
n.set("data", node); |
|
|
self.addNode(n); |
|
|
queue.push(n); |
|
|
}); |
|
|
while (!BI.isEmpty(queue)) { |
|
|
var parent = queue.shift(); |
|
|
var node = parent.get("data"); |
|
|
BI.each(node.children, function (i, child) { |
|
|
var n = new BI.Node(child); |
|
|
n.set("data", child); |
|
|
queue.push(n); |
|
|
self.addNode(parent, n); |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
_toJSON: function (node) { |
|
|
var self = this; |
|
|
var children = []; |
|
|
BI.each(node.getChildren(), function (i, child) { |
|
|
children.push(self._toJSON(child)); |
|
|
}); |
|
|
return BI.extend({ |
|
|
id: node.id |
|
|
}, BI.deepClone(node.get("data")), (children.length > 0 ? { |
|
|
children: children |
|
|
} : {})); |
|
|
}, |
|
|
|
|
|
toJSON: function (node) { |
|
|
var self = this, result = []; |
|
|
BI.each((node || this.root).getChildren(), function (i, child) { |
|
|
result.push(self._toJSON(child)); |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
_toJSONWithNode: function (node) { |
|
|
var self = this; |
|
|
var children = []; |
|
|
BI.each(node.getChildren(), function (i, child) { |
|
|
children.push(self._toJSONWithNode(child)); |
|
|
}); |
|
|
return BI.extend({ |
|
|
id: node.id |
|
|
}, BI.deepClone(node.get("data")), { |
|
|
node: node |
|
|
}, (children.length > 0 ? { |
|
|
children: children |
|
|
} : {})); |
|
|
}, |
|
|
|
|
|
toJSONWithNode: function (node) { |
|
|
var self = this, result = []; |
|
|
BI.each((node || this.root).getChildren(), function (i, child) { |
|
|
result.push(self._toJSONWithNode(child)); |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
search: function (root, target, param) { |
|
|
if (!(root instanceof BI.Node)) { |
|
|
return arguments.callee.apply(this, [this.root, root, target]); |
|
|
} |
|
|
var self = this, next = null; |
|
|
|
|
|
if (BI.isNull(target)) { |
|
|
return null; |
|
|
} |
|
|
if (BI.isEqual(root[param || "id"], target)) { |
|
|
return root; |
|
|
} |
|
|
BI.any(root.getChildren(), function (i, child) { |
|
|
next = self.search(child, target, param); |
|
|
if (null !== next) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
return next; |
|
|
}, |
|
|
|
|
|
_traverse: function (node, callback) { |
|
|
var queue = []; |
|
|
queue.push(node); |
|
|
while (!BI.isEmpty(queue)) { |
|
|
var temp = queue.shift(); |
|
|
var b = callback && callback(temp); |
|
|
if (b === false) { |
|
|
break; |
|
|
} |
|
|
if (b === true) { |
|
|
continue; |
|
|
} |
|
|
if (temp != null) { |
|
|
queue = queue.concat(temp.getChildren()); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
traverse: function (callback) { |
|
|
this._traverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
_recursion: function (node, route, callback) { |
|
|
var self = this; |
|
|
return BI.every(node.getChildren(), function (i, child) { |
|
|
var next = BI.clone(route); |
|
|
next.push(child.id); |
|
|
var b = callback && callback(child, next); |
|
|
if (b === false) { |
|
|
return false; |
|
|
} |
|
|
if (b === true) { |
|
|
return true; |
|
|
} |
|
|
return self._recursion(child, next, callback); |
|
|
}); |
|
|
}, |
|
|
|
|
|
recursion: function (callback) { |
|
|
this._recursion(this.root, [], callback); |
|
|
}, |
|
|
|
|
|
inOrderTraverse: function (callback) { |
|
|
this._inOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 中序遍历(递归) |
|
|
_inOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
this._inOrderTraverse(node.getLeft()); |
|
|
callback && callback(node); |
|
|
this._inOrderTraverse(node.getRight()); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 中序遍历(非递归) |
|
|
nrInOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
while (node != null) { |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
node = stack.pop(); |
|
|
callback && callback(node); |
|
|
node = node.getRight(); |
|
|
} |
|
|
}, |
|
|
|
|
|
preOrderTraverse: function (callback) { |
|
|
this._preOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 先序遍历(递归) |
|
|
_preOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
callback && callback(node); |
|
|
this._preOrderTraverse(node.getLeft()); |
|
|
this._preOrderTraverse(node.getRight()); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 先序遍历(非递归) |
|
|
nrPreOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
|
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
|
|
|
while (node != null) { |
|
|
callback && callback(node); |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
node = stack.pop(); |
|
|
node = node.getRight(); |
|
|
} |
|
|
}, |
|
|
|
|
|
postOrderTraverse: function (callback) { |
|
|
this._postOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 后序遍历(递归) |
|
|
_postOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
this._postOrderTraverse(node.getLeft()); |
|
|
this._postOrderTraverse(node.getRight()); |
|
|
callback && callback(node); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 后续遍历(非递归) |
|
|
nrPostOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
var preNode = null;// 表示最近一次访问的节点 |
|
|
|
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
|
|
|
while (node != null) { |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
|
|
|
node = BI.last(stack); |
|
|
|
|
|
if (node.getRight() == null || node.getRight() == preNode) { |
|
|
callback && callback(node); |
|
|
node = stack.pop(); |
|
|
preNode = node; |
|
|
node = null; |
|
|
} else { |
|
|
node = node.getRight(); |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Node = function (id) { |
|
|
if (BI.isObject(id)) { |
|
|
BI.extend(this, id); |
|
|
} else { |
|
|
this.id = id; |
|
|
} |
|
|
this.clear.apply(this, arguments); |
|
|
}; |
|
|
|
|
|
BI.Node.prototype = { |
|
|
constructor: BI.Node, |
|
|
|
|
|
set: function (key, value) { |
|
|
if (BI.isObject(key)) { |
|
|
BI.extend(this, key); |
|
|
return; |
|
|
} |
|
|
this[key] = value; |
|
|
}, |
|
|
|
|
|
get: function (key) { |
|
|
return this[key]; |
|
|
}, |
|
|
|
|
|
isLeaf: function () { |
|
|
return BI.isEmpty(this.children); |
|
|
}, |
|
|
|
|
|
getChildren: function () { |
|
|
return this.children; |
|
|
}, |
|
|
|
|
|
getChildrenLength: function () { |
|
|
return this.children.length; |
|
|
}, |
|
|
|
|
|
getFirstChild: function () { |
|
|
return BI.first(this.children); |
|
|
}, |
|
|
|
|
|
getLastChild: function () { |
|
|
return BI.last(this.children); |
|
|
}, |
|
|
|
|
|
setLeft: function (left) { |
|
|
this.left = left; |
|
|
}, |
|
|
|
|
|
getLeft: function () { |
|
|
return this.left; |
|
|
}, |
|
|
|
|
|
setRight: function (right) { |
|
|
this.right = right; |
|
|
}, |
|
|
|
|
|
getRight: function () { |
|
|
return this.right; |
|
|
}, |
|
|
|
|
|
setParent: function (parent) { |
|
|
this.parent = parent; |
|
|
}, |
|
|
|
|
|
getParent: function () { |
|
|
return this.parent; |
|
|
}, |
|
|
|
|
|
getChild: function (index) { |
|
|
return this.children[index]; |
|
|
}, |
|
|
|
|
|
getChildIndex: function (id) { |
|
|
return BI.findIndex(this.children, function (i, ch) { |
|
|
return ch.get("id") === id; |
|
|
}); |
|
|
}, |
|
|
|
|
|
removeChild: function (id) { |
|
|
this.removeChildByIndex(this.getChildIndex(id)); |
|
|
}, |
|
|
|
|
|
removeChildByIndex: function (index) { |
|
|
var before = this.getChild(index - 1); |
|
|
var behind = this.getChild(index + 1); |
|
|
if (before != null) { |
|
|
before.setRight(behind || null); |
|
|
} |
|
|
if (behind != null) { |
|
|
behind.setLeft(before || null); |
|
|
} |
|
|
this.children.splice(index, 1); |
|
|
}, |
|
|
|
|
|
removeAllChilds: function () { |
|
|
this.children = []; |
|
|
}, |
|
|
|
|
|
addChild: function (child, index) { |
|
|
var cur = null; |
|
|
if (BI.isUndefined(index)) { |
|
|
cur = this.children.length - 1; |
|
|
} else { |
|
|
cur = index - 1; |
|
|
} |
|
|
child.setParent(this); |
|
|
if (cur >= 0) { |
|
|
this.getChild(cur) && this.getChild(cur).setRight(child); |
|
|
child.setLeft(this.getChild(cur)); |
|
|
} |
|
|
if (BI.isUndefined(index)) { |
|
|
this.children.push(child); |
|
|
} else { |
|
|
this.children.splice(index, 0, child); |
|
|
} |
|
|
}, |
|
|
|
|
|
equals: function (obj) { |
|
|
return this === obj || this.id === obj.id; |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.parent = null; |
|
|
this.left = null; |
|
|
this.right = null; |
|
|
this.children = []; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.extend(BI.Tree, { |
|
|
transformToArrayFormat: function (nodes, pId) { |
|
|
if (!nodes) return []; |
|
|
var r = []; |
|
|
if (BI.isArray(nodes)) { |
|
|
for (var i = 0, l = nodes.length; i < l; i++) { |
|
|
var node = BI.clone(nodes[i]); |
|
|
node.pId = node.pId == null ? pId : node.pId; |
|
|
delete node.children; |
|
|
r.push(node); |
|
|
if (nodes[i]["children"]) { |
|
|
r = r.concat(BI.Tree.transformToArrayFormat(nodes[i]["children"], node.id)); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var newNodes = BI.clone(nodes); |
|
|
newNodes.pId = newNodes.pId == null ? pId : newNodes.pId; |
|
|
delete newNodes.children; |
|
|
r.push(newNodes); |
|
|
if (nodes["children"]) { |
|
|
r = r.concat(BI.Tree.transformToArrayFormat(nodes["children"], newNodes.id)); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
}, |
|
|
|
|
|
arrayFormat: function (nodes, pId) { |
|
|
if (!nodes) { |
|
|
return []; |
|
|
} |
|
|
var r = []; |
|
|
if (BI.isArray(nodes)) { |
|
|
for (var i = 0, l = nodes.length; i < l; i++) { |
|
|
var node = nodes[i]; |
|
|
node.pId = node.pId == null ? pId : node.pId; |
|
|
r.push(node); |
|
|
if (nodes[i]["children"]) { |
|
|
r = r.concat(BI.Tree.arrayFormat(nodes[i]["children"], node.id)); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var newNodes = nodes; |
|
|
newNodes.pId = newNodes.pId == null ? pId : newNodes.pId; |
|
|
r.push(newNodes); |
|
|
if (nodes["children"]) { |
|
|
r = r.concat(BI.Tree.arrayFormat(nodes["children"], newNodes.id)); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
}, |
|
|
|
|
|
transformToTreeFormat: function (sNodes) { |
|
|
var i, l; |
|
|
if (!sNodes) { |
|
|
return []; |
|
|
} |
|
|
|
|
|
if (BI.isArray(sNodes)) { |
|
|
var r = []; |
|
|
var tmpMap = []; |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (BI.isNull(sNodes[i].id)) { |
|
|
return sNodes; |
|
|
} |
|
|
tmpMap[sNodes[i].id] = BI.clone(sNodes[i]); |
|
|
} |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) { |
|
|
if (!tmpMap[sNodes[i].pId].children) { |
|
|
tmpMap[sNodes[i].pId].children = []; |
|
|
} |
|
|
tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]); |
|
|
} else { |
|
|
r.push(tmpMap[sNodes[i].id]); |
|
|
} |
|
|
delete tmpMap[sNodes[i].id].pId; |
|
|
} |
|
|
return r; |
|
|
} |
|
|
return [sNodes]; |
|
|
|
|
|
}, |
|
|
|
|
|
treeFormat: function (sNodes) { |
|
|
var i, l; |
|
|
if (!sNodes) { |
|
|
return []; |
|
|
} |
|
|
|
|
|
if (BI.isArray(sNodes)) { |
|
|
var r = []; |
|
|
var tmpMap = []; |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (BI.isNull(sNodes[i].id)) { |
|
|
return sNodes; |
|
|
} |
|
|
tmpMap[sNodes[i].id] = sNodes[i]; |
|
|
} |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) { |
|
|
if (!tmpMap[sNodes[i].pId].children) { |
|
|
tmpMap[sNodes[i].pId].children = []; |
|
|
} |
|
|
tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]); |
|
|
} else { |
|
|
r.push(tmpMap[sNodes[i].id]); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
} |
|
|
return [sNodes]; |
|
|
|
|
|
}, |
|
|
|
|
|
traversal: function (array, callback) { |
|
|
if (BI.isNull(array)) { |
|
|
return; |
|
|
} |
|
|
var self = this; |
|
|
BI.any(array, function (i, item) { |
|
|
if (callback(i, item) === false) { |
|
|
return true; |
|
|
} |
|
|
self.traversal(item.children, callback); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
})();// 向量操作 |
|
|
BI.Vector = function (x, y) { |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
}; |
|
|
BI.Vector.prototype = { |
|
|
constructor: BI.Vector, |
|
|
cross: function (v) { |
|
|
return (this.x * v.y - this.y * v.x); |
|
|
}, |
|
|
length: function (v) { |
|
|
return (Math.sqrt(this.x * v.x + this.y * v.y)); |
|
|
} |
|
|
}; |
|
|
BI.Region = function (x, y, w, h) { |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
this.w = w; |
|
|
this.h = h; |
|
|
}; |
|
|
BI.Region.prototype = { |
|
|
constructor: BI.Region, |
|
|
// 判断两个区域是否相交,若相交,则要么顶点互相包含,要么矩形边界(或对角线)相交 |
|
|
isIntersects: function (obj) { |
|
|
if (this.isPointInside(obj.x, obj.y) || |
|
|
this.isPointInside(obj.x + obj.w, obj.y) || |
|
|
this.isPointInside(obj.x, obj.y + obj.h) || |
|
|
this.isPointInside(obj.x + obj.w, obj.y + obj.h)) { |
|
|
return true; |
|
|
} else if (obj.isPointInside(this.x, this.y) || |
|
|
obj.isPointInside(this.x + this.w, this.y) || |
|
|
obj.isPointInside(this.x, this.y + this.h) || |
|
|
obj.isPointInside(this.x + this.w, this.y + this.h)) { |
|
|
return true; |
|
|
} else if (obj.x != null && obj.y != null)// 判断矩形对角线相交 |v1 X v2||v1 X v3| < 0 |
|
|
{ |
|
|
var vector1 = new BI.Vector(this.w, this.h);// 矩形对角线向量 |
|
|
var vector2 = new BI.Vector(obj.x - this.x, obj.y - this.y); |
|
|
var vector3 = new BI.Vector(vector2.x + obj.w, vector2.y + obj.h); |
|
|
if ((vector1.cross(vector2) * vector1.cross(vector3)) < 0) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
// 判断一个点是否在这个区域内部 |
|
|
isPointInside: function (x, y) { |
|
|
if (this.x == null || this.y == null) { |
|
|
return false; |
|
|
} |
|
|
if (x >= this.x && x <= this.x + this.w && y >= this.y && y <= this.y + this.h) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
// 返回区域的重心,因为是矩形所以返回中点 |
|
|
getPosition: function () { |
|
|
var pos = []; |
|
|
pos.push(this.x + this.w / 2); |
|
|
pos.push(this.y + this.h / 2); |
|
|
return pos; |
|
|
} |
|
|
};/** |
|
|
* 保存数据,将js里面用到的常量数据都分离 |
|
|
* |
|
|
*/ |
|
|
BI.Data = Data = {}; |
|
|
|
|
|
/** |
|
|
* 存放bi里面通用的一些常量 |
|
|
* @type {{}} |
|
|
*/ |
|
|
Data.Constant = BICst = {}; |
|
|
/** |
|
|
* 缓冲池 |
|
|
* @type {{Buffer: {}}} |
|
|
*/ |
|
|
|
|
|
(function () { |
|
|
var Buffer = {}; |
|
|
var MODE = false;// 设置缓存模式为关闭 |
|
|
|
|
|
Data.BufferPool = { |
|
|
put: function (name, cache) { |
|
|
if (BI.isNotNull(Buffer[name])) { |
|
|
throw new Error("Buffer Pool has the key already!"); |
|
|
} |
|
|
Buffer[name] = cache; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return Buffer[name]; |
|
|
} |
|
|
}; |
|
|
})();/** |
|
|
* 共享池 |
|
|
* @type {{Shared: {}}} |
|
|
*/ |
|
|
|
|
|
(function () { |
|
|
var _Shared = {}; |
|
|
Data.SharingPool = { |
|
|
_Shared: _Shared, |
|
|
put: function (name, shared) { |
|
|
_Shared[name] = shared; |
|
|
}, |
|
|
|
|
|
cat: function () { |
|
|
var args = Array.prototype.slice.call(arguments, 0), |
|
|
copy = _Shared; |
|
|
for (var i = 0; i < args.length; i++) { |
|
|
copy = copy && copy[args[i]]; |
|
|
} |
|
|
return copy; |
|
|
}, |
|
|
|
|
|
get: function () { |
|
|
return BI.deepClone(this.cat.apply(this, arguments)); |
|
|
}, |
|
|
|
|
|
remove: function (key) { |
|
|
delete _Shared[key]; |
|
|
} |
|
|
}; |
|
|
})();Data.Req = { |
|
|
|
|
|
}; |
|
|
Data.Source = BISource = { |
|
|
|
|
|
}; |