/*! time: 2021-9-12 15:31:57 */ !function(r){var e={};function n(t){if(e[t])return e[t].exports;var a=e[t]={i:t,l:!1,exports:{}};return r[t].call(a.exports,a,a.exports,n),a.l=!0,a.exports}n.m=r,n.c=e,n.d=function(r,e,t){n.o(r,e)||Object.defineProperty(r,e,{enumerable:!0,get:t})},n.r=function(r){"undefined"!=typeof Symbol&&Symbol.toStringTag&&Object.defineProperty(r,Symbol.toStringTag,{value:"Module"}),Object.defineProperty(r,"__esModule",{value:!0})},n.t=function(r,e){if(1&e&&(r=n(r)),8&e)return r;if(4&e&&"object"==typeof r&&r&&r.__esModule)return r;var t=Object.create(null);if(n.r(t),Object.defineProperty(t,"default",{enumerable:!0,value:r}),2&e&&"string"!=typeof r)for(var a in r)n.d(t,a,function(e){return r[e]}.bind(null,a));return t},n.n=function(r){var e=r&&r.__esModule?function(){return r["default"]}:function(){return r};return n.d(e,"a",e),e},n.o=function(r,e){return Object.prototype.hasOwnProperty.call(r,e)},n.p="",n(n.s=1264)}({1121:function(r,e){BI.i18n={"BI-Multi_Date_Quarter_End":"季度末","BI-Multi_Date_Month_Begin":"月初","BI-Multi_Date_YMD":"年月日","BI-Custom_Color":"自定义颜色","BI-Numerical_Interval_Input_Data":"请输入数值","BI-Please_Input_Natural_Number":"请输入非负整数","BI-No_More_Data":"无更多数据","BI-Basic_Altogether":"共","BI-Basic_Sunday":"星期日","BI-Widget_Background_Colour":"组件背景","BI-Color_Picker_Error_Text":"请输入0-255的正整数","BI-Multi_Date_Month":"月","BI-No_Selected_Item":"没有可选项","BI-Multi_Date_Year_Begin":"年初","BI-Quarter_1":"第1季度","BI-Quarter_2":"第2季度","BI-Quarter_3":"第3季度","BI-Quarter_4":"第4季度","BI-Multi_Date_Year_Next":"年后","BI-Multi_Date_Month_Prev":"个月前","BI-Month_Trigger_Error_Text":"请输入1~12的正整数","BI-Less_And_Equal":"小于等于","BI-Year_Trigger_Invalid_Text":"请输入有效时间","BI-Multi_Date_Week_Next":"周后","BI-Font_Size":"字号","BI-Basic_Total":"共","BI-Already_Selected":"已选择","BI-Formula_Insert":"插入","BI-Select_All":"全选","BI-Basic_Tuesday":"星期二","BI-Multi_Date_Month_End":"月末","BI-Load_More":"点击加载更多数据","BI-Basic_September":"九月","BI-Current_Is_Last_Page":"当前已是最后一页","BI-Basic_Auto":"自动","BI-Basic_Count":"个","BI-Basic_Value":"值","BI-Basic_Unrestricted":"无限制","BI-Quarter_Trigger_Error_Text":"请输入1~4的正整数","BI-Basic_More":"更多","BI-Basic_Wednesday":"星期三","BI-Basic_Bold":"加粗","BI-Basic_Simple_Saturday":"六","BI-Multi_Date_Month_Next":"个月后","BI-Basic_March":"三月","BI-Current_Is_First_Page":"当前已是第一页","BI-Basic_Thursday":"星期四","BI-Basic_Prompt":"提示","BI-Multi_Date_Today":"今天","BI-Multi_Date_Quarter_Prev":"个季度前","BI-Row_Header":"行表头","BI-Date_Trigger_Error_Text":"日期格式示例:2015-3-11","BI-Basic_Cancel":"取消","BI-Basic_January":"一月","BI-Basic_June":"六月","BI-Basic_July":"七月","BI-Basic_April":"四月","BI-Multi_Date_Quarter_Begin":"季度初","BI-Multi_Date_Week":"周","BI-Click_Blank_To_Select":'点击"空格键"选中完全匹配项',"BI-Basic_August":"八月","BI-Word_Align_Left":"文字居左","BI-Basic_November":"十一月","BI-Font_Colour":"字体颜色","BI-Multi_Date_Day_Prev":"天前","BI-Select_Part":"部分选择","BI-Multi_Date_Day_Next":"天后","BI-Less_Than":"小于","BI-Basic_February":"二月","BI-Multi_Date_Year":"年","BI-Number_Index":"序号","BI-Multi_Date_Week_Prev":"周前","BI-Next_Page":"下一页","BI-Right_Page":"向右翻页","BI-Numerical_Interval_Signal_Value":"前后值相等,请将操作符改为“≤”","BI-Basic_December":"十二月","BI-Basic_Saturday":"星期六","BI-Basic_Simple_Wednesday":"三","BI-Multi_Date_Quarter_Next":"个季度后","BI-Basic_October":"十月","BI-Basic_Simple_Friday":"五","BI-Basic_Save":"保存","BI-Numerical_Interval_Number_Value":"请保证前面的数值小于/等于后面的数值","BI-Previous_Page":"上一页","BI-No_Select":"搜索结果为空","BI-Basic_Clears":"清空","BI-Created_By_Me":"我创建的","BI-Basic_Simple_Tuesday":"二","BI-Word_Align_Right":"文字居右","BI-Summary_Values":"汇总","BI-Basic_Clear":"清除","BI-Upload_File_Size_Error":"文件大小不支持","BI-Upload_File_Count_Error":"超出上传数量上限{R1},请重新上传","BI-Up_Page":"向上翻页","BI-Basic_Simple_Sunday":"日","BI-Multi_Date_Relative_Current_Time":"相对当前时间","BI-Selected_Data":"已选数据:","BI-Multi_Date_Quarter":"季度","BI-Check_Selected":"查看已选","BI-Basic_Search":"搜索","BI-Basic_May":"五月","BI-Continue_Select":"继续选择","BI-Please_Input_Positive_Integer":"请输入正整数","BI-Upload_File_Type_Error":"文件类型不支持","BI-Upload_File_Error":"文件上传失败","BI-Basic_Friday":"星期五","BI-Down_Page":"向下翻页","BI-Basic_Monday":"星期一","BI-Left_Page":"向左翻页","BI-Transparent_Color":"透明","BI-Basic_Simple_Monday":"一","BI-Multi_Date_Year_End":"年末","BI-Time_Interval_Error_Text":"请保证开始时间早于/等于结束时间","BI-Basic_Time":"时间","BI-Basic_OK":"确定","BI-Basic_Sure":"确定","BI-Basic_Simple_Thursday":"四","BI-Multi_Date_Year_Prev":"年前","BI-Tiao_Data":"条数据","BI-Basic_Italic":"斜体","BI-Basic_Dynamic_Title":"动态时间","BI-Basic_Year":"年","BI-Basic_Single_Quarter":"季","BI-Basic_Month":"月","BI-Basic_Week":"周","BI-Basic_Day":"天","BI-Basic_Work_Day":"工作日","BI-Basic_Front":"前","BI-Basic_Behind":"后","BI-Basic_Empty":"空","BI-Basic_Month_End":"月末","BI-Basic_Month_Begin":"月初","BI-Basic_Year_End":"年末","BI-Basic_Year_Begin":"年初","BI-Basic_Quarter_End":"季末","BI-Basic_Quarter_Begin":"季初","BI-Basic_Week_End":"周末","BI-Basic_Week_Begin":"周初","BI-Basic_Current_Day":"当天","BI-Basic_Begin_Start":"初","BI-Basic_End_Stop":"末","BI-Basic_Current_Year":"今年","BI-Basic_Year_Fen":"年份","BI-Basic_Current_Month":"本月","BI-Basic_Current_Quarter":"本季度","BI-Basic_Year_Month":"年月","BI-Basic_Year_Quarter":"年季度","BI-Basic_Input_Can_Not_Null":"输入框不能为空","BI-Basic_Date_Time_Error_Text":"日期格式示例:2015-3-11 00:00:00","BI-Basic_Input_From_To_Number":"请输入{R1}的数值","BI-Basic_Or":"或","BI-Basic_And":"且","BI-Conf_Add_Formula":"添加公式","BI-Conf_Add_Condition":"添加条件","BI-Conf_Formula_And":"且公式条件","BI-Conf_Formula_Or":"或公式条件","BI-Conf_Condition_And":"且条件","BI-Conf_Condition_Or":"或条件","BI-Microsoft_YaHei":"微软雅黑","BI-Apple_Light":"苹方-light","BI-Font_Family":"字体","BI-Basic_Please_Input_Content":"请输入内容","BI-Word_Align_Center":"文字居中","BI-Basic_Please_Enter_Number_Between":"请输入{R1}-{R2}的值","BI-More_Than":"大于","BI-More_And_Equal":"大于等于","BI-Please_Enter_SQL":"请输入SQL","BI-Basic_Click_To_Add_Text":'点按回车键添加"{R1}"',"BI-Basic_Please_Select":"请选择","BI-Basic_Font_Color":"文字颜色","BI-Basic_Background_Color":"背景色","BI-Basic_Underline":"下划线","BI-Basic_Param_Month":"{R1}月","BI-Basic_Param_Day":"{R1}日","BI-Basic_Param_Quarter":"{R1}季度","BI-Basic_Param_Week_Count":"第{R1}周","BI-Basic_Param_Hour":"{R1}时","BI-Basic_Param_Minute":"{R1}分","BI-Basic_Param_Second":"{R1}秒","BI-Basic_Param_Year":"{R1}年","BI-Basic_Date_Day":"日","BI-Basic_Hour_Sin":"时","BI-Basic_Seconds":"秒","BI-Basic_Minute":"分","BI-Basic_Thousand":"千","BI-Basic_Wan":"万","BI-Basic_Million":"百万","BI-Basic_Billion":"亿","BI-Basic_Quarter":"季度","BI-Basic_No_Select":"不选","BI-Basic_Now":"此刻","BI-Color_Picker_Error_Text_Hex":"请输入6位16进制颜色编号","BI-Basic_Date_Range_Error":"请选择{R1}年{R2}月{R3}日-{R4}年{R5}月{R6}日的日期","BI-Basic_Year_Range_Error":"请选择{R1}年-{R2}年的日期","BI-Basic_Year_Month_Range_Error":"请选择{R1}年{R2}月-{R3}年{R4}月的日期","BI-Basic_Year_Quarter_Range_Error":"请选择{R1}年{R2}季度-{R3}年{R4}季度的日期","BI-Basic_Search_And_Patch_Paste":"搜索,支持批量粘贴、粘贴值通过换行识别","BI-Basic_Recommend_Color":"推荐色"}},1264:function(r,e,n){n(136),n(155),n(162),n(163),n(164),n(165),n(166),n(167),n(168),n(169),n(170),n(158),n(160),n(161),n(171),n(172),n(1121),n(1265),n(173),n(174),r.exports=n(175)},1265:function(r,e){BI.Date=BI.Date||{},BI.Date._DN=["星期日","星期一","星期二","星期三","星期四","星期五","星期六","星期日"],BI.Date._SDN=["日","一","二","三","四","五","六","日"],BI.Date._FD=1,BI.Date._MN=["一月","二月","三月","四月","五月","六月","七月","八月","九月","十月","十一月","十二月"],BI.Date._SMN=[0,1,2,3,4,5,6,7,8,9,10,11],BI.Date._QN=["","第1季度","第2季度","第3季度","第4季度"],BI.Date._MD=[31,28,31,30,31,30,31,31,30,31,30,31],BI.Date._OFFSET=[0,-1,-2,-3,-4,-5,-6]},136:function(r,e,n){(function(r){_global=undefined,"undefined"!=typeof window?_global=window:void 0!==r?_global=r:"undefined"!=typeof self?_global=self:_global=this,null==_global.BI&&(_global.BI={prepares:[]}),null==_global.BI.prepares&&(_global.BI.prepares=[])}).call(this,n(15))},15:function(r,e,n){"use strict";function t(r){return(t="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function(r){return typeof r}:function(r){return r&&"function"==typeof Symbol&&r.constructor===Symbol&&r!==Symbol.prototype?"symbol":typeof r})(r)}var a;a=function(){return this}();try{a=a||new Function("return this")()}catch(o){"object"===("undefined"==typeof window?"undefined":t(window))&&(a=window)}r.exports=a},155:function(r,e,n){n(156)(n(157))},156:function(r,e){r.exports=function(r){function e(r){"undefined"!=typeof console&&(console.error||console.log)("[Script Loader]",r)}try{"undefined"!=typeof execScript&&"undefined"!=typeof attachEvent&&"undefined"==typeof addEventListener?execScript(r):"undefined"!=typeof eval?eval.call(null,r):e("EvalError: No eval function available")}catch(n){e(n)}}},157:function(r,e){r.exports="/**\r\n * @license\r\n * Lodash (Custom Build) \r\n * Build: `lodash core plus=\"debounce,throttle,get,set,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference,defaultsDeep,trim,merge,groupBy,uniqBy,before,after,unescape\"`\r\n * Copyright JS Foundation and other contributors \r\n * Released under MIT license \r\n * Based on Underscore.js 1.8.3 \r\n * Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors\r\n */\r\n;(function() {\r\n\r\n /** Used as a safe reference for `undefined` in pre-ES5 environments. */\r\n var undefined;\r\n\r\n /** Used as the semantic version number. */\r\n var VERSION = '4.17.5';\r\n\r\n /** Used as the size to enable large array optimizations. */\r\n var LARGE_ARRAY_SIZE = 200;\r\n\r\n /** Error message constants. */\r\n var FUNC_ERROR_TEXT = 'Expected a function';\r\n\r\n /** Used to stand-in for `undefined` hash values. */\r\n var HASH_UNDEFINED = '__lodash_hash_undefined__';\r\n\r\n /** Used as the maximum memoize cache size. */\r\n var MAX_MEMOIZE_SIZE = 500;\r\n\r\n /** Used as the internal argument placeholder. */\r\n var PLACEHOLDER = '__lodash_placeholder__';\r\n\r\n /** Used to compose bitmasks for cloning. */\r\n var CLONE_DEEP_FLAG = 1,\r\n CLONE_FLAT_FLAG = 2,\r\n CLONE_SYMBOLS_FLAG = 4;\r\n\r\n /** Used to compose bitmasks for value comparisons. */\r\n var COMPARE_PARTIAL_FLAG = 1,\r\n COMPARE_UNORDERED_FLAG = 2;\r\n\r\n /** Used to compose bitmasks for function metadata. */\r\n var WRAP_BIND_FLAG = 1,\r\n WRAP_BIND_KEY_FLAG = 2,\r\n WRAP_CURRY_BOUND_FLAG = 4,\r\n WRAP_CURRY_FLAG = 8,\r\n WRAP_CURRY_RIGHT_FLAG = 16,\r\n WRAP_PARTIAL_FLAG = 32,\r\n WRAP_PARTIAL_RIGHT_FLAG = 64,\r\n WRAP_ARY_FLAG = 128,\r\n WRAP_REARG_FLAG = 256,\r\n WRAP_FLIP_FLAG = 512;\r\n\r\n /** Used to detect hot functions by number of calls within a span of milliseconds. */\r\n var HOT_COUNT = 800,\r\n HOT_SPAN = 16;\r\n\r\n /** Used to indicate the type of lazy iteratees. */\r\n var LAZY_FILTER_FLAG = 1,\r\n LAZY_MAP_FLAG = 2,\r\n LAZY_WHILE_FLAG = 3;\r\n\r\n /** Used as references for various `Number` constants. */\r\n var INFINITY = 1 / 0,\r\n MAX_SAFE_INTEGER = 9007199254740991,\r\n MAX_INTEGER = 1.7976931348623157e+308,\r\n NAN = 0 / 0;\r\n\r\n /** Used as references for the maximum length and index of an array. */\r\n var MAX_ARRAY_LENGTH = 4294967295;\r\n\r\n /** Used to associate wrap methods with their bit flags. */\r\n var wrapFlags = [\r\n ['ary', WRAP_ARY_FLAG],\r\n ['bind', WRAP_BIND_FLAG],\r\n ['bindKey', WRAP_BIND_KEY_FLAG],\r\n ['curry', WRAP_CURRY_FLAG],\r\n ['curryRight', WRAP_CURRY_RIGHT_FLAG],\r\n ['flip', WRAP_FLIP_FLAG],\r\n ['partial', WRAP_PARTIAL_FLAG],\r\n ['partialRight', WRAP_PARTIAL_RIGHT_FLAG],\r\n ['rearg', WRAP_REARG_FLAG]\r\n ];\r\n\r\n /** `Object#toString` result references. */\r\n var argsTag = '[object Arguments]',\r\n arrayTag = '[object Array]',\r\n asyncTag = '[object AsyncFunction]',\r\n boolTag = '[object Boolean]',\r\n dateTag = '[object Date]',\r\n errorTag = '[object Error]',\r\n funcTag = '[object Function]',\r\n genTag = '[object GeneratorFunction]',\r\n mapTag = '[object Map]',\r\n numberTag = '[object Number]',\r\n nullTag = '[object Null]',\r\n objectTag = '[object Object]',\r\n promiseTag = '[object Promise]',\r\n proxyTag = '[object Proxy]',\r\n regexpTag = '[object RegExp]',\r\n setTag = '[object Set]',\r\n stringTag = '[object String]',\r\n symbolTag = '[object Symbol]',\r\n undefinedTag = '[object Undefined]',\r\n weakMapTag = '[object WeakMap]';\r\n\r\n var arrayBufferTag = '[object ArrayBuffer]',\r\n dataViewTag = '[object DataView]',\r\n float32Tag = '[object Float32Array]',\r\n float64Tag = '[object Float64Array]',\r\n int8Tag = '[object Int8Array]',\r\n int16Tag = '[object Int16Array]',\r\n int32Tag = '[object Int32Array]',\r\n uint8Tag = '[object Uint8Array]',\r\n uint8ClampedTag = '[object Uint8ClampedArray]',\r\n uint16Tag = '[object Uint16Array]',\r\n uint32Tag = '[object Uint32Array]';\r\n\r\n /** Used to match HTML entities and HTML characters. */\r\n var reEscapedHtml = /&(?:amp|lt|gt|quot|#39);/g,\r\n reUnescapedHtml = /[&<>\"']/g,\r\n reHasEscapedHtml = RegExp(reEscapedHtml.source),\r\n reHasUnescapedHtml = RegExp(reUnescapedHtml.source);\r\n\r\n /** Used to match property names within property paths. */\r\n var reIsDeepProp = /\\.|\\[(?:[^[\\]]*|([\"'])(?:(?!\\1)[^\\\\]|\\\\.)*?\\1)\\]/,\r\n reIsPlainProp = /^\\w*$/,\r\n rePropName = /[^.[\\]]+|\\[(?:(-?\\d+(?:\\.\\d+)?)|([\"'])((?:(?!\\2)[^\\\\]|\\\\.)*?)\\2)\\]|(?=(?:\\.|\\[\\])(?:\\.|\\[\\]|$))/g;\r\n\r\n /**\r\n * Used to match `RegExp`\r\n * [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns).\r\n */\r\n var reRegExpChar = /[\\\\^$.*+?()[\\]{}|]/g;\r\n\r\n /** Used to match leading and trailing whitespace. */\r\n var reTrim = /^\\s+|\\s+$/g;\r\n\r\n /** Used to match wrap detail comments. */\r\n var reWrapComment = /\\{(?:\\n\\/\\* \\[wrapped with .+\\] \\*\\/)?\\n?/,\r\n reWrapDetails = /\\{\\n\\/\\* \\[wrapped with (.+)\\] \\*/,\r\n reSplitDetails = /,? & /;\r\n\r\n /** Used to match backslashes in property paths. */\r\n var reEscapeChar = /\\\\(\\\\)?/g;\r\n\r\n /** Used to match `RegExp` flags from their coerced string values. */\r\n var reFlags = /\\w*$/;\r\n\r\n /** Used to detect bad signed hexadecimal string values. */\r\n var reIsBadHex = /^[-+]0x[0-9a-f]+$/i;\r\n\r\n /** Used to detect binary string values. */\r\n var reIsBinary = /^0b[01]+$/i;\r\n\r\n /** Used to detect host constructors (Safari). */\r\n var reIsHostCtor = /^\\[object .+?Constructor\\]$/;\r\n\r\n /** Used to detect octal string values. */\r\n var reIsOctal = /^0o[0-7]+$/i;\r\n\r\n /** Used to detect unsigned integer values. */\r\n var reIsUint = /^(?:0|[1-9]\\d*)$/;\r\n\r\n /** Used to compose unicode character classes. */\r\n var rsAstralRange = '\\\\ud800-\\\\udfff',\r\n rsComboMarksRange = '\\\\u0300-\\\\u036f',\r\n reComboHalfMarksRange = '\\\\ufe20-\\\\ufe2f',\r\n rsComboSymbolsRange = '\\\\u20d0-\\\\u20ff',\r\n rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange,\r\n rsVarRange = '\\\\ufe0e\\\\ufe0f';\r\n\r\n /** Used to compose unicode capture groups. */\r\n var rsAstral = '[' + rsAstralRange + ']',\r\n rsCombo = '[' + rsComboRange + ']',\r\n rsFitz = '\\\\ud83c[\\\\udffb-\\\\udfff]',\r\n rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')',\r\n rsNonAstral = '[^' + rsAstralRange + ']',\r\n rsRegional = '(?:\\\\ud83c[\\\\udde6-\\\\uddff]){2}',\r\n rsSurrPair = '[\\\\ud800-\\\\udbff][\\\\udc00-\\\\udfff]',\r\n rsZWJ = '\\\\u200d';\r\n\r\n /** Used to compose unicode regexes. */\r\n var reOptMod = rsModifier + '?',\r\n rsOptVar = '[' + rsVarRange + ']?',\r\n rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*',\r\n rsSeq = rsOptVar + reOptMod + rsOptJoin,\r\n rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')';\r\n\r\n /** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */\r\n var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g');\r\n\r\n /** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */\r\n var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange + rsComboRange + rsVarRange + ']');\r\n\r\n /** Used to identify `toStringTag` values of typed arrays. */\r\n var typedArrayTags = {};\r\n typedArrayTags[float32Tag] = typedArrayTags[float64Tag] =\r\n typedArrayTags[int8Tag] = typedArrayTags[int16Tag] =\r\n typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] =\r\n typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] =\r\n typedArrayTags[uint32Tag] = true;\r\n typedArrayTags[argsTag] = typedArrayTags[arrayTag] =\r\n typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] =\r\n typedArrayTags[dataViewTag] = typedArrayTags[dateTag] =\r\n typedArrayTags[errorTag] = typedArrayTags[funcTag] =\r\n typedArrayTags[mapTag] = typedArrayTags[numberTag] =\r\n typedArrayTags[objectTag] = typedArrayTags[regexpTag] =\r\n typedArrayTags[setTag] = typedArrayTags[stringTag] =\r\n typedArrayTags[weakMapTag] = false;\r\n\r\n /** Used to identify `toStringTag` values supported by `_.clone`. */\r\n var cloneableTags = {};\r\n cloneableTags[argsTag] = cloneableTags[arrayTag] =\r\n cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] =\r\n cloneableTags[boolTag] = cloneableTags[dateTag] =\r\n cloneableTags[float32Tag] = cloneableTags[float64Tag] =\r\n cloneableTags[int8Tag] = cloneableTags[int16Tag] =\r\n cloneableTags[int32Tag] = cloneableTags[mapTag] =\r\n cloneableTags[numberTag] = cloneableTags[objectTag] =\r\n cloneableTags[regexpTag] = cloneableTags[setTag] =\r\n cloneableTags[stringTag] = cloneableTags[symbolTag] =\r\n cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] =\r\n cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true;\r\n cloneableTags[errorTag] = cloneableTags[funcTag] =\r\n cloneableTags[weakMapTag] = false;\r\n\r\n /** Used to map characters to HTML entities. */\r\n var htmlEscapes = {\r\n '&': '&',\r\n '<': '<',\r\n '>': '>',\r\n '\"': '"',\r\n \"'\": '''\r\n };\r\n\r\n /** Used to map HTML entities to characters. */\r\n var htmlUnescapes = {\r\n '&': '&',\r\n '<': '<',\r\n '>': '>',\r\n '"': '\"',\r\n ''': \"'\"\r\n };\r\n\r\n /** Built-in method references without a dependency on `root`. */\r\n var freeParseFloat = parseFloat,\r\n freeParseInt = parseInt;\r\n\r\n /** Detect free variable `global` from Node.js. */\r\n var freeGlobal = typeof global == 'object' && global && global.Object === Object && global;\r\n\r\n /** Detect free variable `self`. */\r\n var freeSelf = typeof self == 'object' && self && self.Object === Object && self;\r\n\r\n /** Used as a reference to the global object. */\r\n var root = freeGlobal || freeSelf || Function('return this')();\r\n\r\n /** Detect free variable `exports`. */\r\n var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports;\r\n\r\n /** Detect free variable `module`. */\r\n var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module;\r\n\r\n /** Detect the popular CommonJS extension `module.exports`. */\r\n var moduleExports = freeModule && freeModule.exports === freeExports;\r\n\r\n /** Detect free variable `process` from Node.js. */\r\n var freeProcess = moduleExports && freeGlobal.process;\r\n\r\n /** Used to access faster Node.js helpers. */\r\n var nodeUtil = (function() {\r\n try {\r\n return freeProcess && freeProcess.binding && freeProcess.binding('util');\r\n } catch (e) {}\r\n }());\r\n\r\n /* Node.js helper references. */\r\n var nodeIsDate = nodeUtil && nodeUtil.isDate,\r\n nodeIsMap = nodeUtil && nodeUtil.isMap,\r\n nodeIsRegExp = nodeUtil && nodeUtil.isRegExp,\r\n nodeIsSet = nodeUtil && nodeUtil.isSet,\r\n nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray;\r\n\r\n /*--------------------------------------------------------------------------*/\r\n\r\n /**\r\n * A faster alternative to `Function#apply`, this function invokes `func`\r\n * with the `this` binding of `thisArg` and the arguments of `args`.\r\n *\r\n * @private\r\n * @param {Function} func The function to invoke.\r\n * @param {*} thisArg The `this` binding of `func`.\r\n * @param {Array} args The arguments to invoke `func` with.\r\n * @returns {*} Returns the result of `func`.\r\n */\r\n function apply(func, thisArg, args) {\r\n switch (args.length) {\r\n case 0: return func.call(thisArg);\r\n case 1: return func.call(thisArg, args[0]);\r\n case 2: return func.call(thisArg, args[0], args[1]);\r\n case 3: return func.call(thisArg, args[0], args[1], args[2]);\r\n }\r\n return func.apply(thisArg, args);\r\n }\r\n\r\n /**\r\n * A specialized version of `baseAggregator` for arrays.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} setter The function to set `accumulator` values.\r\n * @param {Function} iteratee The iteratee to transform keys.\r\n * @param {Object} accumulator The initial aggregated object.\r\n * @returns {Function} Returns `accumulator`.\r\n */\r\n function arrayAggregator(array, setter, iteratee, accumulator) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n while (++index < length) {\r\n var value = array[index];\r\n setter(accumulator, value, iteratee(value), array);\r\n }\r\n return accumulator;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.forEach` for arrays without support for\r\n * iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Array} Returns `array`.\r\n */\r\n function arrayEach(array, iteratee) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n while (++index < length) {\r\n if (iteratee(array[index], index, array) === false) {\r\n break;\r\n }\r\n }\r\n return array;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.every` for arrays without support for\r\n * iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {boolean} Returns `true` if all elements pass the predicate check,\r\n * else `false`.\r\n */\r\n function arrayEvery(array, predicate) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n while (++index < length) {\r\n if (!predicate(array[index], index, array)) {\r\n return false;\r\n }\r\n }\r\n return true;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.filter` for arrays without support for\r\n * iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {Array} Returns the new filtered array.\r\n */\r\n function arrayFilter(array, predicate) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length,\r\n resIndex = 0,\r\n result = [];\r\n\r\n while (++index < length) {\r\n var value = array[index];\r\n if (predicate(value, index, array)) {\r\n result[resIndex++] = value;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.includes` for arrays without support for\r\n * specifying an index to search from.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to inspect.\r\n * @param {*} target The value to search for.\r\n * @returns {boolean} Returns `true` if `target` is found, else `false`.\r\n */\r\n function arrayIncludes(array, value) {\r\n var length = array == null ? 0 : array.length;\r\n return !!length && baseIndexOf(array, value, 0) > -1;\r\n }\r\n\r\n /**\r\n * This function is like `arrayIncludes` except that it accepts a comparator.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to inspect.\r\n * @param {*} target The value to search for.\r\n * @param {Function} comparator The comparator invoked per element.\r\n * @returns {boolean} Returns `true` if `target` is found, else `false`.\r\n */\r\n function arrayIncludesWith(array, value, comparator) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n while (++index < length) {\r\n if (comparator(value, array[index])) {\r\n return true;\r\n }\r\n }\r\n return false;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.map` for arrays without support for iteratee\r\n * shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Array} Returns the new mapped array.\r\n */\r\n function arrayMap(array, iteratee) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length,\r\n result = Array(length);\r\n\r\n while (++index < length) {\r\n result[index] = iteratee(array[index], index, array);\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Appends the elements of `values` to `array`.\r\n *\r\n * @private\r\n * @param {Array} array The array to modify.\r\n * @param {Array} values The values to append.\r\n * @returns {Array} Returns `array`.\r\n */\r\n function arrayPush(array, values) {\r\n var index = -1,\r\n length = values.length,\r\n offset = array.length;\r\n\r\n while (++index < length) {\r\n array[offset + index] = values[index];\r\n }\r\n return array;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.reduce` for arrays without support for\r\n * iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @param {*} [accumulator] The initial value.\r\n * @param {boolean} [initAccum] Specify using the first element of `array` as\r\n * the initial value.\r\n * @returns {*} Returns the accumulated value.\r\n */\r\n function arrayReduce(array, iteratee, accumulator, initAccum) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n if (initAccum && length) {\r\n accumulator = array[++index];\r\n }\r\n while (++index < length) {\r\n accumulator = iteratee(accumulator, array[index], index, array);\r\n }\r\n return accumulator;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.some` for arrays without support for iteratee\r\n * shorthands.\r\n *\r\n * @private\r\n * @param {Array} [array] The array to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {boolean} Returns `true` if any element passes the predicate check,\r\n * else `false`.\r\n */\r\n function arraySome(array, predicate) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length;\r\n\r\n while (++index < length) {\r\n if (predicate(array[index], index, array)) {\r\n return true;\r\n }\r\n }\r\n return false;\r\n }\r\n\r\n /**\r\n * Gets the size of an ASCII `string`.\r\n *\r\n * @private\r\n * @param {string} string The string inspect.\r\n * @returns {number} Returns the string size.\r\n */\r\n var asciiSize = baseProperty('length');\r\n\r\n /**\r\n * Converts an ASCII `string` to an array.\r\n *\r\n * @private\r\n * @param {string} string The string to convert.\r\n * @returns {Array} Returns the converted array.\r\n */\r\n function asciiToArray(string) {\r\n return string.split('');\r\n }\r\n\r\n /**\r\n * The base implementation of methods like `_.findKey` and `_.findLastKey`,\r\n * without support for iteratee shorthands, which iterates over `collection`\r\n * using `eachFunc`.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to inspect.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @param {Function} eachFunc The function to iterate over `collection`.\r\n * @returns {*} Returns the found element or its key, else `undefined`.\r\n */\r\n function baseFindKey(collection, predicate, eachFunc) {\r\n var result;\r\n eachFunc(collection, function(value, key, collection) {\r\n if (predicate(value, key, collection)) {\r\n result = key;\r\n return false;\r\n }\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.findIndex` and `_.findLastIndex` without\r\n * support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @param {number} fromIndex The index to search from.\r\n * @param {boolean} [fromRight] Specify iterating from right to left.\r\n * @returns {number} Returns the index of the matched value, else `-1`.\r\n */\r\n function baseFindIndex(array, predicate, fromIndex, fromRight) {\r\n var length = array.length,\r\n index = fromIndex + (fromRight ? 1 : -1);\r\n\r\n while ((fromRight ? index-- : ++index < length)) {\r\n if (predicate(array[index], index, array)) {\r\n return index;\r\n }\r\n }\r\n return -1;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.indexOf` without `fromIndex` bounds checks.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {*} value The value to search for.\r\n * @param {number} fromIndex The index to search from.\r\n * @returns {number} Returns the index of the matched value, else `-1`.\r\n */\r\n function baseIndexOf(array, value, fromIndex) {\r\n return value === value\r\n ? strictIndexOf(array, value, fromIndex)\r\n : baseFindIndex(array, baseIsNaN, fromIndex);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isNaN` without support for number objects.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.\r\n */\r\n function baseIsNaN(value) {\r\n return value !== value;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.property` without support for deep paths.\r\n *\r\n * @private\r\n * @param {string} key The key of the property to get.\r\n * @returns {Function} Returns the new accessor function.\r\n */\r\n function baseProperty(key) {\r\n return function(object) {\r\n return object == null ? undefined : object[key];\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.propertyOf` without support for deep paths.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Function} Returns the new accessor function.\r\n */\r\n function basePropertyOf(object) {\r\n return function(key) {\r\n return object == null ? undefined : object[key];\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.reduce` and `_.reduceRight`, without support\r\n * for iteratee shorthands, which iterates over `collection` using `eachFunc`.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @param {*} accumulator The initial value.\r\n * @param {boolean} initAccum Specify using the first or last element of\r\n * `collection` as the initial value.\r\n * @param {Function} eachFunc The function to iterate over `collection`.\r\n * @returns {*} Returns the accumulated value.\r\n */\r\n function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) {\r\n eachFunc(collection, function(value, index, collection) {\r\n accumulator = initAccum\r\n ? (initAccum = false, value)\r\n : iteratee(accumulator, value, index, collection);\r\n });\r\n return accumulator;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.sortBy` which uses `comparer` to define the\r\n * sort order of `array` and replaces criteria objects with their corresponding\r\n * values.\r\n *\r\n * @private\r\n * @param {Array} array The array to sort.\r\n * @param {Function} comparer The function to define sort order.\r\n * @returns {Array} Returns `array`.\r\n */\r\n function baseSortBy(array, comparer) {\r\n var length = array.length;\r\n\r\n array.sort(comparer);\r\n while (length--) {\r\n array[length] = array[length].value;\r\n }\r\n return array;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.times` without support for iteratee shorthands\r\n * or max array length checks.\r\n *\r\n * @private\r\n * @param {number} n The number of times to invoke `iteratee`.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Array} Returns the array of results.\r\n */\r\n function baseTimes(n, iteratee) {\r\n var index = -1,\r\n result = Array(n);\r\n\r\n while (++index < n) {\r\n result[index] = iteratee(index);\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.unary` without support for storing metadata.\r\n *\r\n * @private\r\n * @param {Function} func The function to cap arguments for.\r\n * @returns {Function} Returns the new capped function.\r\n */\r\n function baseUnary(func) {\r\n return function(value) {\r\n return func(value);\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.values` and `_.valuesIn` which creates an\r\n * array of `object` property values corresponding to the property names\r\n * of `props`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Array} props The property names to get values for.\r\n * @returns {Object} Returns the array of property values.\r\n */\r\n function baseValues(object, props) {\r\n return arrayMap(props, function(key) {\r\n return object[key];\r\n });\r\n }\r\n\r\n /**\r\n * Checks if a `cache` value for `key` exists.\r\n *\r\n * @private\r\n * @param {Object} cache The cache to query.\r\n * @param {string} key The key of the entry to check.\r\n * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\r\n */\r\n function cacheHas(cache, key) {\r\n return cache.has(key);\r\n }\r\n\r\n /**\r\n * Used by `_.trim` and `_.trimStart` to get the index of the first string symbol\r\n * that is not found in the character symbols.\r\n *\r\n * @private\r\n * @param {Array} strSymbols The string symbols to inspect.\r\n * @param {Array} chrSymbols The character symbols to find.\r\n * @returns {number} Returns the index of the first unmatched string symbol.\r\n */\r\n function charsStartIndex(strSymbols, chrSymbols) {\r\n var index = -1,\r\n length = strSymbols.length;\r\n\r\n while (++index < length && baseIndexOf(chrSymbols, strSymbols[index], 0) > -1) {}\r\n return index;\r\n }\r\n\r\n /**\r\n * Used by `_.trim` and `_.trimEnd` to get the index of the last string symbol\r\n * that is not found in the character symbols.\r\n *\r\n * @private\r\n * @param {Array} strSymbols The string symbols to inspect.\r\n * @param {Array} chrSymbols The character symbols to find.\r\n * @returns {number} Returns the index of the last unmatched string symbol.\r\n */\r\n function charsEndIndex(strSymbols, chrSymbols) {\r\n var index = strSymbols.length;\r\n\r\n while (index-- && baseIndexOf(chrSymbols, strSymbols[index], 0) > -1) {}\r\n return index;\r\n }\r\n\r\n /**\r\n * Gets the number of `placeholder` occurrences in `array`.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {*} placeholder The placeholder to search for.\r\n * @returns {number} Returns the placeholder count.\r\n */\r\n function countHolders(array, placeholder) {\r\n var length = array.length,\r\n result = 0;\r\n\r\n while (length--) {\r\n if (array[length] === placeholder) {\r\n ++result;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Used by `_.escape` to convert characters to HTML entities.\r\n *\r\n * @private\r\n * @param {string} chr The matched character to escape.\r\n * @returns {string} Returns the escaped character.\r\n */\r\n var escapeHtmlChar = basePropertyOf(htmlEscapes);\r\n\r\n /**\r\n * Gets the value at `key` of `object`.\r\n *\r\n * @private\r\n * @param {Object} [object] The object to query.\r\n * @param {string} key The key of the property to get.\r\n * @returns {*} Returns the property value.\r\n */\r\n function getValue(object, key) {\r\n return object == null ? undefined : object[key];\r\n }\r\n\r\n /**\r\n * Checks if `string` contains Unicode symbols.\r\n *\r\n * @private\r\n * @param {string} string The string to inspect.\r\n * @returns {boolean} Returns `true` if a symbol is found, else `false`.\r\n */\r\n function hasUnicode(string) {\r\n return reHasUnicode.test(string);\r\n }\r\n\r\n /**\r\n * Converts `iterator` to an array.\r\n *\r\n * @private\r\n * @param {Object} iterator The iterator to convert.\r\n * @returns {Array} Returns the converted array.\r\n */\r\n function iteratorToArray(iterator) {\r\n var data,\r\n result = [];\r\n\r\n while (!(data = iterator.next()).done) {\r\n result.push(data.value);\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Converts `map` to its key-value pairs.\r\n *\r\n * @private\r\n * @param {Object} map The map to convert.\r\n * @returns {Array} Returns the key-value pairs.\r\n */\r\n function mapToArray(map) {\r\n var index = -1,\r\n result = Array(map.size);\r\n\r\n map.forEach(function(value, key) {\r\n result[++index] = [key, value];\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates a unary function that invokes `func` with its argument transformed.\r\n *\r\n * @private\r\n * @param {Function} func The function to wrap.\r\n * @param {Function} transform The argument transform.\r\n * @returns {Function} Returns the new function.\r\n */\r\n function overArg(func, transform) {\r\n return function(arg) {\r\n return func(transform(arg));\r\n };\r\n }\r\n\r\n /**\r\n * Replaces all `placeholder` elements in `array` with an internal placeholder\r\n * and returns an array of their indexes.\r\n *\r\n * @private\r\n * @param {Array} array The array to modify.\r\n * @param {*} placeholder The placeholder to replace.\r\n * @returns {Array} Returns the new array of placeholder indexes.\r\n */\r\n function replaceHolders(array, placeholder) {\r\n var index = -1,\r\n length = array.length,\r\n resIndex = 0,\r\n result = [];\r\n\r\n while (++index < length) {\r\n var value = array[index];\r\n if (value === placeholder || value === PLACEHOLDER) {\r\n array[index] = PLACEHOLDER;\r\n result[resIndex++] = index;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the value at `key`, unless `key` is \"__proto__\".\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {string} key The key of the property to get.\r\n * @returns {*} Returns the property value.\r\n */\r\n function safeGet(object, key) {\r\n return key == '__proto__'\r\n ? undefined\r\n : object[key];\r\n }\r\n\r\n /**\r\n * Converts `set` to an array of its values.\r\n *\r\n * @private\r\n * @param {Object} set The set to convert.\r\n * @returns {Array} Returns the values.\r\n */\r\n function setToArray(set) {\r\n var index = -1,\r\n result = Array(set.size);\r\n\r\n set.forEach(function(value) {\r\n result[++index] = value;\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * A specialized version of `_.indexOf` which performs strict equality\r\n * comparisons of values, i.e. `===`.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {*} value The value to search for.\r\n * @param {number} fromIndex The index to search from.\r\n * @returns {number} Returns the index of the matched value, else `-1`.\r\n */\r\n function strictIndexOf(array, value, fromIndex) {\r\n var index = fromIndex - 1,\r\n length = array.length;\r\n\r\n while (++index < length) {\r\n if (array[index] === value) {\r\n return index;\r\n }\r\n }\r\n return -1;\r\n }\r\n\r\n /**\r\n * Gets the number of symbols in `string`.\r\n *\r\n * @private\r\n * @param {string} string The string to inspect.\r\n * @returns {number} Returns the string size.\r\n */\r\n function stringSize(string) {\r\n return hasUnicode(string)\r\n ? unicodeSize(string)\r\n : asciiSize(string);\r\n }\r\n\r\n /**\r\n * Converts `string` to an array.\r\n *\r\n * @private\r\n * @param {string} string The string to convert.\r\n * @returns {Array} Returns the converted array.\r\n */\r\n function stringToArray(string) {\r\n return hasUnicode(string)\r\n ? unicodeToArray(string)\r\n : asciiToArray(string);\r\n }\r\n\r\n /**\r\n * Used by `_.unescape` to convert HTML entities to characters.\r\n *\r\n * @private\r\n * @param {string} chr The matched character to unescape.\r\n * @returns {string} Returns the unescaped character.\r\n */\r\n var unescapeHtmlChar = basePropertyOf(htmlUnescapes);\r\n\r\n /**\r\n * Gets the size of a Unicode `string`.\r\n *\r\n * @private\r\n * @param {string} string The string inspect.\r\n * @returns {number} Returns the string size.\r\n */\r\n function unicodeSize(string) {\r\n var result = reUnicode.lastIndex = 0;\r\n while (reUnicode.test(string)) {\r\n ++result;\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Converts a Unicode `string` to an array.\r\n *\r\n * @private\r\n * @param {string} string The string to convert.\r\n * @returns {Array} Returns the converted array.\r\n */\r\n function unicodeToArray(string) {\r\n return string.match(reUnicode) || [];\r\n }\r\n\r\n /*--------------------------------------------------------------------------*/\r\n\r\n /** Used for built-in method references. */\r\n var arrayProto = Array.prototype,\r\n funcProto = Function.prototype,\r\n objectProto = Object.prototype;\r\n\r\n /** Used to detect overreaching core-js shims. */\r\n var coreJsData = root['__core-js_shared__'];\r\n\r\n /** Used to resolve the decompiled source of functions. */\r\n var funcToString = funcProto.toString;\r\n\r\n /** Used to check objects for own properties. */\r\n var hasOwnProperty = objectProto.hasOwnProperty;\r\n\r\n /** Used to generate unique IDs. */\r\n var idCounter = 0;\r\n\r\n /** Used to detect methods masquerading as native. */\r\n var maskSrcKey = (function() {\r\n var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || '');\r\n return uid ? ('Symbol(src)_1.' + uid) : '';\r\n }());\r\n\r\n /**\r\n * Used to resolve the\r\n * [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring)\r\n * of values.\r\n */\r\n var nativeObjectToString = objectProto.toString;\r\n\r\n /** Used to infer the `Object` constructor. */\r\n var objectCtorString = funcToString.call(Object);\r\n\r\n /** Used to restore the original `_` reference in `_.noConflict`. */\r\n var oldDash = root._;\r\n\r\n /** Used to detect if a method is native. */\r\n var reIsNative = RegExp('^' +\r\n funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\\\$&')\r\n .replace(/hasOwnProperty|(function).*?(?=\\\\\\()| for .+?(?=\\\\\\])/g, '$1.*?') + '$'\r\n );\r\n\r\n /** Built-in value references. */\r\n var Buffer = moduleExports ? root.Buffer : undefined,\r\n Symbol = root.Symbol,\r\n Uint8Array = root.Uint8Array,\r\n allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined,\r\n getPrototype = overArg(Object.getPrototypeOf, Object),\r\n objectCreate = Object.create,\r\n propertyIsEnumerable = objectProto.propertyIsEnumerable,\r\n splice = arrayProto.splice,\r\n spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined,\r\n symIterator = Symbol ? Symbol.iterator : undefined,\r\n symToStringTag = Symbol ? Symbol.toStringTag : undefined;\r\n\r\n var defineProperty = (function() {\r\n try {\r\n var func = getNative(Object, 'defineProperty');\r\n func({}, '', {});\r\n return func;\r\n } catch (e) {}\r\n }());\r\n\r\n /* Built-in method references for those with the same name as other `lodash` methods. */\r\n var nativeCeil = Math.ceil,\r\n nativeFloor = Math.floor,\r\n nativeGetSymbols = Object.getOwnPropertySymbols,\r\n nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined,\r\n nativeIsFinite = root.isFinite,\r\n nativeKeys = overArg(Object.keys, Object),\r\n nativeMax = Math.max,\r\n nativeMin = Math.min,\r\n nativeNow = Date.now,\r\n nativeRandom = Math.random,\r\n nativeReverse = arrayProto.reverse;\r\n\r\n /* Built-in method references that are verified to be native. */\r\n var DataView = getNative(root, 'DataView'),\r\n Map = getNative(root, 'Map'),\r\n Promise = getNative(root, 'Promise'),\r\n Set = getNative(root, 'Set'),\r\n WeakMap = getNative(root, 'WeakMap'),\r\n nativeCreate = getNative(Object, 'create');\r\n\r\n /** Used to store function metadata. */\r\n var metaMap = WeakMap && new WeakMap;\r\n\r\n /** Used to lookup unminified function names. */\r\n var realNames = {};\r\n\r\n /** Used to detect maps, sets, and weakmaps. */\r\n var dataViewCtorString = toSource(DataView),\r\n mapCtorString = toSource(Map),\r\n promiseCtorString = toSource(Promise),\r\n setCtorString = toSource(Set),\r\n weakMapCtorString = toSource(WeakMap);\r\n\r\n /** Used to convert symbols to primitives and strings. */\r\n var symbolProto = Symbol ? Symbol.prototype : undefined,\r\n symbolValueOf = symbolProto ? symbolProto.valueOf : undefined,\r\n symbolToString = symbolProto ? symbolProto.toString : undefined;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a `lodash` object which wraps `value` to enable implicit method\r\n * chain sequences. Methods that operate on and return arrays, collections,\r\n * and functions can be chained together. Methods that retrieve a single value\r\n * or may return a primitive value will automatically end the chain sequence\r\n * and return the unwrapped value. Otherwise, the value must be unwrapped\r\n * with `_#value`.\r\n *\r\n * Explicit chain sequences, which must be unwrapped with `_#value`, may be\r\n * enabled using `_.chain`.\r\n *\r\n * The execution of chained methods is lazy, that is, it's deferred until\r\n * `_#value` is implicitly or explicitly called.\r\n *\r\n * Lazy evaluation allows several methods to support shortcut fusion.\r\n * Shortcut fusion is an optimization to merge iteratee calls; this avoids\r\n * the creation of intermediate arrays and can greatly reduce the number of\r\n * iteratee executions. Sections of a chain sequence qualify for shortcut\r\n * fusion if the section is applied to an array and iteratees accept only\r\n * one argument. The heuristic for whether a section qualifies for shortcut\r\n * fusion is subject to change.\r\n *\r\n * Chaining is supported in custom builds as long as the `_#value` method is\r\n * directly or indirectly included in the build.\r\n *\r\n * In addition to lodash methods, wrappers have `Array` and `String` methods.\r\n *\r\n * The wrapper `Array` methods are:\r\n * `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift`\r\n *\r\n * The wrapper `String` methods are:\r\n * `replace` and `split`\r\n *\r\n * The wrapper methods that support shortcut fusion are:\r\n * `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`,\r\n * `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`,\r\n * `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray`\r\n *\r\n * The chainable wrapper methods are:\r\n * `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`,\r\n * `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`,\r\n * `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`,\r\n * `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`,\r\n * `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`,\r\n * `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`,\r\n * `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`,\r\n * `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`,\r\n * `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`,\r\n * `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`,\r\n * `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`,\r\n * `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`,\r\n * `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`,\r\n * `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`,\r\n * `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`,\r\n * `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`,\r\n * `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`,\r\n * `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`,\r\n * `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`,\r\n * `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`,\r\n * `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`,\r\n * `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`,\r\n * `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`,\r\n * `zipObject`, `zipObjectDeep`, and `zipWith`\r\n *\r\n * The wrapper methods that are **not** chainable by default are:\r\n * `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`,\r\n * `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`,\r\n * `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`,\r\n * `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`,\r\n * `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`,\r\n * `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`,\r\n * `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`,\r\n * `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`,\r\n * `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`,\r\n * `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`,\r\n * `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`,\r\n * `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`,\r\n * `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`,\r\n * `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`,\r\n * `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`,\r\n * `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`,\r\n * `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`,\r\n * `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`,\r\n * `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`,\r\n * `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`,\r\n * `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`,\r\n * `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`,\r\n * `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`,\r\n * `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`,\r\n * `upperFirst`, `value`, and `words`\r\n *\r\n * @name _\r\n * @constructor\r\n * @category Seq\r\n * @param {*} value The value to wrap in a `lodash` instance.\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * function square(n) {\r\n * return n * n;\r\n * }\r\n *\r\n * var wrapped = _([1, 2, 3]);\r\n *\r\n * // Returns an unwrapped value.\r\n * wrapped.reduce(_.add);\r\n * // => 6\r\n *\r\n * // Returns a wrapped value.\r\n * var squares = wrapped.map(square);\r\n *\r\n * _.isArray(squares);\r\n * // => false\r\n *\r\n * _.isArray(squares.value());\r\n * // => true\r\n */\r\n function lodash(value) {\r\n if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) {\r\n if (value instanceof LodashWrapper) {\r\n return value;\r\n }\r\n if (hasOwnProperty.call(value, '__wrapped__')) {\r\n return wrapperClone(value);\r\n }\r\n }\r\n return new LodashWrapper(value);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.create` without support for assigning\r\n * properties to the created object.\r\n *\r\n * @private\r\n * @param {Object} proto The object to inherit from.\r\n * @returns {Object} Returns the new object.\r\n */\r\n var baseCreate = (function() {\r\n function object() {}\r\n return function(proto) {\r\n if (!isObject(proto)) {\r\n return {};\r\n }\r\n if (objectCreate) {\r\n return objectCreate(proto);\r\n }\r\n object.prototype = proto;\r\n var result = new object;\r\n object.prototype = undefined;\r\n return result;\r\n };\r\n }());\r\n\r\n /**\r\n * The function whose prototype chain sequence wrappers inherit from.\r\n *\r\n * @private\r\n */\r\n function baseLodash() {\r\n // No operation performed.\r\n }\r\n\r\n /**\r\n * The base constructor for creating `lodash` wrapper objects.\r\n *\r\n * @private\r\n * @param {*} value The value to wrap.\r\n * @param {boolean} [chainAll] Enable explicit method chain sequences.\r\n */\r\n function LodashWrapper(value, chainAll) {\r\n this.__wrapped__ = value;\r\n this.__actions__ = [];\r\n this.__chain__ = !!chainAll;\r\n this.__index__ = 0;\r\n this.__values__ = undefined;\r\n }\r\n\r\n // Ensure wrappers are instances of `baseLodash`.\r\n lodash.prototype = baseLodash.prototype;\r\n lodash.prototype.constructor = lodash;\r\n\r\n LodashWrapper.prototype = baseCreate(baseLodash.prototype);\r\n LodashWrapper.prototype.constructor = LodashWrapper;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a lazy wrapper object which wraps `value` to enable lazy evaluation.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {*} value The value to wrap.\r\n */\r\n function LazyWrapper(value) {\r\n this.__wrapped__ = value;\r\n this.__actions__ = [];\r\n this.__dir__ = 1;\r\n this.__filtered__ = false;\r\n this.__iteratees__ = [];\r\n this.__takeCount__ = MAX_ARRAY_LENGTH;\r\n this.__views__ = [];\r\n }\r\n\r\n /**\r\n * Creates a clone of the lazy wrapper object.\r\n *\r\n * @private\r\n * @name clone\r\n * @memberOf LazyWrapper\r\n * @returns {Object} Returns the cloned `LazyWrapper` object.\r\n */\r\n function lazyClone() {\r\n var result = new LazyWrapper(this.__wrapped__);\r\n result.__actions__ = copyArray(this.__actions__);\r\n result.__dir__ = this.__dir__;\r\n result.__filtered__ = this.__filtered__;\r\n result.__iteratees__ = copyArray(this.__iteratees__);\r\n result.__takeCount__ = this.__takeCount__;\r\n result.__views__ = copyArray(this.__views__);\r\n return result;\r\n }\r\n\r\n /**\r\n * Reverses the direction of lazy iteration.\r\n *\r\n * @private\r\n * @name reverse\r\n * @memberOf LazyWrapper\r\n * @returns {Object} Returns the new reversed `LazyWrapper` object.\r\n */\r\n function lazyReverse() {\r\n if (this.__filtered__) {\r\n var result = new LazyWrapper(this);\r\n result.__dir__ = -1;\r\n result.__filtered__ = true;\r\n } else {\r\n result = this.clone();\r\n result.__dir__ *= -1;\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Extracts the unwrapped value from its lazy wrapper.\r\n *\r\n * @private\r\n * @name value\r\n * @memberOf LazyWrapper\r\n * @returns {*} Returns the unwrapped value.\r\n */\r\n function lazyValue() {\r\n var array = this.__wrapped__.value(),\r\n dir = this.__dir__,\r\n isArr = isArray(array),\r\n isRight = dir < 0,\r\n arrLength = isArr ? array.length : 0,\r\n view = getView(0, arrLength, this.__views__),\r\n start = view.start,\r\n end = view.end,\r\n length = end - start,\r\n index = isRight ? end : (start - 1),\r\n iteratees = this.__iteratees__,\r\n iterLength = iteratees.length,\r\n resIndex = 0,\r\n takeCount = nativeMin(length, this.__takeCount__);\r\n\r\n if (!isArr || (!isRight && arrLength == length && takeCount == length)) {\r\n return baseWrapperValue(array, this.__actions__);\r\n }\r\n var result = [];\r\n\r\n outer:\r\n while (length-- && resIndex < takeCount) {\r\n index += dir;\r\n\r\n var iterIndex = -1,\r\n value = array[index];\r\n\r\n while (++iterIndex < iterLength) {\r\n var data = iteratees[iterIndex],\r\n iteratee = data.iteratee,\r\n type = data.type,\r\n computed = iteratee(value);\r\n\r\n if (type == LAZY_MAP_FLAG) {\r\n value = computed;\r\n } else if (!computed) {\r\n if (type == LAZY_FILTER_FLAG) {\r\n continue outer;\r\n } else {\r\n break outer;\r\n }\r\n }\r\n }\r\n result[resIndex++] = value;\r\n }\r\n return result;\r\n }\r\n\r\n // Ensure `LazyWrapper` is an instance of `baseLodash`.\r\n LazyWrapper.prototype = baseCreate(baseLodash.prototype);\r\n LazyWrapper.prototype.constructor = LazyWrapper;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a hash object.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {Array} [entries] The key-value pairs to cache.\r\n */\r\n function Hash(entries) {\r\n var index = -1,\r\n length = entries == null ? 0 : entries.length;\r\n\r\n this.clear();\r\n while (++index < length) {\r\n var entry = entries[index];\r\n this.set(entry[0], entry[1]);\r\n }\r\n }\r\n\r\n /**\r\n * Removes all key-value entries from the hash.\r\n *\r\n * @private\r\n * @name clear\r\n * @memberOf Hash\r\n */\r\n function hashClear() {\r\n this.__data__ = nativeCreate ? nativeCreate(null) : {};\r\n this.size = 0;\r\n }\r\n\r\n /**\r\n * Removes `key` and its value from the hash.\r\n *\r\n * @private\r\n * @name delete\r\n * @memberOf Hash\r\n * @param {Object} hash The hash to modify.\r\n * @param {string} key The key of the value to remove.\r\n * @returns {boolean} Returns `true` if the entry was removed, else `false`.\r\n */\r\n function hashDelete(key) {\r\n var result = this.has(key) && delete this.__data__[key];\r\n this.size -= result ? 1 : 0;\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the hash value for `key`.\r\n *\r\n * @private\r\n * @name get\r\n * @memberOf Hash\r\n * @param {string} key The key of the value to get.\r\n * @returns {*} Returns the entry value.\r\n */\r\n function hashGet(key) {\r\n var data = this.__data__;\r\n if (nativeCreate) {\r\n var result = data[key];\r\n return result === HASH_UNDEFINED ? undefined : result;\r\n }\r\n return hasOwnProperty.call(data, key) ? data[key] : undefined;\r\n }\r\n\r\n /**\r\n * Checks if a hash value for `key` exists.\r\n *\r\n * @private\r\n * @name has\r\n * @memberOf Hash\r\n * @param {string} key The key of the entry to check.\r\n * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\r\n */\r\n function hashHas(key) {\r\n var data = this.__data__;\r\n return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key);\r\n }\r\n\r\n /**\r\n * Sets the hash `key` to `value`.\r\n *\r\n * @private\r\n * @name set\r\n * @memberOf Hash\r\n * @param {string} key The key of the value to set.\r\n * @param {*} value The value to set.\r\n * @returns {Object} Returns the hash instance.\r\n */\r\n function hashSet(key, value) {\r\n var data = this.__data__;\r\n this.size += this.has(key) ? 0 : 1;\r\n data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value;\r\n return this;\r\n }\r\n\r\n // Add methods to `Hash`.\r\n Hash.prototype.clear = hashClear;\r\n Hash.prototype['delete'] = hashDelete;\r\n Hash.prototype.get = hashGet;\r\n Hash.prototype.has = hashHas;\r\n Hash.prototype.set = hashSet;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates an list cache object.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {Array} [entries] The key-value pairs to cache.\r\n */\r\n function ListCache(entries) {\r\n var index = -1,\r\n length = entries == null ? 0 : entries.length;\r\n\r\n this.clear();\r\n while (++index < length) {\r\n var entry = entries[index];\r\n this.set(entry[0], entry[1]);\r\n }\r\n }\r\n\r\n /**\r\n * Removes all key-value entries from the list cache.\r\n *\r\n * @private\r\n * @name clear\r\n * @memberOf ListCache\r\n */\r\n function listCacheClear() {\r\n this.__data__ = [];\r\n this.size = 0;\r\n }\r\n\r\n /**\r\n * Removes `key` and its value from the list cache.\r\n *\r\n * @private\r\n * @name delete\r\n * @memberOf ListCache\r\n * @param {string} key The key of the value to remove.\r\n * @returns {boolean} Returns `true` if the entry was removed, else `false`.\r\n */\r\n function listCacheDelete(key) {\r\n var data = this.__data__,\r\n index = assocIndexOf(data, key);\r\n\r\n if (index < 0) {\r\n return false;\r\n }\r\n var lastIndex = data.length - 1;\r\n if (index == lastIndex) {\r\n data.pop();\r\n } else {\r\n splice.call(data, index, 1);\r\n }\r\n --this.size;\r\n return true;\r\n }\r\n\r\n /**\r\n * Gets the list cache value for `key`.\r\n *\r\n * @private\r\n * @name get\r\n * @memberOf ListCache\r\n * @param {string} key The key of the value to get.\r\n * @returns {*} Returns the entry value.\r\n */\r\n function listCacheGet(key) {\r\n var data = this.__data__,\r\n index = assocIndexOf(data, key);\r\n\r\n return index < 0 ? undefined : data[index][1];\r\n }\r\n\r\n /**\r\n * Checks if a list cache value for `key` exists.\r\n *\r\n * @private\r\n * @name has\r\n * @memberOf ListCache\r\n * @param {string} key The key of the entry to check.\r\n * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\r\n */\r\n function listCacheHas(key) {\r\n return assocIndexOf(this.__data__, key) > -1;\r\n }\r\n\r\n /**\r\n * Sets the list cache `key` to `value`.\r\n *\r\n * @private\r\n * @name set\r\n * @memberOf ListCache\r\n * @param {string} key The key of the value to set.\r\n * @param {*} value The value to set.\r\n * @returns {Object} Returns the list cache instance.\r\n */\r\n function listCacheSet(key, value) {\r\n var data = this.__data__,\r\n index = assocIndexOf(data, key);\r\n\r\n if (index < 0) {\r\n ++this.size;\r\n data.push([key, value]);\r\n } else {\r\n data[index][1] = value;\r\n }\r\n return this;\r\n }\r\n\r\n // Add methods to `ListCache`.\r\n ListCache.prototype.clear = listCacheClear;\r\n ListCache.prototype['delete'] = listCacheDelete;\r\n ListCache.prototype.get = listCacheGet;\r\n ListCache.prototype.has = listCacheHas;\r\n ListCache.prototype.set = listCacheSet;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a map cache object to store key-value pairs.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {Array} [entries] The key-value pairs to cache.\r\n */\r\n function MapCache(entries) {\r\n var index = -1,\r\n length = entries == null ? 0 : entries.length;\r\n\r\n this.clear();\r\n while (++index < length) {\r\n var entry = entries[index];\r\n this.set(entry[0], entry[1]);\r\n }\r\n }\r\n\r\n /**\r\n * Removes all key-value entries from the map.\r\n *\r\n * @private\r\n * @name clear\r\n * @memberOf MapCache\r\n */\r\n function mapCacheClear() {\r\n this.size = 0;\r\n this.__data__ = {\r\n 'hash': new Hash,\r\n 'map': new (Map || ListCache),\r\n 'string': new Hash\r\n };\r\n }\r\n\r\n /**\r\n * Removes `key` and its value from the map.\r\n *\r\n * @private\r\n * @name delete\r\n * @memberOf MapCache\r\n * @param {string} key The key of the value to remove.\r\n * @returns {boolean} Returns `true` if the entry was removed, else `false`.\r\n */\r\n function mapCacheDelete(key) {\r\n var result = getMapData(this, key)['delete'](key);\r\n this.size -= result ? 1 : 0;\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the map value for `key`.\r\n *\r\n * @private\r\n * @name get\r\n * @memberOf MapCache\r\n * @param {string} key The key of the value to get.\r\n * @returns {*} Returns the entry value.\r\n */\r\n function mapCacheGet(key) {\r\n return getMapData(this, key).get(key);\r\n }\r\n\r\n /**\r\n * Checks if a map value for `key` exists.\r\n *\r\n * @private\r\n * @name has\r\n * @memberOf MapCache\r\n * @param {string} key The key of the entry to check.\r\n * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\r\n */\r\n function mapCacheHas(key) {\r\n return getMapData(this, key).has(key);\r\n }\r\n\r\n /**\r\n * Sets the map `key` to `value`.\r\n *\r\n * @private\r\n * @name set\r\n * @memberOf MapCache\r\n * @param {string} key The key of the value to set.\r\n * @param {*} value The value to set.\r\n * @returns {Object} Returns the map cache instance.\r\n */\r\n function mapCacheSet(key, value) {\r\n var data = getMapData(this, key),\r\n size = data.size;\r\n\r\n data.set(key, value);\r\n this.size += data.size == size ? 0 : 1;\r\n return this;\r\n }\r\n\r\n // Add methods to `MapCache`.\r\n MapCache.prototype.clear = mapCacheClear;\r\n MapCache.prototype['delete'] = mapCacheDelete;\r\n MapCache.prototype.get = mapCacheGet;\r\n MapCache.prototype.has = mapCacheHas;\r\n MapCache.prototype.set = mapCacheSet;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n *\r\n * Creates an array cache object to store unique values.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {Array} [values] The values to cache.\r\n */\r\n function SetCache(values) {\r\n var index = -1,\r\n length = values == null ? 0 : values.length;\r\n\r\n this.__data__ = new MapCache;\r\n while (++index < length) {\r\n this.add(values[index]);\r\n }\r\n }\r\n\r\n /**\r\n * Adds `value` to the array cache.\r\n *\r\n * @private\r\n * @name add\r\n * @memberOf SetCache\r\n * @alias push\r\n * @param {*} value The value to cache.\r\n * @returns {Object} Returns the cache instance.\r\n */\r\n function setCacheAdd(value) {\r\n this.__data__.set(value, HASH_UNDEFINED);\r\n return this;\r\n }\r\n\r\n /**\r\n * Checks if `value` is in the array cache.\r\n *\r\n * @private\r\n * @name has\r\n * @memberOf SetCache\r\n * @param {*} value The value to search for.\r\n * @returns {number} Returns `true` if `value` is found, else `false`.\r\n */\r\n function setCacheHas(value) {\r\n return this.__data__.has(value);\r\n }\r\n\r\n // Add methods to `SetCache`.\r\n SetCache.prototype.add = SetCache.prototype.push = setCacheAdd;\r\n SetCache.prototype.has = setCacheHas;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a stack cache object to store key-value pairs.\r\n *\r\n * @private\r\n * @constructor\r\n * @param {Array} [entries] The key-value pairs to cache.\r\n */\r\n function Stack(entries) {\r\n var data = this.__data__ = new ListCache(entries);\r\n this.size = data.size;\r\n }\r\n\r\n /**\r\n * Removes all key-value entries from the stack.\r\n *\r\n * @private\r\n * @name clear\r\n * @memberOf Stack\r\n */\r\n function stackClear() {\r\n this.__data__ = new ListCache;\r\n this.size = 0;\r\n }\r\n\r\n /**\r\n * Removes `key` and its value from the stack.\r\n *\r\n * @private\r\n * @name delete\r\n * @memberOf Stack\r\n * @param {string} key The key of the value to remove.\r\n * @returns {boolean} Returns `true` if the entry was removed, else `false`.\r\n */\r\n function stackDelete(key) {\r\n var data = this.__data__,\r\n result = data['delete'](key);\r\n\r\n this.size = data.size;\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the stack value for `key`.\r\n *\r\n * @private\r\n * @name get\r\n * @memberOf Stack\r\n * @param {string} key The key of the value to get.\r\n * @returns {*} Returns the entry value.\r\n */\r\n function stackGet(key) {\r\n return this.__data__.get(key);\r\n }\r\n\r\n /**\r\n * Checks if a stack value for `key` exists.\r\n *\r\n * @private\r\n * @name has\r\n * @memberOf Stack\r\n * @param {string} key The key of the entry to check.\r\n * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\r\n */\r\n function stackHas(key) {\r\n return this.__data__.has(key);\r\n }\r\n\r\n /**\r\n * Sets the stack `key` to `value`.\r\n *\r\n * @private\r\n * @name set\r\n * @memberOf Stack\r\n * @param {string} key The key of the value to set.\r\n * @param {*} value The value to set.\r\n * @returns {Object} Returns the stack cache instance.\r\n */\r\n function stackSet(key, value) {\r\n var data = this.__data__;\r\n if (data instanceof ListCache) {\r\n var pairs = data.__data__;\r\n if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) {\r\n pairs.push([key, value]);\r\n this.size = ++data.size;\r\n return this;\r\n }\r\n data = this.__data__ = new MapCache(pairs);\r\n }\r\n data.set(key, value);\r\n this.size = data.size;\r\n return this;\r\n }\r\n\r\n // Add methods to `Stack`.\r\n Stack.prototype.clear = stackClear;\r\n Stack.prototype['delete'] = stackDelete;\r\n Stack.prototype.get = stackGet;\r\n Stack.prototype.has = stackHas;\r\n Stack.prototype.set = stackSet;\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates an array of the enumerable property names of the array-like `value`.\r\n *\r\n * @private\r\n * @param {*} value The value to query.\r\n * @param {boolean} inherited Specify returning inherited property names.\r\n * @returns {Array} Returns the array of property names.\r\n */\r\n function arrayLikeKeys(value, inherited) {\r\n var isArr = isArray(value),\r\n isArg = !isArr && isArguments(value),\r\n isBuff = !isArr && !isArg && isBuffer(value),\r\n isType = !isArr && !isArg && !isBuff && isTypedArray(value),\r\n skipIndexes = isArr || isArg || isBuff || isType,\r\n result = skipIndexes ? baseTimes(value.length, String) : [],\r\n length = result.length;\r\n\r\n for (var key in value) {\r\n if ((inherited || hasOwnProperty.call(value, key)) &&\r\n !(skipIndexes && (\r\n // Safari 9 has enumerable `arguments.length` in strict mode.\r\n key == 'length' ||\r\n // Node.js 0.10 has enumerable non-index properties on buffers.\r\n (isBuff && (key == 'offset' || key == 'parent')) ||\r\n // PhantomJS 2 has enumerable non-index properties on typed arrays.\r\n (isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) ||\r\n // Skip index properties.\r\n isIndex(key, length)\r\n ))) {\r\n result.push(key);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * This function is like `assignValue` except that it doesn't assign\r\n * `undefined` values.\r\n *\r\n * @private\r\n * @param {Object} object The object to modify.\r\n * @param {string} key The key of the property to assign.\r\n * @param {*} value The value to assign.\r\n */\r\n function assignMergeValue(object, key, value) {\r\n if ((value !== undefined && !eq(object[key], value)) ||\r\n (value === undefined && !(key in object))) {\r\n baseAssignValue(object, key, value);\r\n }\r\n }\r\n\r\n /**\r\n * Assigns `value` to `key` of `object` if the existing value is not equivalent\r\n * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons.\r\n *\r\n * @private\r\n * @param {Object} object The object to modify.\r\n * @param {string} key The key of the property to assign.\r\n * @param {*} value The value to assign.\r\n */\r\n function assignValue(object, key, value) {\r\n var objValue = object[key];\r\n if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) ||\r\n (value === undefined && !(key in object))) {\r\n baseAssignValue(object, key, value);\r\n }\r\n }\r\n\r\n /**\r\n * Gets the index at which the `key` is found in `array` of key-value pairs.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {*} key The key to search for.\r\n * @returns {number} Returns the index of the matched value, else `-1`.\r\n */\r\n function assocIndexOf(array, key) {\r\n var length = array.length;\r\n while (length--) {\r\n if (eq(array[length][0], key)) {\r\n return length;\r\n }\r\n }\r\n return -1;\r\n }\r\n\r\n /**\r\n * Aggregates elements of `collection` on `accumulator` with keys transformed\r\n * by `iteratee` and values set by `setter`.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} setter The function to set `accumulator` values.\r\n * @param {Function} iteratee The iteratee to transform keys.\r\n * @param {Object} accumulator The initial aggregated object.\r\n * @returns {Function} Returns `accumulator`.\r\n */\r\n function baseAggregator(collection, setter, iteratee, accumulator) {\r\n baseEach(collection, function(value, key, collection) {\r\n setter(accumulator, value, iteratee(value), collection);\r\n });\r\n return accumulator;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.assign` without support for multiple sources\r\n * or `customizer` functions.\r\n *\r\n * @private\r\n * @param {Object} object The destination object.\r\n * @param {Object} source The source object.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function baseAssign(object, source) {\r\n return object && copyObject(source, keys(source), object);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.assignIn` without support for multiple sources\r\n * or `customizer` functions.\r\n *\r\n * @private\r\n * @param {Object} object The destination object.\r\n * @param {Object} source The source object.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function baseAssignIn(object, source) {\r\n return object && copyObject(source, keysIn(source), object);\r\n }\r\n\r\n /**\r\n * The base implementation of `assignValue` and `assignMergeValue` without\r\n * value checks.\r\n *\r\n * @private\r\n * @param {Object} object The object to modify.\r\n * @param {string} key The key of the property to assign.\r\n * @param {*} value The value to assign.\r\n */\r\n function baseAssignValue(object, key, value) {\r\n if (key == '__proto__' && defineProperty) {\r\n defineProperty(object, key, {\r\n 'configurable': true,\r\n 'enumerable': true,\r\n 'value': value,\r\n 'writable': true\r\n });\r\n } else {\r\n object[key] = value;\r\n }\r\n }\r\n\r\n /**\r\n * The base implementation of `_.at` without support for individual paths.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {string[]} paths The property paths to pick.\r\n * @returns {Array} Returns the picked elements.\r\n */\r\n function baseAt(object, paths) {\r\n var index = -1,\r\n length = paths.length,\r\n result = Array(length),\r\n skip = object == null;\r\n\r\n while (++index < length) {\r\n result[index] = skip ? undefined : get(object, paths[index]);\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.clamp` which doesn't coerce arguments.\r\n *\r\n * @private\r\n * @param {number} number The number to clamp.\r\n * @param {number} [lower] The lower bound.\r\n * @param {number} upper The upper bound.\r\n * @returns {number} Returns the clamped number.\r\n */\r\n function baseClamp(number, lower, upper) {\r\n if (number === number) {\r\n if (upper !== undefined) {\r\n number = number <= upper ? number : upper;\r\n }\r\n if (lower !== undefined) {\r\n number = number >= lower ? number : lower;\r\n }\r\n }\r\n return number;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.clone` and `_.cloneDeep` which tracks\r\n * traversed objects.\r\n *\r\n * @private\r\n * @param {*} value The value to clone.\r\n * @param {boolean} bitmask The bitmask flags.\r\n * 1 - Deep clone\r\n * 2 - Flatten inherited properties\r\n * 4 - Clone symbols\r\n * @param {Function} [customizer] The function to customize cloning.\r\n * @param {string} [key] The key of `value`.\r\n * @param {Object} [object] The parent object of `value`.\r\n * @param {Object} [stack] Tracks traversed objects and their clone counterparts.\r\n * @returns {*} Returns the cloned value.\r\n */\r\n function baseClone(value, bitmask, customizer, key, object, stack) {\r\n var result,\r\n isDeep = bitmask & CLONE_DEEP_FLAG,\r\n isFlat = bitmask & CLONE_FLAT_FLAG,\r\n isFull = bitmask & CLONE_SYMBOLS_FLAG;\r\n\r\n if (customizer) {\r\n result = object ? customizer(value, key, object, stack) : customizer(value);\r\n }\r\n if (result !== undefined) {\r\n return result;\r\n }\r\n if (!isObject(value)) {\r\n return value;\r\n }\r\n var isArr = isArray(value);\r\n if (isArr) {\r\n result = initCloneArray(value);\r\n if (!isDeep) {\r\n return copyArray(value, result);\r\n }\r\n } else {\r\n var tag = getTag(value),\r\n isFunc = tag == funcTag || tag == genTag;\r\n\r\n if (isBuffer(value)) {\r\n return cloneBuffer(value, isDeep);\r\n }\r\n if (tag == objectTag || tag == argsTag || (isFunc && !object)) {\r\n result = (isFlat || isFunc) ? {} : initCloneObject(value);\r\n if (!isDeep) {\r\n return isFlat\r\n ? copySymbolsIn(value, baseAssignIn(result, value))\r\n : copySymbols(value, baseAssign(result, value));\r\n }\r\n } else {\r\n if (!cloneableTags[tag]) {\r\n return object ? value : {};\r\n }\r\n result = initCloneByTag(value, tag, isDeep);\r\n }\r\n }\r\n // Check for circular references and return its corresponding clone.\r\n stack || (stack = new Stack);\r\n var stacked = stack.get(value);\r\n if (stacked) {\r\n return stacked;\r\n }\r\n stack.set(value, result);\r\n\r\n if (isSet(value)) {\r\n value.forEach(function(subValue) {\r\n result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack));\r\n });\r\n\r\n return result;\r\n }\r\n\r\n if (isMap(value)) {\r\n value.forEach(function(subValue, key) {\r\n result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack));\r\n });\r\n\r\n return result;\r\n }\r\n\r\n var keysFunc = isFull\r\n ? (isFlat ? getAllKeysIn : getAllKeys)\r\n : (isFlat ? keysIn : keys);\r\n\r\n var props = isArr ? undefined : keysFunc(value);\r\n arrayEach(props || value, function(subValue, key) {\r\n if (props) {\r\n key = subValue;\r\n subValue = value[key];\r\n }\r\n // Recursively populate clone (susceptible to call stack limits).\r\n assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack));\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.delay` and `_.defer` which accepts `args`\r\n * to provide to `func`.\r\n *\r\n * @private\r\n * @param {Function} func The function to delay.\r\n * @param {number} wait The number of milliseconds to delay invocation.\r\n * @param {Array} args The arguments to provide to `func`.\r\n * @returns {number|Object} Returns the timer id or timeout object.\r\n */\r\n function baseDelay(func, wait, args) {\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n return setTimeout(function() { func.apply(undefined, args); }, wait);\r\n }\r\n\r\n /**\r\n * The base implementation of methods like `_.difference` without support\r\n * for excluding multiple arrays or iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {Array} values The values to exclude.\r\n * @param {Function} [iteratee] The iteratee invoked per element.\r\n * @param {Function} [comparator] The comparator invoked per element.\r\n * @returns {Array} Returns the new array of filtered values.\r\n */\r\n function baseDifference(array, values, iteratee, comparator) {\r\n var index = -1,\r\n includes = arrayIncludes,\r\n isCommon = true,\r\n length = array.length,\r\n result = [],\r\n valuesLength = values.length;\r\n\r\n if (!length) {\r\n return result;\r\n }\r\n if (iteratee) {\r\n values = arrayMap(values, baseUnary(iteratee));\r\n }\r\n if (comparator) {\r\n includes = arrayIncludesWith;\r\n isCommon = false;\r\n }\r\n else if (values.length >= LARGE_ARRAY_SIZE) {\r\n includes = cacheHas;\r\n isCommon = false;\r\n values = new SetCache(values);\r\n }\r\n outer:\r\n while (++index < length) {\r\n var value = array[index],\r\n computed = iteratee == null ? value : iteratee(value);\r\n\r\n value = (comparator || value !== 0) ? value : 0;\r\n if (isCommon && computed === computed) {\r\n var valuesIndex = valuesLength;\r\n while (valuesIndex--) {\r\n if (values[valuesIndex] === computed) {\r\n continue outer;\r\n }\r\n }\r\n result.push(value);\r\n }\r\n else if (!includes(values, computed, comparator)) {\r\n result.push(value);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.forEach` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Array|Object} Returns `collection`.\r\n */\r\n var baseEach = createBaseEach(baseForOwn);\r\n\r\n /**\r\n * The base implementation of `_.every` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {boolean} Returns `true` if all elements pass the predicate check,\r\n * else `false`\r\n */\r\n function baseEvery(collection, predicate) {\r\n var result = true;\r\n baseEach(collection, function(value, index, collection) {\r\n result = !!predicate(value, index, collection);\r\n return result;\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of methods like `_.max` and `_.min` which accepts a\r\n * `comparator` to determine the extremum value.\r\n *\r\n * @private\r\n * @param {Array} array The array to iterate over.\r\n * @param {Function} iteratee The iteratee invoked per iteration.\r\n * @param {Function} comparator The comparator used to compare values.\r\n * @returns {*} Returns the extremum value.\r\n */\r\n function baseExtremum(array, iteratee, comparator) {\r\n var index = -1,\r\n length = array.length;\r\n\r\n while (++index < length) {\r\n var value = array[index],\r\n current = iteratee(value);\r\n\r\n if (current != null && (computed === undefined\r\n ? (current === current && !isSymbol(current))\r\n : comparator(current, computed)\r\n )) {\r\n var computed = current,\r\n result = value;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.filter` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {Array} Returns the new filtered array.\r\n */\r\n function baseFilter(collection, predicate) {\r\n var result = [];\r\n baseEach(collection, function(value, index, collection) {\r\n if (predicate(value, index, collection)) {\r\n result.push(value);\r\n }\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.flatten` with support for restricting flattening.\r\n *\r\n * @private\r\n * @param {Array} array The array to flatten.\r\n * @param {number} depth The maximum recursion depth.\r\n * @param {boolean} [predicate=isFlattenable] The function invoked per iteration.\r\n * @param {boolean} [isStrict] Restrict to values that pass `predicate` checks.\r\n * @param {Array} [result=[]] The initial result value.\r\n * @returns {Array} Returns the new flattened array.\r\n */\r\n function baseFlatten(array, depth, predicate, isStrict, result) {\r\n var index = -1,\r\n length = array.length;\r\n\r\n predicate || (predicate = isFlattenable);\r\n result || (result = []);\r\n\r\n while (++index < length) {\r\n var value = array[index];\r\n if (depth > 0 && predicate(value)) {\r\n if (depth > 1) {\r\n // Recursively flatten arrays (susceptible to call stack limits).\r\n baseFlatten(value, depth - 1, predicate, isStrict, result);\r\n } else {\r\n arrayPush(result, value);\r\n }\r\n } else if (!isStrict) {\r\n result[result.length] = value;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `baseForOwn` which iterates over `object`\r\n * properties returned by `keysFunc` and invokes `iteratee` for each property.\r\n * Iteratee functions may exit iteration early by explicitly returning `false`.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @param {Function} keysFunc The function to get the keys of `object`.\r\n * @returns {Object} Returns `object`.\r\n */\r\n var baseFor = createBaseFor();\r\n\r\n /**\r\n * This function is like `baseFor` except that it iterates over properties\r\n * in the opposite order.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @param {Function} keysFunc The function to get the keys of `object`.\r\n * @returns {Object} Returns `object`.\r\n */\r\n var baseForRight = createBaseFor(true);\r\n\r\n /**\r\n * The base implementation of `_.forOwn` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function baseForOwn(object, iteratee) {\r\n return object && baseFor(object, iteratee, keys);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.forOwnRight` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function baseForOwnRight(object, iteratee) {\r\n return object && baseForRight(object, iteratee, keys);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.functions` which creates an array of\r\n * `object` function property names filtered from `props`.\r\n *\r\n * @private\r\n * @param {Object} object The object to inspect.\r\n * @param {Array} props The property names to filter.\r\n * @returns {Array} Returns the function names.\r\n */\r\n function baseFunctions(object, props) {\r\n return arrayFilter(props, function(key) {\r\n return isFunction(object[key]);\r\n });\r\n }\r\n\r\n /**\r\n * The base implementation of `_.get` without support for default values.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path of the property to get.\r\n * @returns {*} Returns the resolved value.\r\n */\r\n function baseGet(object, path) {\r\n path = castPath(path, object);\r\n\r\n var index = 0,\r\n length = path.length;\r\n\r\n while (object != null && index < length) {\r\n object = object[toKey(path[index++])];\r\n }\r\n return (index && index == length) ? object : undefined;\r\n }\r\n\r\n /**\r\n * The base implementation of `getAllKeys` and `getAllKeysIn` which uses\r\n * `keysFunc` and `symbolsFunc` to get the enumerable property names and\r\n * symbols of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Function} keysFunc The function to get the keys of `object`.\r\n * @param {Function} symbolsFunc The function to get the symbols of `object`.\r\n * @returns {Array} Returns the array of property names and symbols.\r\n */\r\n function baseGetAllKeys(object, keysFunc, symbolsFunc) {\r\n var result = keysFunc(object);\r\n return isArray(object) ? result : arrayPush(result, symbolsFunc(object));\r\n }\r\n\r\n /**\r\n * The base implementation of `getTag` without fallbacks for buggy environments.\r\n *\r\n * @private\r\n * @param {*} value The value to query.\r\n * @returns {string} Returns the `toStringTag`.\r\n */\r\n function baseGetTag(value) {\r\n if (value == null) {\r\n return value === undefined ? undefinedTag : nullTag;\r\n }\r\n return (symToStringTag && symToStringTag in Object(value))\r\n ? getRawTag(value)\r\n : objectToString(value);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.gt` which doesn't coerce arguments.\r\n *\r\n * @private\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @returns {boolean} Returns `true` if `value` is greater than `other`,\r\n * else `false`.\r\n */\r\n function baseGt(value, other) {\r\n return value > other;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.has` without support for deep paths.\r\n *\r\n * @private\r\n * @param {Object} [object] The object to query.\r\n * @param {Array|string} key The key to check.\r\n * @returns {boolean} Returns `true` if `key` exists, else `false`.\r\n */\r\n function baseHas(object, key) {\r\n return object != null && hasOwnProperty.call(object, key);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.hasIn` without support for deep paths.\r\n *\r\n * @private\r\n * @param {Object} [object] The object to query.\r\n * @param {Array|string} key The key to check.\r\n * @returns {boolean} Returns `true` if `key` exists, else `false`.\r\n */\r\n function baseHasIn(object, key) {\r\n return object != null && key in Object(object);\r\n }\r\n\r\n /**\r\n * The base implementation of methods like `_.intersection`, without support\r\n * for iteratee shorthands, that accepts an array of arrays to inspect.\r\n *\r\n * @private\r\n * @param {Array} arrays The arrays to inspect.\r\n * @param {Function} [iteratee] The iteratee invoked per element.\r\n * @param {Function} [comparator] The comparator invoked per element.\r\n * @returns {Array} Returns the new array of shared values.\r\n */\r\n function baseIntersection(arrays, iteratee, comparator) {\r\n var includes = comparator ? arrayIncludesWith : arrayIncludes,\r\n length = arrays[0].length,\r\n othLength = arrays.length,\r\n othIndex = othLength,\r\n caches = Array(othLength),\r\n maxLength = Infinity,\r\n result = [];\r\n\r\n while (othIndex--) {\r\n var array = arrays[othIndex];\r\n if (othIndex && iteratee) {\r\n array = arrayMap(array, baseUnary(iteratee));\r\n }\r\n maxLength = nativeMin(array.length, maxLength);\r\n caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120))\r\n ? new SetCache(othIndex && array)\r\n : undefined;\r\n }\r\n array = arrays[0];\r\n\r\n var index = -1,\r\n seen = caches[0];\r\n\r\n outer:\r\n while (++index < length && result.length < maxLength) {\r\n var value = array[index],\r\n computed = iteratee ? iteratee(value) : value;\r\n\r\n value = (comparator || value !== 0) ? value : 0;\r\n if (!(seen\r\n ? cacheHas(seen, computed)\r\n : includes(result, computed, comparator)\r\n )) {\r\n othIndex = othLength;\r\n while (--othIndex) {\r\n var cache = caches[othIndex];\r\n if (!(cache\r\n ? cacheHas(cache, computed)\r\n : includes(arrays[othIndex], computed, comparator))\r\n ) {\r\n continue outer;\r\n }\r\n }\r\n if (seen) {\r\n seen.push(computed);\r\n }\r\n result.push(value);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.invert` and `_.invertBy` which inverts\r\n * `object` with values transformed by `iteratee` and set by `setter`.\r\n *\r\n * @private\r\n * @param {Object} object The object to iterate over.\r\n * @param {Function} setter The function to set `accumulator` values.\r\n * @param {Function} iteratee The iteratee to transform values.\r\n * @param {Object} accumulator The initial inverted object.\r\n * @returns {Function} Returns `accumulator`.\r\n */\r\n function baseInverter(object, setter, iteratee, accumulator) {\r\n baseForOwn(object, function(value, key, object) {\r\n setter(accumulator, iteratee(value), key, object);\r\n });\r\n return accumulator;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.invoke` without support for individual\r\n * method arguments.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path of the method to invoke.\r\n * @param {Array} args The arguments to invoke the method with.\r\n * @returns {*} Returns the result of the invoked method.\r\n */\r\n function baseInvoke(object, path, args) {\r\n path = castPath(path, object);\r\n object = parent(object, path);\r\n var func = object == null ? object : object[toKey(last(path))];\r\n return func == null ? undefined : apply(func, object, args);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isArguments`.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is an `arguments` object,\r\n */\r\n function baseIsArguments(value) {\r\n return isObjectLike(value) && baseGetTag(value) == argsTag;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isDate` without Node.js optimizations.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a date object, else `false`.\r\n */\r\n function baseIsDate(value) {\r\n return isObjectLike(value) && baseGetTag(value) == dateTag;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isEqual` which supports partial comparisons\r\n * and tracks traversed objects.\r\n *\r\n * @private\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @param {boolean} bitmask The bitmask flags.\r\n * 1 - Unordered comparison\r\n * 2 - Partial comparison\r\n * @param {Function} [customizer] The function to customize comparisons.\r\n * @param {Object} [stack] Tracks traversed `value` and `other` objects.\r\n * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\r\n */\r\n function baseIsEqual(value, other, bitmask, customizer, stack) {\r\n if (value === other) {\r\n return true;\r\n }\r\n if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) {\r\n return value !== value && other !== other;\r\n }\r\n return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack);\r\n }\r\n\r\n /**\r\n * A specialized version of `baseIsEqual` for arrays and objects which performs\r\n * deep comparisons and tracks traversed objects enabling objects with circular\r\n * references to be compared.\r\n *\r\n * @private\r\n * @param {Object} object The object to compare.\r\n * @param {Object} other The other object to compare.\r\n * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\r\n * @param {Function} customizer The function to customize comparisons.\r\n * @param {Function} equalFunc The function to determine equivalents of values.\r\n * @param {Object} [stack] Tracks traversed `object` and `other` objects.\r\n * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\r\n */\r\n function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) {\r\n var objIsArr = isArray(object),\r\n othIsArr = isArray(other),\r\n objTag = objIsArr ? arrayTag : getTag(object),\r\n othTag = othIsArr ? arrayTag : getTag(other);\r\n\r\n objTag = objTag == argsTag ? objectTag : objTag;\r\n othTag = othTag == argsTag ? objectTag : othTag;\r\n\r\n var objIsObj = objTag == objectTag,\r\n othIsObj = othTag == objectTag,\r\n isSameTag = objTag == othTag;\r\n\r\n if (isSameTag && isBuffer(object)) {\r\n if (!isBuffer(other)) {\r\n return false;\r\n }\r\n objIsArr = true;\r\n objIsObj = false;\r\n }\r\n if (isSameTag && !objIsObj) {\r\n stack || (stack = new Stack);\r\n return (objIsArr || isTypedArray(object))\r\n ? equalArrays(object, other, bitmask, customizer, equalFunc, stack)\r\n : equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack);\r\n }\r\n if (!(bitmask & COMPARE_PARTIAL_FLAG)) {\r\n var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'),\r\n othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__');\r\n\r\n if (objIsWrapped || othIsWrapped) {\r\n var objUnwrapped = objIsWrapped ? object.value() : object,\r\n othUnwrapped = othIsWrapped ? other.value() : other;\r\n\r\n stack || (stack = new Stack);\r\n return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack);\r\n }\r\n }\r\n if (!isSameTag) {\r\n return false;\r\n }\r\n stack || (stack = new Stack);\r\n return equalObjects(object, other, bitmask, customizer, equalFunc, stack);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isMap` without Node.js optimizations.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a map, else `false`.\r\n */\r\n function baseIsMap(value) {\r\n return isObjectLike(value) && getTag(value) == mapTag;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isMatch` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Object} object The object to inspect.\r\n * @param {Object} source The object of property values to match.\r\n * @param {Array} matchData The property names, values, and compare flags to match.\r\n * @param {Function} [customizer] The function to customize comparisons.\r\n * @returns {boolean} Returns `true` if `object` is a match, else `false`.\r\n */\r\n function baseIsMatch(object, source, matchData, customizer) {\r\n var index = matchData.length,\r\n length = index,\r\n noCustomizer = !customizer;\r\n\r\n if (object == null) {\r\n return !length;\r\n }\r\n object = Object(object);\r\n while (index--) {\r\n var data = matchData[index];\r\n if ((noCustomizer && data[2])\r\n ? data[1] !== object[data[0]]\r\n : !(data[0] in object)\r\n ) {\r\n return false;\r\n }\r\n }\r\n while (++index < length) {\r\n data = matchData[index];\r\n var key = data[0],\r\n objValue = object[key],\r\n srcValue = data[1];\r\n\r\n if (noCustomizer && data[2]) {\r\n if (objValue === undefined && !(key in object)) {\r\n return false;\r\n }\r\n } else {\r\n var stack = new Stack;\r\n if (customizer) {\r\n var result = customizer(objValue, srcValue, key, object, source, stack);\r\n }\r\n if (!(result === undefined\r\n ? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack)\r\n : result\r\n )) {\r\n return false;\r\n }\r\n }\r\n }\r\n return true;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isNative` without bad shim checks.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a native function,\r\n * else `false`.\r\n */\r\n function baseIsNative(value) {\r\n if (!isObject(value) || isMasked(value)) {\r\n return false;\r\n }\r\n var pattern = isFunction(value) ? reIsNative : reIsHostCtor;\r\n return pattern.test(toSource(value));\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isRegExp` without Node.js optimizations.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.\r\n */\r\n function baseIsRegExp(value) {\r\n return isObjectLike(value) && baseGetTag(value) == regexpTag;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isSet` without Node.js optimizations.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a set, else `false`.\r\n */\r\n function baseIsSet(value) {\r\n return isObjectLike(value) && getTag(value) == setTag;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.isTypedArray` without Node.js optimizations.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.\r\n */\r\n function baseIsTypedArray(value) {\r\n return isObjectLike(value) &&\r\n isLength(value.length) && !!typedArrayTags[baseGetTag(value)];\r\n }\r\n\r\n /**\r\n * The base implementation of `_.iteratee`.\r\n *\r\n * @private\r\n * @param {*} [value=_.identity] The value to convert to an iteratee.\r\n * @returns {Function} Returns the iteratee.\r\n */\r\n function baseIteratee(value) {\r\n // Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9.\r\n // See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details.\r\n if (typeof value == 'function') {\r\n return value;\r\n }\r\n if (value == null) {\r\n return identity;\r\n }\r\n if (typeof value == 'object') {\r\n return isArray(value)\r\n ? baseMatchesProperty(value[0], value[1])\r\n : baseMatches(value);\r\n }\r\n return property(value);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.keys` which doesn't treat sparse arrays as dense.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names.\r\n */\r\n function baseKeys(object) {\r\n if (!isPrototype(object)) {\r\n return nativeKeys(object);\r\n }\r\n var result = [];\r\n for (var key in Object(object)) {\r\n if (hasOwnProperty.call(object, key) && key != 'constructor') {\r\n result.push(key);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names.\r\n */\r\n function baseKeysIn(object) {\r\n if (!isObject(object)) {\r\n return nativeKeysIn(object);\r\n }\r\n var isProto = isPrototype(object),\r\n result = [];\r\n\r\n for (var key in object) {\r\n if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) {\r\n result.push(key);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.lt` which doesn't coerce arguments.\r\n *\r\n * @private\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @returns {boolean} Returns `true` if `value` is less than `other`,\r\n * else `false`.\r\n */\r\n function baseLt(value, other) {\r\n return value < other;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.map` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} iteratee The function invoked per iteration.\r\n * @returns {Array} Returns the new mapped array.\r\n */\r\n function baseMap(collection, iteratee) {\r\n var index = -1,\r\n result = isArrayLike(collection) ? Array(collection.length) : [];\r\n\r\n baseEach(collection, function(value, key, collection) {\r\n result[++index] = iteratee(value, key, collection);\r\n });\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.matches` which doesn't clone `source`.\r\n *\r\n * @private\r\n * @param {Object} source The object of property values to match.\r\n * @returns {Function} Returns the new spec function.\r\n */\r\n function baseMatches(source) {\r\n var matchData = getMatchData(source);\r\n if (matchData.length == 1 && matchData[0][2]) {\r\n return matchesStrictComparable(matchData[0][0], matchData[0][1]);\r\n }\r\n return function(object) {\r\n return object === source || baseIsMatch(object, source, matchData);\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.matchesProperty` which doesn't clone `srcValue`.\r\n *\r\n * @private\r\n * @param {string} path The path of the property to get.\r\n * @param {*} srcValue The value to match.\r\n * @returns {Function} Returns the new spec function.\r\n */\r\n function baseMatchesProperty(path, srcValue) {\r\n if (isKey(path) && isStrictComparable(srcValue)) {\r\n return matchesStrictComparable(toKey(path), srcValue);\r\n }\r\n return function(object) {\r\n var objValue = get(object, path);\r\n return (objValue === undefined && objValue === srcValue)\r\n ? hasIn(object, path)\r\n : baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG);\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.merge` without support for multiple sources.\r\n *\r\n * @private\r\n * @param {Object} object The destination object.\r\n * @param {Object} source The source object.\r\n * @param {number} srcIndex The index of `source`.\r\n * @param {Function} [customizer] The function to customize merged values.\r\n * @param {Object} [stack] Tracks traversed source values and their merged\r\n * counterparts.\r\n */\r\n function baseMerge(object, source, srcIndex, customizer, stack) {\r\n if (object === source) {\r\n return;\r\n }\r\n baseFor(source, function(srcValue, key) {\r\n if (isObject(srcValue)) {\r\n stack || (stack = new Stack);\r\n baseMergeDeep(object, source, key, srcIndex, baseMerge, customizer, stack);\r\n }\r\n else {\r\n var newValue = customizer\r\n ? customizer(safeGet(object, key), srcValue, (key + ''), object, source, stack)\r\n : undefined;\r\n\r\n if (newValue === undefined) {\r\n newValue = srcValue;\r\n }\r\n assignMergeValue(object, key, newValue);\r\n }\r\n }, keysIn);\r\n }\r\n\r\n /**\r\n * A specialized version of `baseMerge` for arrays and objects which performs\r\n * deep merges and tracks traversed objects enabling objects with circular\r\n * references to be merged.\r\n *\r\n * @private\r\n * @param {Object} object The destination object.\r\n * @param {Object} source The source object.\r\n * @param {string} key The key of the value to merge.\r\n * @param {number} srcIndex The index of `source`.\r\n * @param {Function} mergeFunc The function to merge values.\r\n * @param {Function} [customizer] The function to customize assigned values.\r\n * @param {Object} [stack] Tracks traversed source values and their merged\r\n * counterparts.\r\n */\r\n function baseMergeDeep(object, source, key, srcIndex, mergeFunc, customizer, stack) {\r\n var objValue = safeGet(object, key),\r\n srcValue = safeGet(source, key),\r\n stacked = stack.get(srcValue);\r\n\r\n if (stacked) {\r\n assignMergeValue(object, key, stacked);\r\n return;\r\n }\r\n var newValue = customizer\r\n ? customizer(objValue, srcValue, (key + ''), object, source, stack)\r\n : undefined;\r\n\r\n var isCommon = newValue === undefined;\r\n\r\n if (isCommon) {\r\n var isArr = isArray(srcValue),\r\n isBuff = !isArr && isBuffer(srcValue),\r\n isTyped = !isArr && !isBuff && isTypedArray(srcValue);\r\n\r\n newValue = srcValue;\r\n if (isArr || isBuff || isTyped) {\r\n if (isArray(objValue)) {\r\n newValue = objValue;\r\n }\r\n else if (isArrayLikeObject(objValue)) {\r\n newValue = copyArray(objValue);\r\n }\r\n else if (isBuff) {\r\n isCommon = false;\r\n newValue = cloneBuffer(srcValue, true);\r\n }\r\n else if (isTyped) {\r\n isCommon = false;\r\n newValue = cloneTypedArray(srcValue, true);\r\n }\r\n else {\r\n newValue = [];\r\n }\r\n }\r\n else if (isPlainObject(srcValue) || isArguments(srcValue)) {\r\n newValue = objValue;\r\n if (isArguments(objValue)) {\r\n newValue = toPlainObject(objValue);\r\n }\r\n else if (!isObject(objValue) || (srcIndex && isFunction(objValue))) {\r\n newValue = initCloneObject(srcValue);\r\n }\r\n }\r\n else {\r\n isCommon = false;\r\n }\r\n }\r\n if (isCommon) {\r\n // Recursively merge objects and arrays (susceptible to call stack limits).\r\n stack.set(srcValue, newValue);\r\n mergeFunc(newValue, srcValue, srcIndex, customizer, stack);\r\n stack['delete'](srcValue);\r\n }\r\n assignMergeValue(object, key, newValue);\r\n }\r\n\r\n /**\r\n * The base implementation of `_.orderBy` without param guards.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by.\r\n * @param {string[]} orders The sort orders of `iteratees`.\r\n * @returns {Array} Returns the new sorted array.\r\n */\r\n function baseOrderBy(collection, iteratees, orders) {\r\n var index = -1;\r\n iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee));\r\n\r\n var result = baseMap(collection, function(value, key, collection) {\r\n var criteria = arrayMap(iteratees, function(iteratee) {\r\n return iteratee(value);\r\n });\r\n return { 'criteria': criteria, 'index': ++index, 'value': value };\r\n });\r\n\r\n return baseSortBy(result, function(object, other) {\r\n return compareMultiple(object, other, orders);\r\n });\r\n }\r\n\r\n /**\r\n * The base implementation of `_.pick` without support for individual\r\n * property identifiers.\r\n *\r\n * @private\r\n * @param {Object} object The source object.\r\n * @param {string[]} paths The property paths to pick.\r\n * @returns {Object} Returns the new object.\r\n */\r\n function basePick(object, paths) {\r\n return basePickBy(object, paths, function(value, path) {\r\n return hasIn(object, path);\r\n });\r\n }\r\n\r\n /**\r\n * The base implementation of `_.pickBy` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Object} object The source object.\r\n * @param {string[]} paths The property paths to pick.\r\n * @param {Function} predicate The function invoked per property.\r\n * @returns {Object} Returns the new object.\r\n */\r\n function basePickBy(object, paths, predicate) {\r\n var index = -1,\r\n length = paths.length,\r\n result = {};\r\n\r\n while (++index < length) {\r\n var path = paths[index],\r\n value = baseGet(object, path);\r\n\r\n if (predicate(value, path)) {\r\n baseSet(result, castPath(path, object), value);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseProperty` which supports deep paths.\r\n *\r\n * @private\r\n * @param {Array|string} path The path of the property to get.\r\n * @returns {Function} Returns the new accessor function.\r\n */\r\n function basePropertyDeep(path) {\r\n return function(object) {\r\n return baseGet(object, path);\r\n };\r\n }\r\n\r\n /**\r\n * The base implementation of `_.random` without support for returning\r\n * floating-point numbers.\r\n *\r\n * @private\r\n * @param {number} lower The lower bound.\r\n * @param {number} upper The upper bound.\r\n * @returns {number} Returns the random number.\r\n */\r\n function baseRandom(lower, upper) {\r\n return lower + nativeFloor(nativeRandom() * (upper - lower + 1));\r\n }\r\n\r\n /**\r\n * The base implementation of `_.range` and `_.rangeRight` which doesn't\r\n * coerce arguments.\r\n *\r\n * @private\r\n * @param {number} start The start of the range.\r\n * @param {number} end The end of the range.\r\n * @param {number} step The value to increment or decrement by.\r\n * @param {boolean} [fromRight] Specify iterating from right to left.\r\n * @returns {Array} Returns the range of numbers.\r\n */\r\n function baseRange(start, end, step, fromRight) {\r\n var index = -1,\r\n length = nativeMax(nativeCeil((end - start) / (step || 1)), 0),\r\n result = Array(length);\r\n\r\n while (length--) {\r\n result[fromRight ? length : ++index] = start;\r\n start += step;\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.rest` which doesn't validate or coerce arguments.\r\n *\r\n * @private\r\n * @param {Function} func The function to apply a rest parameter to.\r\n * @param {number} [start=func.length-1] The start position of the rest parameter.\r\n * @returns {Function} Returns the new function.\r\n */\r\n function baseRest(func, start) {\r\n return setToString(overRest(func, start, identity), func + '');\r\n }\r\n\r\n /**\r\n * The base implementation of `_.set`.\r\n *\r\n * @private\r\n * @param {Object} object The object to modify.\r\n * @param {Array|string} path The path of the property to set.\r\n * @param {*} value The value to set.\r\n * @param {Function} [customizer] The function to customize path creation.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function baseSet(object, path, value, customizer) {\r\n if (!isObject(object)) {\r\n return object;\r\n }\r\n path = castPath(path, object);\r\n\r\n var index = -1,\r\n length = path.length,\r\n lastIndex = length - 1,\r\n nested = object;\r\n\r\n while (nested != null && ++index < length) {\r\n var key = toKey(path[index]),\r\n newValue = value;\r\n\r\n if (index != lastIndex) {\r\n var objValue = nested[key];\r\n newValue = customizer ? customizer(objValue, key, nested) : undefined;\r\n if (newValue === undefined) {\r\n newValue = isObject(objValue)\r\n ? objValue\r\n : (isIndex(path[index + 1]) ? [] : {});\r\n }\r\n }\r\n assignValue(nested, key, newValue);\r\n nested = nested[key];\r\n }\r\n return object;\r\n }\r\n\r\n /**\r\n * The base implementation of `setData` without support for hot loop shorting.\r\n *\r\n * @private\r\n * @param {Function} func The function to associate metadata with.\r\n * @param {*} data The metadata.\r\n * @returns {Function} Returns `func`.\r\n */\r\n var baseSetData = !metaMap ? identity : function(func, data) {\r\n metaMap.set(func, data);\r\n return func;\r\n };\r\n\r\n /**\r\n * The base implementation of `setToString` without support for hot loop shorting.\r\n *\r\n * @private\r\n * @param {Function} func The function to modify.\r\n * @param {Function} string The `toString` result.\r\n * @returns {Function} Returns `func`.\r\n */\r\n var baseSetToString = !defineProperty ? identity : function(func, string) {\r\n return defineProperty(func, 'toString', {\r\n 'configurable': true,\r\n 'enumerable': false,\r\n 'value': constant(string),\r\n 'writable': true\r\n });\r\n };\r\n\r\n /**\r\n * The base implementation of `_.slice` without an iteratee call guard.\r\n *\r\n * @private\r\n * @param {Array} array The array to slice.\r\n * @param {number} [start=0] The start position.\r\n * @param {number} [end=array.length] The end position.\r\n * @returns {Array} Returns the slice of `array`.\r\n */\r\n function baseSlice(array, start, end) {\r\n var index = -1,\r\n length = array.length;\r\n\r\n if (start < 0) {\r\n start = -start > length ? 0 : (length + start);\r\n }\r\n end = end > length ? length : end;\r\n if (end < 0) {\r\n end += length;\r\n }\r\n length = start > end ? 0 : ((end - start) >>> 0);\r\n start >>>= 0;\r\n\r\n var result = Array(length);\r\n while (++index < length) {\r\n result[index] = array[index + start];\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.some` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} predicate The function invoked per iteration.\r\n * @returns {boolean} Returns `true` if any element passes the predicate check,\r\n * else `false`.\r\n */\r\n function baseSome(collection, predicate) {\r\n var result;\r\n\r\n baseEach(collection, function(value, index, collection) {\r\n result = predicate(value, index, collection);\r\n return !result;\r\n });\r\n return !!result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.toString` which doesn't convert nullish\r\n * values to empty strings.\r\n *\r\n * @private\r\n * @param {*} value The value to process.\r\n * @returns {string} Returns the string.\r\n */\r\n function baseToString(value) {\r\n // Exit early for strings to avoid a performance hit in some environments.\r\n if (typeof value == 'string') {\r\n return value;\r\n }\r\n if (isArray(value)) {\r\n // Recursively convert values (susceptible to call stack limits).\r\n return arrayMap(value, baseToString) + '';\r\n }\r\n if (isSymbol(value)) {\r\n return symbolToString ? symbolToString.call(value) : '';\r\n }\r\n var result = (value + '');\r\n return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.uniqBy` without support for iteratee shorthands.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {Function} [iteratee] The iteratee invoked per element.\r\n * @param {Function} [comparator] The comparator invoked per element.\r\n * @returns {Array} Returns the new duplicate free array.\r\n */\r\n function baseUniq(array, iteratee, comparator) {\r\n var index = -1,\r\n includes = arrayIncludes,\r\n length = array.length,\r\n isCommon = true,\r\n result = [],\r\n seen = result;\r\n\r\n if (comparator) {\r\n isCommon = false;\r\n includes = arrayIncludesWith;\r\n }\r\n else if (length >= LARGE_ARRAY_SIZE) {\r\n var set = iteratee ? null : createSet(array);\r\n if (set) {\r\n return setToArray(set);\r\n }\r\n isCommon = false;\r\n includes = cacheHas;\r\n seen = new SetCache;\r\n }\r\n else {\r\n seen = iteratee ? [] : result;\r\n }\r\n outer:\r\n while (++index < length) {\r\n var value = array[index],\r\n computed = iteratee ? iteratee(value) : value;\r\n\r\n value = (comparator || value !== 0) ? value : 0;\r\n if (isCommon && computed === computed) {\r\n var seenIndex = seen.length;\r\n while (seenIndex--) {\r\n if (seen[seenIndex] === computed) {\r\n continue outer;\r\n }\r\n }\r\n if (iteratee) {\r\n seen.push(computed);\r\n }\r\n result.push(value);\r\n }\r\n else if (!includes(seen, computed, comparator)) {\r\n if (seen !== result) {\r\n seen.push(computed);\r\n }\r\n result.push(value);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * The base implementation of `_.unset`.\r\n *\r\n * @private\r\n * @param {Object} object The object to modify.\r\n * @param {Array|string} path The property path to unset.\r\n * @returns {boolean} Returns `true` if the property is deleted, else `false`.\r\n */\r\n function baseUnset(object, path) {\r\n path = castPath(path, object);\r\n object = parent(object, path);\r\n return object == null || delete object[toKey(last(path))];\r\n }\r\n\r\n /**\r\n * The base implementation of `wrapperValue` which returns the result of\r\n * performing a sequence of actions on the unwrapped `value`, where each\r\n * successive action is supplied the return value of the previous.\r\n *\r\n * @private\r\n * @param {*} value The unwrapped value.\r\n * @param {Array} actions Actions to perform to resolve the unwrapped value.\r\n * @returns {*} Returns the resolved value.\r\n */\r\n function baseWrapperValue(value, actions) {\r\n var result = value;\r\n if (result instanceof LazyWrapper) {\r\n result = result.value();\r\n }\r\n return arrayReduce(actions, function(result, action) {\r\n return action.func.apply(action.thisArg, arrayPush([result], action.args));\r\n }, result);\r\n }\r\n\r\n /**\r\n * This base implementation of `_.zipObject` which assigns values using `assignFunc`.\r\n *\r\n * @private\r\n * @param {Array} props The property identifiers.\r\n * @param {Array} values The property values.\r\n * @param {Function} assignFunc The function to assign values.\r\n * @returns {Object} Returns the new object.\r\n */\r\n function baseZipObject(props, values, assignFunc) {\r\n var index = -1,\r\n length = props.length,\r\n valsLength = values.length,\r\n result = {};\r\n\r\n while (++index < length) {\r\n var value = index < valsLength ? values[index] : undefined;\r\n assignFunc(result, props[index], value);\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Casts `value` to an empty array if it's not an array like object.\r\n *\r\n * @private\r\n * @param {*} value The value to inspect.\r\n * @returns {Array|Object} Returns the cast array-like object.\r\n */\r\n function castArrayLikeObject(value) {\r\n return isArrayLikeObject(value) ? value : [];\r\n }\r\n\r\n /**\r\n * Casts `value` to a path array if it's not one.\r\n *\r\n * @private\r\n * @param {*} value The value to inspect.\r\n * @param {Object} [object] The object to query keys on.\r\n * @returns {Array} Returns the cast property path array.\r\n */\r\n function castPath(value, object) {\r\n if (isArray(value)) {\r\n return value;\r\n }\r\n return isKey(value, object) ? [value] : stringToPath(toString(value));\r\n }\r\n\r\n /**\r\n * Casts `array` to a slice if it's needed.\r\n *\r\n * @private\r\n * @param {Array} array The array to inspect.\r\n * @param {number} start The start position.\r\n * @param {number} [end=array.length] The end position.\r\n * @returns {Array} Returns the cast slice.\r\n */\r\n function castSlice(array, start, end) {\r\n var length = array.length;\r\n end = end === undefined ? length : end;\r\n return (!start && end >= length) ? array : baseSlice(array, start, end);\r\n }\r\n\r\n /**\r\n * Creates a clone of `buffer`.\r\n *\r\n * @private\r\n * @param {Buffer} buffer The buffer to clone.\r\n * @param {boolean} [isDeep] Specify a deep clone.\r\n * @returns {Buffer} Returns the cloned buffer.\r\n */\r\n function cloneBuffer(buffer, isDeep) {\r\n if (isDeep) {\r\n return buffer.slice();\r\n }\r\n var length = buffer.length,\r\n result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length);\r\n\r\n buffer.copy(result);\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates a clone of `arrayBuffer`.\r\n *\r\n * @private\r\n * @param {ArrayBuffer} arrayBuffer The array buffer to clone.\r\n * @returns {ArrayBuffer} Returns the cloned array buffer.\r\n */\r\n function cloneArrayBuffer(arrayBuffer) {\r\n var result = new arrayBuffer.constructor(arrayBuffer.byteLength);\r\n new Uint8Array(result).set(new Uint8Array(arrayBuffer));\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates a clone of `dataView`.\r\n *\r\n * @private\r\n * @param {Object} dataView The data view to clone.\r\n * @param {boolean} [isDeep] Specify a deep clone.\r\n * @returns {Object} Returns the cloned data view.\r\n */\r\n function cloneDataView(dataView, isDeep) {\r\n var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer;\r\n return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength);\r\n }\r\n\r\n /**\r\n * Creates a clone of `regexp`.\r\n *\r\n * @private\r\n * @param {Object} regexp The regexp to clone.\r\n * @returns {Object} Returns the cloned regexp.\r\n */\r\n function cloneRegExp(regexp) {\r\n var result = new regexp.constructor(regexp.source, reFlags.exec(regexp));\r\n result.lastIndex = regexp.lastIndex;\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates a clone of the `symbol` object.\r\n *\r\n * @private\r\n * @param {Object} symbol The symbol object to clone.\r\n * @returns {Object} Returns the cloned symbol object.\r\n */\r\n function cloneSymbol(symbol) {\r\n return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {};\r\n }\r\n\r\n /**\r\n * Creates a clone of `typedArray`.\r\n *\r\n * @private\r\n * @param {Object} typedArray The typed array to clone.\r\n * @param {boolean} [isDeep] Specify a deep clone.\r\n * @returns {Object} Returns the cloned typed array.\r\n */\r\n function cloneTypedArray(typedArray, isDeep) {\r\n var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer;\r\n return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length);\r\n }\r\n\r\n /**\r\n * Compares values to sort them in ascending order.\r\n *\r\n * @private\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @returns {number} Returns the sort order indicator for `value`.\r\n */\r\n function compareAscending(value, other) {\r\n if (value !== other) {\r\n var valIsDefined = value !== undefined,\r\n valIsNull = value === null,\r\n valIsReflexive = value === value,\r\n valIsSymbol = isSymbol(value);\r\n\r\n var othIsDefined = other !== undefined,\r\n othIsNull = other === null,\r\n othIsReflexive = other === other,\r\n othIsSymbol = isSymbol(other);\r\n\r\n if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) ||\r\n (valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) ||\r\n (valIsNull && othIsDefined && othIsReflexive) ||\r\n (!valIsDefined && othIsReflexive) ||\r\n !valIsReflexive) {\r\n return 1;\r\n }\r\n if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) ||\r\n (othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) ||\r\n (othIsNull && valIsDefined && valIsReflexive) ||\r\n (!othIsDefined && valIsReflexive) ||\r\n !othIsReflexive) {\r\n return -1;\r\n }\r\n }\r\n return 0;\r\n }\r\n\r\n /**\r\n * Used by `_.orderBy` to compare multiple properties of a value to another\r\n * and stable sort them.\r\n *\r\n * If `orders` is unspecified, all values are sorted in ascending order. Otherwise,\r\n * specify an order of \"desc\" for descending or \"asc\" for ascending sort order\r\n * of corresponding values.\r\n *\r\n * @private\r\n * @param {Object} object The object to compare.\r\n * @param {Object} other The other object to compare.\r\n * @param {boolean[]|string[]} orders The order to sort by for each property.\r\n * @returns {number} Returns the sort order indicator for `object`.\r\n */\r\n function compareMultiple(object, other, orders) {\r\n var index = -1,\r\n objCriteria = object.criteria,\r\n othCriteria = other.criteria,\r\n length = objCriteria.length,\r\n ordersLength = orders.length;\r\n\r\n while (++index < length) {\r\n var result = compareAscending(objCriteria[index], othCriteria[index]);\r\n if (result) {\r\n if (index >= ordersLength) {\r\n return result;\r\n }\r\n var order = orders[index];\r\n return result * (order == 'desc' ? -1 : 1);\r\n }\r\n }\r\n // Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications\r\n // that causes it, under certain circumstances, to provide the same value for\r\n // `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247\r\n // for more details.\r\n //\r\n // This also ensures a stable sort in V8 and other engines.\r\n // See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details.\r\n return object.index - other.index;\r\n }\r\n\r\n /**\r\n * Creates an array that is the composition of partially applied arguments,\r\n * placeholders, and provided arguments into a single array of arguments.\r\n *\r\n * @private\r\n * @param {Array} args The provided arguments.\r\n * @param {Array} partials The arguments to prepend to those provided.\r\n * @param {Array} holders The `partials` placeholder indexes.\r\n * @params {boolean} [isCurried] Specify composing for a curried function.\r\n * @returns {Array} Returns the new array of composed arguments.\r\n */\r\n function composeArgs(args, partials, holders, isCurried) {\r\n var argsIndex = -1,\r\n argsLength = args.length,\r\n holdersLength = holders.length,\r\n leftIndex = -1,\r\n leftLength = partials.length,\r\n rangeLength = nativeMax(argsLength - holdersLength, 0),\r\n result = Array(leftLength + rangeLength),\r\n isUncurried = !isCurried;\r\n\r\n while (++leftIndex < leftLength) {\r\n result[leftIndex] = partials[leftIndex];\r\n }\r\n while (++argsIndex < holdersLength) {\r\n if (isUncurried || argsIndex < argsLength) {\r\n result[holders[argsIndex]] = args[argsIndex];\r\n }\r\n }\r\n while (rangeLength--) {\r\n result[leftIndex++] = args[argsIndex++];\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * This function is like `composeArgs` except that the arguments composition\r\n * is tailored for `_.partialRight`.\r\n *\r\n * @private\r\n * @param {Array} args The provided arguments.\r\n * @param {Array} partials The arguments to append to those provided.\r\n * @param {Array} holders The `partials` placeholder indexes.\r\n * @params {boolean} [isCurried] Specify composing for a curried function.\r\n * @returns {Array} Returns the new array of composed arguments.\r\n */\r\n function composeArgsRight(args, partials, holders, isCurried) {\r\n var argsIndex = -1,\r\n argsLength = args.length,\r\n holdersIndex = -1,\r\n holdersLength = holders.length,\r\n rightIndex = -1,\r\n rightLength = partials.length,\r\n rangeLength = nativeMax(argsLength - holdersLength, 0),\r\n result = Array(rangeLength + rightLength),\r\n isUncurried = !isCurried;\r\n\r\n while (++argsIndex < rangeLength) {\r\n result[argsIndex] = args[argsIndex];\r\n }\r\n var offset = argsIndex;\r\n while (++rightIndex < rightLength) {\r\n result[offset + rightIndex] = partials[rightIndex];\r\n }\r\n while (++holdersIndex < holdersLength) {\r\n if (isUncurried || argsIndex < argsLength) {\r\n result[offset + holders[holdersIndex]] = args[argsIndex++];\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Copies the values of `source` to `array`.\r\n *\r\n * @private\r\n * @param {Array} source The array to copy values from.\r\n * @param {Array} [array=[]] The array to copy values to.\r\n * @returns {Array} Returns `array`.\r\n */\r\n function copyArray(source, array) {\r\n var index = -1,\r\n length = source.length;\r\n\r\n array || (array = Array(length));\r\n while (++index < length) {\r\n array[index] = source[index];\r\n }\r\n return array;\r\n }\r\n\r\n /**\r\n * Copies properties of `source` to `object`.\r\n *\r\n * @private\r\n * @param {Object} source The object to copy properties from.\r\n * @param {Array} props The property identifiers to copy.\r\n * @param {Object} [object={}] The object to copy properties to.\r\n * @param {Function} [customizer] The function to customize copied values.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function copyObject(source, props, object, customizer) {\r\n var isNew = !object;\r\n object || (object = {});\r\n\r\n var index = -1,\r\n length = props.length;\r\n\r\n while (++index < length) {\r\n var key = props[index];\r\n\r\n var newValue = customizer\r\n ? customizer(object[key], source[key], key, object, source)\r\n : undefined;\r\n\r\n if (newValue === undefined) {\r\n newValue = source[key];\r\n }\r\n if (isNew) {\r\n baseAssignValue(object, key, newValue);\r\n } else {\r\n assignValue(object, key, newValue);\r\n }\r\n }\r\n return object;\r\n }\r\n\r\n /**\r\n * Copies own symbols of `source` to `object`.\r\n *\r\n * @private\r\n * @param {Object} source The object to copy symbols from.\r\n * @param {Object} [object={}] The object to copy symbols to.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function copySymbols(source, object) {\r\n return copyObject(source, getSymbols(source), object);\r\n }\r\n\r\n /**\r\n * Copies own and inherited symbols of `source` to `object`.\r\n *\r\n * @private\r\n * @param {Object} source The object to copy symbols from.\r\n * @param {Object} [object={}] The object to copy symbols to.\r\n * @returns {Object} Returns `object`.\r\n */\r\n function copySymbolsIn(source, object) {\r\n return copyObject(source, getSymbolsIn(source), object);\r\n }\r\n\r\n /**\r\n * Creates a function like `_.groupBy`.\r\n *\r\n * @private\r\n * @param {Function} setter The function to set accumulator values.\r\n * @param {Function} [initializer] The accumulator object initializer.\r\n * @returns {Function} Returns the new aggregator function.\r\n */\r\n function createAggregator(setter, initializer) {\r\n return function(collection, iteratee) {\r\n var func = isArray(collection) ? arrayAggregator : baseAggregator,\r\n accumulator = initializer ? initializer() : {};\r\n\r\n return func(collection, setter, baseIteratee(iteratee, 2), accumulator);\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function like `_.assign`.\r\n *\r\n * @private\r\n * @param {Function} assigner The function to assign values.\r\n * @returns {Function} Returns the new assigner function.\r\n */\r\n function createAssigner(assigner) {\r\n return baseRest(function(object, sources) {\r\n var index = -1,\r\n length = sources.length,\r\n customizer = length > 1 ? sources[length - 1] : undefined,\r\n guard = length > 2 ? sources[2] : undefined;\r\n\r\n customizer = (assigner.length > 3 && typeof customizer == 'function')\r\n ? (length--, customizer)\r\n : undefined;\r\n\r\n if (guard && isIterateeCall(sources[0], sources[1], guard)) {\r\n customizer = length < 3 ? undefined : customizer;\r\n length = 1;\r\n }\r\n object = Object(object);\r\n while (++index < length) {\r\n var source = sources[index];\r\n if (source) {\r\n assigner(object, source, index, customizer);\r\n }\r\n }\r\n return object;\r\n });\r\n }\r\n\r\n /**\r\n * Creates a `baseEach` or `baseEachRight` function.\r\n *\r\n * @private\r\n * @param {Function} eachFunc The function to iterate over a collection.\r\n * @param {boolean} [fromRight] Specify iterating from right to left.\r\n * @returns {Function} Returns the new base function.\r\n */\r\n function createBaseEach(eachFunc, fromRight) {\r\n return function(collection, iteratee) {\r\n if (collection == null) {\r\n return collection;\r\n }\r\n if (!isArrayLike(collection)) {\r\n return eachFunc(collection, iteratee);\r\n }\r\n var length = collection.length,\r\n index = fromRight ? length : -1,\r\n iterable = Object(collection);\r\n\r\n while ((fromRight ? index-- : ++index < length)) {\r\n if (iteratee(iterable[index], index, iterable) === false) {\r\n break;\r\n }\r\n }\r\n return collection;\r\n };\r\n }\r\n\r\n /**\r\n * Creates a base function for methods like `_.forIn` and `_.forOwn`.\r\n *\r\n * @private\r\n * @param {boolean} [fromRight] Specify iterating from right to left.\r\n * @returns {Function} Returns the new base function.\r\n */\r\n function createBaseFor(fromRight) {\r\n return function(object, iteratee, keysFunc) {\r\n var index = -1,\r\n iterable = Object(object),\r\n props = keysFunc(object),\r\n length = props.length;\r\n\r\n while (length--) {\r\n var key = props[fromRight ? length : ++index];\r\n if (iteratee(iterable[key], key, iterable) === false) {\r\n break;\r\n }\r\n }\r\n return object;\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that wraps `func` to invoke it with the optional `this`\r\n * binding of `thisArg`.\r\n *\r\n * @private\r\n * @param {Function} func The function to wrap.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @param {*} [thisArg] The `this` binding of `func`.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createBind(func, bitmask, thisArg) {\r\n var isBind = bitmask & WRAP_BIND_FLAG,\r\n Ctor = createCtor(func);\r\n\r\n function wrapper() {\r\n var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\r\n return fn.apply(isBind ? thisArg : this, arguments);\r\n }\r\n return wrapper;\r\n }\r\n\r\n /**\r\n * Creates a function that produces an instance of `Ctor` regardless of\r\n * whether it was invoked as part of a `new` expression or by `call` or `apply`.\r\n *\r\n * @private\r\n * @param {Function} Ctor The constructor to wrap.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createCtor(Ctor) {\r\n return function() {\r\n // Use a `switch` statement to work with class constructors. See\r\n // http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist\r\n // for more details.\r\n var args = arguments;\r\n switch (args.length) {\r\n case 0: return new Ctor;\r\n case 1: return new Ctor(args[0]);\r\n case 2: return new Ctor(args[0], args[1]);\r\n case 3: return new Ctor(args[0], args[1], args[2]);\r\n case 4: return new Ctor(args[0], args[1], args[2], args[3]);\r\n case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]);\r\n case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]);\r\n case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);\r\n }\r\n var thisBinding = baseCreate(Ctor.prototype),\r\n result = Ctor.apply(thisBinding, args);\r\n\r\n // Mimic the constructor's `return` behavior.\r\n // See https://es5.github.io/#x13.2.2 for more details.\r\n return isObject(result) ? result : thisBinding;\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that wraps `func` to enable currying.\r\n *\r\n * @private\r\n * @param {Function} func The function to wrap.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @param {number} arity The arity of `func`.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createCurry(func, bitmask, arity) {\r\n var Ctor = createCtor(func);\r\n\r\n function wrapper() {\r\n var length = arguments.length,\r\n args = Array(length),\r\n index = length,\r\n placeholder = getHolder(wrapper);\r\n\r\n while (index--) {\r\n args[index] = arguments[index];\r\n }\r\n var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder)\r\n ? []\r\n : replaceHolders(args, placeholder);\r\n\r\n length -= holders.length;\r\n if (length < arity) {\r\n return createRecurry(\r\n func, bitmask, createHybrid, wrapper.placeholder, undefined,\r\n args, holders, undefined, undefined, arity - length);\r\n }\r\n var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\r\n return apply(fn, this, args);\r\n }\r\n return wrapper;\r\n }\r\n\r\n /**\r\n * Creates a `_.find` or `_.findLast` function.\r\n *\r\n * @private\r\n * @param {Function} findIndexFunc The function to find the collection index.\r\n * @returns {Function} Returns the new find function.\r\n */\r\n function createFind(findIndexFunc) {\r\n return function(collection, predicate, fromIndex) {\r\n var iterable = Object(collection);\r\n if (!isArrayLike(collection)) {\r\n var iteratee = baseIteratee(predicate, 3);\r\n collection = keys(collection);\r\n predicate = function(key) { return iteratee(iterable[key], key, iterable); };\r\n }\r\n var index = findIndexFunc(collection, predicate, fromIndex);\r\n return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined;\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that wraps `func` to invoke it with optional `this`\r\n * binding of `thisArg`, partial application, and currying.\r\n *\r\n * @private\r\n * @param {Function|string} func The function or method name to wrap.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @param {*} [thisArg] The `this` binding of `func`.\r\n * @param {Array} [partials] The arguments to prepend to those provided to\r\n * the new function.\r\n * @param {Array} [holders] The `partials` placeholder indexes.\r\n * @param {Array} [partialsRight] The arguments to append to those provided\r\n * to the new function.\r\n * @param {Array} [holdersRight] The `partialsRight` placeholder indexes.\r\n * @param {Array} [argPos] The argument positions of the new function.\r\n * @param {number} [ary] The arity cap of `func`.\r\n * @param {number} [arity] The arity of `func`.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) {\r\n var isAry = bitmask & WRAP_ARY_FLAG,\r\n isBind = bitmask & WRAP_BIND_FLAG,\r\n isBindKey = bitmask & WRAP_BIND_KEY_FLAG,\r\n isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG),\r\n isFlip = bitmask & WRAP_FLIP_FLAG,\r\n Ctor = isBindKey ? undefined : createCtor(func);\r\n\r\n function wrapper() {\r\n var length = arguments.length,\r\n args = Array(length),\r\n index = length;\r\n\r\n while (index--) {\r\n args[index] = arguments[index];\r\n }\r\n if (isCurried) {\r\n var placeholder = getHolder(wrapper),\r\n holdersCount = countHolders(args, placeholder);\r\n }\r\n if (partials) {\r\n args = composeArgs(args, partials, holders, isCurried);\r\n }\r\n if (partialsRight) {\r\n args = composeArgsRight(args, partialsRight, holdersRight, isCurried);\r\n }\r\n length -= holdersCount;\r\n if (isCurried && length < arity) {\r\n var newHolders = replaceHolders(args, placeholder);\r\n return createRecurry(\r\n func, bitmask, createHybrid, wrapper.placeholder, thisArg,\r\n args, newHolders, argPos, ary, arity - length\r\n );\r\n }\r\n var thisBinding = isBind ? thisArg : this,\r\n fn = isBindKey ? thisBinding[func] : func;\r\n\r\n length = args.length;\r\n if (argPos) {\r\n args = reorder(args, argPos);\r\n } else if (isFlip && length > 1) {\r\n args.reverse();\r\n }\r\n if (isAry && ary < length) {\r\n args.length = ary;\r\n }\r\n if (this && this !== root && this instanceof wrapper) {\r\n fn = Ctor || createCtor(fn);\r\n }\r\n return fn.apply(thisBinding, args);\r\n }\r\n return wrapper;\r\n }\r\n\r\n /**\r\n * Creates a function like `_.invertBy`.\r\n *\r\n * @private\r\n * @param {Function} setter The function to set accumulator values.\r\n * @param {Function} toIteratee The function to resolve iteratees.\r\n * @returns {Function} Returns the new inverter function.\r\n */\r\n function createInverter(setter, toIteratee) {\r\n return function(object, iteratee) {\r\n return baseInverter(object, setter, toIteratee(iteratee), {});\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that wraps `func` to invoke it with the `this` binding\r\n * of `thisArg` and `partials` prepended to the arguments it receives.\r\n *\r\n * @private\r\n * @param {Function} func The function to wrap.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @param {*} thisArg The `this` binding of `func`.\r\n * @param {Array} partials The arguments to prepend to those provided to\r\n * the new function.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createPartial(func, bitmask, thisArg, partials) {\r\n var isBind = bitmask & WRAP_BIND_FLAG,\r\n Ctor = createCtor(func);\r\n\r\n function wrapper() {\r\n var argsIndex = -1,\r\n argsLength = arguments.length,\r\n leftIndex = -1,\r\n leftLength = partials.length,\r\n args = Array(leftLength + argsLength),\r\n fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\r\n\r\n while (++leftIndex < leftLength) {\r\n args[leftIndex] = partials[leftIndex];\r\n }\r\n while (argsLength--) {\r\n args[leftIndex++] = arguments[++argsIndex];\r\n }\r\n return apply(fn, isBind ? thisArg : this, args);\r\n }\r\n return wrapper;\r\n }\r\n\r\n /**\r\n * Creates a `_.range` or `_.rangeRight` function.\r\n *\r\n * @private\r\n * @param {boolean} [fromRight] Specify iterating from right to left.\r\n * @returns {Function} Returns the new range function.\r\n */\r\n function createRange(fromRight) {\r\n return function(start, end, step) {\r\n if (step && typeof step != 'number' && isIterateeCall(start, end, step)) {\r\n end = step = undefined;\r\n }\r\n // Ensure the sign of `-0` is preserved.\r\n start = toFinite(start);\r\n if (end === undefined) {\r\n end = start;\r\n start = 0;\r\n } else {\r\n end = toFinite(end);\r\n }\r\n step = step === undefined ? (start < end ? 1 : -1) : toFinite(step);\r\n return baseRange(start, end, step, fromRight);\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that wraps `func` to continue currying.\r\n *\r\n * @private\r\n * @param {Function} func The function to wrap.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @param {Function} wrapFunc The function to create the `func` wrapper.\r\n * @param {*} placeholder The placeholder value.\r\n * @param {*} [thisArg] The `this` binding of `func`.\r\n * @param {Array} [partials] The arguments to prepend to those provided to\r\n * the new function.\r\n * @param {Array} [holders] The `partials` placeholder indexes.\r\n * @param {Array} [argPos] The argument positions of the new function.\r\n * @param {number} [ary] The arity cap of `func`.\r\n * @param {number} [arity] The arity of `func`.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) {\r\n var isCurry = bitmask & WRAP_CURRY_FLAG,\r\n newHolders = isCurry ? holders : undefined,\r\n newHoldersRight = isCurry ? undefined : holders,\r\n newPartials = isCurry ? partials : undefined,\r\n newPartialsRight = isCurry ? undefined : partials;\r\n\r\n bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG);\r\n bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG);\r\n\r\n if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) {\r\n bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG);\r\n }\r\n var newData = [\r\n func, bitmask, thisArg, newPartials, newHolders, newPartialsRight,\r\n newHoldersRight, argPos, ary, arity\r\n ];\r\n\r\n var result = wrapFunc.apply(undefined, newData);\r\n if (isLaziable(func)) {\r\n setData(result, newData);\r\n }\r\n result.placeholder = placeholder;\r\n return setWrapToString(result, func, bitmask);\r\n }\r\n\r\n /**\r\n * Creates a set object of `values`.\r\n *\r\n * @private\r\n * @param {Array} values The values to add to the set.\r\n * @returns {Object} Returns the new set.\r\n */\r\n var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) {\r\n return new Set(values);\r\n };\r\n\r\n /**\r\n * Creates a function that either curries or invokes `func` with optional\r\n * `this` binding and partially applied arguments.\r\n *\r\n * @private\r\n * @param {Function|string} func The function or method name to wrap.\r\n * @param {number} bitmask The bitmask flags.\r\n * 1 - `_.bind`\r\n * 2 - `_.bindKey`\r\n * 4 - `_.curry` or `_.curryRight` of a bound function\r\n * 8 - `_.curry`\r\n * 16 - `_.curryRight`\r\n * 32 - `_.partial`\r\n * 64 - `_.partialRight`\r\n * 128 - `_.rearg`\r\n * 256 - `_.ary`\r\n * 512 - `_.flip`\r\n * @param {*} [thisArg] The `this` binding of `func`.\r\n * @param {Array} [partials] The arguments to be partially applied.\r\n * @param {Array} [holders] The `partials` placeholder indexes.\r\n * @param {Array} [argPos] The argument positions of the new function.\r\n * @param {number} [ary] The arity cap of `func`.\r\n * @param {number} [arity] The arity of `func`.\r\n * @returns {Function} Returns the new wrapped function.\r\n */\r\n function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) {\r\n var isBindKey = bitmask & WRAP_BIND_KEY_FLAG;\r\n if (!isBindKey && typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n var length = partials ? partials.length : 0;\r\n if (!length) {\r\n bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG);\r\n partials = holders = undefined;\r\n }\r\n ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0);\r\n arity = arity === undefined ? arity : toInteger(arity);\r\n length -= holders ? holders.length : 0;\r\n\r\n if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) {\r\n var partialsRight = partials,\r\n holdersRight = holders;\r\n\r\n partials = holders = undefined;\r\n }\r\n var data = isBindKey ? undefined : getData(func);\r\n\r\n var newData = [\r\n func, bitmask, thisArg, partials, holders, partialsRight, holdersRight,\r\n argPos, ary, arity\r\n ];\r\n\r\n if (data) {\r\n mergeData(newData, data);\r\n }\r\n func = newData[0];\r\n bitmask = newData[1];\r\n thisArg = newData[2];\r\n partials = newData[3];\r\n holders = newData[4];\r\n arity = newData[9] = newData[9] === undefined\r\n ? (isBindKey ? 0 : func.length)\r\n : nativeMax(newData[9] - length, 0);\r\n\r\n if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) {\r\n bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG);\r\n }\r\n if (!bitmask || bitmask == WRAP_BIND_FLAG) {\r\n var result = createBind(func, bitmask, thisArg);\r\n } else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) {\r\n result = createCurry(func, bitmask, arity);\r\n } else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) {\r\n result = createPartial(func, bitmask, thisArg, partials);\r\n } else {\r\n result = createHybrid.apply(undefined, newData);\r\n }\r\n var setter = data ? baseSetData : setData;\r\n return setWrapToString(setter(result, newData), func, bitmask);\r\n }\r\n\r\n /**\r\n * Used by `_.defaultsDeep` to customize its `_.merge` use to merge source\r\n * objects into destination objects that are passed thru.\r\n *\r\n * @private\r\n * @param {*} objValue The destination value.\r\n * @param {*} srcValue The source value.\r\n * @param {string} key The key of the property to merge.\r\n * @param {Object} object The parent object of `objValue`.\r\n * @param {Object} source The parent object of `srcValue`.\r\n * @param {Object} [stack] Tracks traversed source values and their merged\r\n * counterparts.\r\n * @returns {*} Returns the value to assign.\r\n */\r\n function customDefaultsMerge(objValue, srcValue, key, object, source, stack) {\r\n if (isObject(objValue) && isObject(srcValue)) {\r\n // Recursively merge objects and arrays (susceptible to call stack limits).\r\n stack.set(srcValue, objValue);\r\n baseMerge(objValue, srcValue, undefined, customDefaultsMerge, stack);\r\n stack['delete'](srcValue);\r\n }\r\n return objValue;\r\n }\r\n\r\n /**\r\n * Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain\r\n * objects.\r\n *\r\n * @private\r\n * @param {*} value The value to inspect.\r\n * @param {string} key The key of the property to inspect.\r\n * @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`.\r\n */\r\n function customOmitClone(value) {\r\n return isPlainObject(value) ? undefined : value;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseIsEqualDeep` for arrays with support for\r\n * partial deep comparisons.\r\n *\r\n * @private\r\n * @param {Array} array The array to compare.\r\n * @param {Array} other The other array to compare.\r\n * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\r\n * @param {Function} customizer The function to customize comparisons.\r\n * @param {Function} equalFunc The function to determine equivalents of values.\r\n * @param {Object} stack Tracks traversed `array` and `other` objects.\r\n * @returns {boolean} Returns `true` if the arrays are equivalent, else `false`.\r\n */\r\n function equalArrays(array, other, bitmask, customizer, equalFunc, stack) {\r\n var isPartial = bitmask & COMPARE_PARTIAL_FLAG,\r\n arrLength = array.length,\r\n othLength = other.length;\r\n\r\n if (arrLength != othLength && !(isPartial && othLength > arrLength)) {\r\n return false;\r\n }\r\n // Assume cyclic values are equal.\r\n var stacked = stack.get(array);\r\n if (stacked && stack.get(other)) {\r\n return stacked == other;\r\n }\r\n var index = -1,\r\n result = true,\r\n seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined;\r\n\r\n stack.set(array, other);\r\n stack.set(other, array);\r\n\r\n // Ignore non-index properties.\r\n while (++index < arrLength) {\r\n var arrValue = array[index],\r\n othValue = other[index];\r\n\r\n if (customizer) {\r\n var compared = isPartial\r\n ? customizer(othValue, arrValue, index, other, array, stack)\r\n : customizer(arrValue, othValue, index, array, other, stack);\r\n }\r\n if (compared !== undefined) {\r\n if (compared) {\r\n continue;\r\n }\r\n result = false;\r\n break;\r\n }\r\n // Recursively compare arrays (susceptible to call stack limits).\r\n if (seen) {\r\n if (!arraySome(other, function(othValue, othIndex) {\r\n if (!cacheHas(seen, othIndex) &&\r\n (arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) {\r\n return seen.push(othIndex);\r\n }\r\n })) {\r\n result = false;\r\n break;\r\n }\r\n } else if (!(\r\n arrValue === othValue ||\r\n equalFunc(arrValue, othValue, bitmask, customizer, stack)\r\n )) {\r\n result = false;\r\n break;\r\n }\r\n }\r\n stack['delete'](array);\r\n stack['delete'](other);\r\n return result;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseIsEqualDeep` for comparing objects of\r\n * the same `toStringTag`.\r\n *\r\n * **Note:** This function only supports comparing values with tags of\r\n * `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`.\r\n *\r\n * @private\r\n * @param {Object} object The object to compare.\r\n * @param {Object} other The other object to compare.\r\n * @param {string} tag The `toStringTag` of the objects to compare.\r\n * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\r\n * @param {Function} customizer The function to customize comparisons.\r\n * @param {Function} equalFunc The function to determine equivalents of values.\r\n * @param {Object} stack Tracks traversed `object` and `other` objects.\r\n * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\r\n */\r\n function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) {\r\n switch (tag) {\r\n case dataViewTag:\r\n if ((object.byteLength != other.byteLength) ||\r\n (object.byteOffset != other.byteOffset)) {\r\n return false;\r\n }\r\n object = object.buffer;\r\n other = other.buffer;\r\n\r\n case arrayBufferTag:\r\n if ((object.byteLength != other.byteLength) ||\r\n !equalFunc(new Uint8Array(object), new Uint8Array(other))) {\r\n return false;\r\n }\r\n return true;\r\n\r\n case boolTag:\r\n case dateTag:\r\n case numberTag:\r\n // Coerce booleans to `1` or `0` and dates to milliseconds.\r\n // Invalid dates are coerced to `NaN`.\r\n return eq(+object, +other);\r\n\r\n case errorTag:\r\n return object.name == other.name && object.message == other.message;\r\n\r\n case regexpTag:\r\n case stringTag:\r\n // Coerce regexes to strings and treat strings, primitives and objects,\r\n // as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring\r\n // for more details.\r\n return object == (other + '');\r\n\r\n case mapTag:\r\n var convert = mapToArray;\r\n\r\n case setTag:\r\n var isPartial = bitmask & COMPARE_PARTIAL_FLAG;\r\n convert || (convert = setToArray);\r\n\r\n if (object.size != other.size && !isPartial) {\r\n return false;\r\n }\r\n // Assume cyclic values are equal.\r\n var stacked = stack.get(object);\r\n if (stacked) {\r\n return stacked == other;\r\n }\r\n bitmask |= COMPARE_UNORDERED_FLAG;\r\n\r\n // Recursively compare objects (susceptible to call stack limits).\r\n stack.set(object, other);\r\n var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack);\r\n stack['delete'](object);\r\n return result;\r\n\r\n case symbolTag:\r\n if (symbolValueOf) {\r\n return symbolValueOf.call(object) == symbolValueOf.call(other);\r\n }\r\n }\r\n return false;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseIsEqualDeep` for objects with support for\r\n * partial deep comparisons.\r\n *\r\n * @private\r\n * @param {Object} object The object to compare.\r\n * @param {Object} other The other object to compare.\r\n * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\r\n * @param {Function} customizer The function to customize comparisons.\r\n * @param {Function} equalFunc The function to determine equivalents of values.\r\n * @param {Object} stack Tracks traversed `object` and `other` objects.\r\n * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\r\n */\r\n function equalObjects(object, other, bitmask, customizer, equalFunc, stack) {\r\n var isPartial = bitmask & COMPARE_PARTIAL_FLAG,\r\n objProps = getAllKeys(object),\r\n objLength = objProps.length,\r\n othProps = getAllKeys(other),\r\n othLength = othProps.length;\r\n\r\n if (objLength != othLength && !isPartial) {\r\n return false;\r\n }\r\n var index = objLength;\r\n while (index--) {\r\n var key = objProps[index];\r\n if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) {\r\n return false;\r\n }\r\n }\r\n // Assume cyclic values are equal.\r\n var stacked = stack.get(object);\r\n if (stacked && stack.get(other)) {\r\n return stacked == other;\r\n }\r\n var result = true;\r\n stack.set(object, other);\r\n stack.set(other, object);\r\n\r\n var skipCtor = isPartial;\r\n while (++index < objLength) {\r\n key = objProps[index];\r\n var objValue = object[key],\r\n othValue = other[key];\r\n\r\n if (customizer) {\r\n var compared = isPartial\r\n ? customizer(othValue, objValue, key, other, object, stack)\r\n : customizer(objValue, othValue, key, object, other, stack);\r\n }\r\n // Recursively compare objects (susceptible to call stack limits).\r\n if (!(compared === undefined\r\n ? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack))\r\n : compared\r\n )) {\r\n result = false;\r\n break;\r\n }\r\n skipCtor || (skipCtor = key == 'constructor');\r\n }\r\n if (result && !skipCtor) {\r\n var objCtor = object.constructor,\r\n othCtor = other.constructor;\r\n\r\n // Non `Object` object instances with different constructors are not equal.\r\n if (objCtor != othCtor &&\r\n ('constructor' in object && 'constructor' in other) &&\r\n !(typeof objCtor == 'function' && objCtor instanceof objCtor &&\r\n typeof othCtor == 'function' && othCtor instanceof othCtor)) {\r\n result = false;\r\n }\r\n }\r\n stack['delete'](object);\r\n stack['delete'](other);\r\n return result;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseRest` which flattens the rest array.\r\n *\r\n * @private\r\n * @param {Function} func The function to apply a rest parameter to.\r\n * @returns {Function} Returns the new function.\r\n */\r\n function flatRest(func) {\r\n return setToString(overRest(func, undefined, flatten), func + '');\r\n }\r\n\r\n /**\r\n * Creates an array of own enumerable property names and symbols of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names and symbols.\r\n */\r\n function getAllKeys(object) {\r\n return baseGetAllKeys(object, keys, getSymbols);\r\n }\r\n\r\n /**\r\n * Creates an array of own and inherited enumerable property names and\r\n * symbols of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names and symbols.\r\n */\r\n function getAllKeysIn(object) {\r\n return baseGetAllKeys(object, keysIn, getSymbolsIn);\r\n }\r\n\r\n /**\r\n * Gets metadata for `func`.\r\n *\r\n * @private\r\n * @param {Function} func The function to query.\r\n * @returns {*} Returns the metadata for `func`.\r\n */\r\n var getData = !metaMap ? noop : function(func) {\r\n return metaMap.get(func);\r\n };\r\n\r\n /**\r\n * Gets the name of `func`.\r\n *\r\n * @private\r\n * @param {Function} func The function to query.\r\n * @returns {string} Returns the function name.\r\n */\r\n function getFuncName(func) {\r\n var result = (func.name + ''),\r\n array = realNames[result],\r\n length = hasOwnProperty.call(realNames, result) ? array.length : 0;\r\n\r\n while (length--) {\r\n var data = array[length],\r\n otherFunc = data.func;\r\n if (otherFunc == null || otherFunc == func) {\r\n return data.name;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the argument placeholder value for `func`.\r\n *\r\n * @private\r\n * @param {Function} func The function to inspect.\r\n * @returns {*} Returns the placeholder value.\r\n */\r\n function getHolder(func) {\r\n var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func;\r\n return object.placeholder;\r\n }\r\n\r\n /**\r\n * Gets the data for `map`.\r\n *\r\n * @private\r\n * @param {Object} map The map to query.\r\n * @param {string} key The reference key.\r\n * @returns {*} Returns the map data.\r\n */\r\n function getMapData(map, key) {\r\n var data = map.__data__;\r\n return isKeyable(key)\r\n ? data[typeof key == 'string' ? 'string' : 'hash']\r\n : data.map;\r\n }\r\n\r\n /**\r\n * Gets the property names, values, and compare flags of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the match data of `object`.\r\n */\r\n function getMatchData(object) {\r\n var result = keys(object),\r\n length = result.length;\r\n\r\n while (length--) {\r\n var key = result[length],\r\n value = object[key];\r\n\r\n result[length] = [key, value, isStrictComparable(value)];\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Gets the native function at `key` of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {string} key The key of the method to get.\r\n * @returns {*} Returns the function if it's native, else `undefined`.\r\n */\r\n function getNative(object, key) {\r\n var value = getValue(object, key);\r\n return baseIsNative(value) ? value : undefined;\r\n }\r\n\r\n /**\r\n * A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values.\r\n *\r\n * @private\r\n * @param {*} value The value to query.\r\n * @returns {string} Returns the raw `toStringTag`.\r\n */\r\n function getRawTag(value) {\r\n var isOwn = hasOwnProperty.call(value, symToStringTag),\r\n tag = value[symToStringTag];\r\n\r\n try {\r\n value[symToStringTag] = undefined;\r\n var unmasked = true;\r\n } catch (e) {}\r\n\r\n var result = nativeObjectToString.call(value);\r\n if (unmasked) {\r\n if (isOwn) {\r\n value[symToStringTag] = tag;\r\n } else {\r\n delete value[symToStringTag];\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates an array of the own enumerable symbols of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of symbols.\r\n */\r\n var getSymbols = !nativeGetSymbols ? stubArray : function(object) {\r\n if (object == null) {\r\n return [];\r\n }\r\n object = Object(object);\r\n return arrayFilter(nativeGetSymbols(object), function(symbol) {\r\n return propertyIsEnumerable.call(object, symbol);\r\n });\r\n };\r\n\r\n /**\r\n * Creates an array of the own and inherited enumerable symbols of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of symbols.\r\n */\r\n var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) {\r\n var result = [];\r\n while (object) {\r\n arrayPush(result, getSymbols(object));\r\n object = getPrototype(object);\r\n }\r\n return result;\r\n };\r\n\r\n /**\r\n * Gets the `toStringTag` of `value`.\r\n *\r\n * @private\r\n * @param {*} value The value to query.\r\n * @returns {string} Returns the `toStringTag`.\r\n */\r\n var getTag = baseGetTag;\r\n\r\n // Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6.\r\n if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) ||\r\n (Map && getTag(new Map) != mapTag) ||\r\n (Promise && getTag(Promise.resolve()) != promiseTag) ||\r\n (Set && getTag(new Set) != setTag) ||\r\n (WeakMap && getTag(new WeakMap) != weakMapTag)) {\r\n getTag = function(value) {\r\n var result = baseGetTag(value),\r\n Ctor = result == objectTag ? value.constructor : undefined,\r\n ctorString = Ctor ? toSource(Ctor) : '';\r\n\r\n if (ctorString) {\r\n switch (ctorString) {\r\n case dataViewCtorString: return dataViewTag;\r\n case mapCtorString: return mapTag;\r\n case promiseCtorString: return promiseTag;\r\n case setCtorString: return setTag;\r\n case weakMapCtorString: return weakMapTag;\r\n }\r\n }\r\n return result;\r\n };\r\n }\r\n\r\n /**\r\n * Gets the view, applying any `transforms` to the `start` and `end` positions.\r\n *\r\n * @private\r\n * @param {number} start The start of the view.\r\n * @param {number} end The end of the view.\r\n * @param {Array} transforms The transformations to apply to the view.\r\n * @returns {Object} Returns an object containing the `start` and `end`\r\n * positions of the view.\r\n */\r\n function getView(start, end, transforms) {\r\n var index = -1,\r\n length = transforms.length;\r\n\r\n while (++index < length) {\r\n var data = transforms[index],\r\n size = data.size;\r\n\r\n switch (data.type) {\r\n case 'drop': start += size; break;\r\n case 'dropRight': end -= size; break;\r\n case 'take': end = nativeMin(end, start + size); break;\r\n case 'takeRight': start = nativeMax(start, end - size); break;\r\n }\r\n }\r\n return { 'start': start, 'end': end };\r\n }\r\n\r\n /**\r\n * Extracts wrapper details from the `source` body comment.\r\n *\r\n * @private\r\n * @param {string} source The source to inspect.\r\n * @returns {Array} Returns the wrapper details.\r\n */\r\n function getWrapDetails(source) {\r\n var match = source.match(reWrapDetails);\r\n return match ? match[1].split(reSplitDetails) : [];\r\n }\r\n\r\n /**\r\n * Checks if `path` exists on `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path to check.\r\n * @param {Function} hasFunc The function to check properties.\r\n * @returns {boolean} Returns `true` if `path` exists, else `false`.\r\n */\r\n function hasPath(object, path, hasFunc) {\r\n path = castPath(path, object);\r\n\r\n var index = -1,\r\n length = path.length,\r\n result = false;\r\n\r\n while (++index < length) {\r\n var key = toKey(path[index]);\r\n if (!(result = object != null && hasFunc(object, key))) {\r\n break;\r\n }\r\n object = object[key];\r\n }\r\n if (result || ++index != length) {\r\n return result;\r\n }\r\n length = object == null ? 0 : object.length;\r\n return !!length && isLength(length) && isIndex(key, length) &&\r\n (isArray(object) || isArguments(object));\r\n }\r\n\r\n /**\r\n * Initializes an array clone.\r\n *\r\n * @private\r\n * @param {Array} array The array to clone.\r\n * @returns {Array} Returns the initialized clone.\r\n */\r\n function initCloneArray(array) {\r\n var length = array.length,\r\n result = new array.constructor(length);\r\n\r\n // Add properties assigned by `RegExp#exec`.\r\n if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) {\r\n result.index = array.index;\r\n result.input = array.input;\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Initializes an object clone.\r\n *\r\n * @private\r\n * @param {Object} object The object to clone.\r\n * @returns {Object} Returns the initialized clone.\r\n */\r\n function initCloneObject(object) {\r\n return (typeof object.constructor == 'function' && !isPrototype(object))\r\n ? baseCreate(getPrototype(object))\r\n : {};\r\n }\r\n\r\n /**\r\n * Initializes an object clone based on its `toStringTag`.\r\n *\r\n * **Note:** This function only supports cloning values with tags of\r\n * `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`.\r\n *\r\n * @private\r\n * @param {Object} object The object to clone.\r\n * @param {string} tag The `toStringTag` of the object to clone.\r\n * @param {boolean} [isDeep] Specify a deep clone.\r\n * @returns {Object} Returns the initialized clone.\r\n */\r\n function initCloneByTag(object, tag, isDeep) {\r\n var Ctor = object.constructor;\r\n switch (tag) {\r\n case arrayBufferTag:\r\n return cloneArrayBuffer(object);\r\n\r\n case boolTag:\r\n case dateTag:\r\n return new Ctor(+object);\r\n\r\n case dataViewTag:\r\n return cloneDataView(object, isDeep);\r\n\r\n case float32Tag: case float64Tag:\r\n case int8Tag: case int16Tag: case int32Tag:\r\n case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag:\r\n return cloneTypedArray(object, isDeep);\r\n\r\n case mapTag:\r\n return new Ctor;\r\n\r\n case numberTag:\r\n case stringTag:\r\n return new Ctor(object);\r\n\r\n case regexpTag:\r\n return cloneRegExp(object);\r\n\r\n case setTag:\r\n return new Ctor;\r\n\r\n case symbolTag:\r\n return cloneSymbol(object);\r\n }\r\n }\r\n\r\n /**\r\n * Inserts wrapper `details` in a comment at the top of the `source` body.\r\n *\r\n * @private\r\n * @param {string} source The source to modify.\r\n * @returns {Array} details The details to insert.\r\n * @returns {string} Returns the modified source.\r\n */\r\n function insertWrapDetails(source, details) {\r\n var length = details.length;\r\n if (!length) {\r\n return source;\r\n }\r\n var lastIndex = length - 1;\r\n details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex];\r\n details = details.join(length > 2 ? ', ' : ' ');\r\n return source.replace(reWrapComment, '{\\n/* [wrapped with ' + details + '] */\\n');\r\n }\r\n\r\n /**\r\n * Checks if `value` is a flattenable `arguments` object or array.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is flattenable, else `false`.\r\n */\r\n function isFlattenable(value) {\r\n return isArray(value) || isArguments(value) ||\r\n !!(spreadableSymbol && value && value[spreadableSymbol]);\r\n }\r\n\r\n /**\r\n * Checks if `value` is a valid array-like index.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index.\r\n * @returns {boolean} Returns `true` if `value` is a valid index, else `false`.\r\n */\r\n function isIndex(value, length) {\r\n var type = typeof value;\r\n length = length == null ? MAX_SAFE_INTEGER : length;\r\n\r\n return !!length &&\r\n (type == 'number' ||\r\n (type != 'symbol' && reIsUint.test(value))) &&\r\n (value > -1 && value % 1 == 0 && value < length);\r\n }\r\n\r\n /**\r\n * Checks if the given arguments are from an iteratee call.\r\n *\r\n * @private\r\n * @param {*} value The potential iteratee value argument.\r\n * @param {*} index The potential iteratee index or key argument.\r\n * @param {*} object The potential iteratee object argument.\r\n * @returns {boolean} Returns `true` if the arguments are from an iteratee call,\r\n * else `false`.\r\n */\r\n function isIterateeCall(value, index, object) {\r\n if (!isObject(object)) {\r\n return false;\r\n }\r\n var type = typeof index;\r\n if (type == 'number'\r\n ? (isArrayLike(object) && isIndex(index, object.length))\r\n : (type == 'string' && index in object)\r\n ) {\r\n return eq(object[index], value);\r\n }\r\n return false;\r\n }\r\n\r\n /**\r\n * Checks if `value` is a property name and not a property path.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @param {Object} [object] The object to query keys on.\r\n * @returns {boolean} Returns `true` if `value` is a property name, else `false`.\r\n */\r\n function isKey(value, object) {\r\n if (isArray(value)) {\r\n return false;\r\n }\r\n var type = typeof value;\r\n if (type == 'number' || type == 'symbol' || type == 'boolean' ||\r\n value == null || isSymbol(value)) {\r\n return true;\r\n }\r\n return reIsPlainProp.test(value) || !reIsDeepProp.test(value) ||\r\n (object != null && value in Object(object));\r\n }\r\n\r\n /**\r\n * Checks if `value` is suitable for use as unique object key.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is suitable, else `false`.\r\n */\r\n function isKeyable(value) {\r\n var type = typeof value;\r\n return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean')\r\n ? (value !== '__proto__')\r\n : (value === null);\r\n }\r\n\r\n /**\r\n * Checks if `func` has a lazy counterpart.\r\n *\r\n * @private\r\n * @param {Function} func The function to check.\r\n * @returns {boolean} Returns `true` if `func` has a lazy counterpart,\r\n * else `false`.\r\n */\r\n function isLaziable(func) {\r\n var funcName = getFuncName(func),\r\n other = lodash[funcName];\r\n\r\n if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) {\r\n return false;\r\n }\r\n if (func === other) {\r\n return true;\r\n }\r\n var data = getData(other);\r\n return !!data && func === data[0];\r\n }\r\n\r\n /**\r\n * Checks if `func` has its source masked.\r\n *\r\n * @private\r\n * @param {Function} func The function to check.\r\n * @returns {boolean} Returns `true` if `func` is masked, else `false`.\r\n */\r\n function isMasked(func) {\r\n return !!maskSrcKey && (maskSrcKey in func);\r\n }\r\n\r\n /**\r\n * Checks if `value` is likely a prototype object.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a prototype, else `false`.\r\n */\r\n function isPrototype(value) {\r\n var Ctor = value && value.constructor,\r\n proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto;\r\n\r\n return value === proto;\r\n }\r\n\r\n /**\r\n * Checks if `value` is suitable for strict equality comparisons, i.e. `===`.\r\n *\r\n * @private\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` if suitable for strict\r\n * equality comparisons, else `false`.\r\n */\r\n function isStrictComparable(value) {\r\n return value === value && !isObject(value);\r\n }\r\n\r\n /**\r\n * A specialized version of `matchesProperty` for source values suitable\r\n * for strict equality comparisons, i.e. `===`.\r\n *\r\n * @private\r\n * @param {string} key The key of the property to get.\r\n * @param {*} srcValue The value to match.\r\n * @returns {Function} Returns the new spec function.\r\n */\r\n function matchesStrictComparable(key, srcValue) {\r\n return function(object) {\r\n if (object == null) {\r\n return false;\r\n }\r\n return object[key] === srcValue &&\r\n (srcValue !== undefined || (key in Object(object)));\r\n };\r\n }\r\n\r\n /**\r\n * A specialized version of `_.memoize` which clears the memoized function's\r\n * cache when it exceeds `MAX_MEMOIZE_SIZE`.\r\n *\r\n * @private\r\n * @param {Function} func The function to have its output memoized.\r\n * @returns {Function} Returns the new memoized function.\r\n */\r\n function memoizeCapped(func) {\r\n var result = memoize(func, function(key) {\r\n if (cache.size === MAX_MEMOIZE_SIZE) {\r\n cache.clear();\r\n }\r\n return key;\r\n });\r\n\r\n var cache = result.cache;\r\n return result;\r\n }\r\n\r\n /**\r\n * Merges the function metadata of `source` into `data`.\r\n *\r\n * Merging metadata reduces the number of wrappers used to invoke a function.\r\n * This is possible because methods like `_.bind`, `_.curry`, and `_.partial`\r\n * may be applied regardless of execution order. Methods like `_.ary` and\r\n * `_.rearg` modify function arguments, making the order in which they are\r\n * executed important, preventing the merging of metadata. However, we make\r\n * an exception for a safe combined case where curried functions have `_.ary`\r\n * and or `_.rearg` applied.\r\n *\r\n * @private\r\n * @param {Array} data The destination metadata.\r\n * @param {Array} source The source metadata.\r\n * @returns {Array} Returns `data`.\r\n */\r\n function mergeData(data, source) {\r\n var bitmask = data[1],\r\n srcBitmask = source[1],\r\n newBitmask = bitmask | srcBitmask,\r\n isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG);\r\n\r\n var isCombo =\r\n ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) ||\r\n ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) ||\r\n ((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG));\r\n\r\n // Exit early if metadata can't be merged.\r\n if (!(isCommon || isCombo)) {\r\n return data;\r\n }\r\n // Use source `thisArg` if available.\r\n if (srcBitmask & WRAP_BIND_FLAG) {\r\n data[2] = source[2];\r\n // Set when currying a bound function.\r\n newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG;\r\n }\r\n // Compose partial arguments.\r\n var value = source[3];\r\n if (value) {\r\n var partials = data[3];\r\n data[3] = partials ? composeArgs(partials, value, source[4]) : value;\r\n data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4];\r\n }\r\n // Compose partial right arguments.\r\n value = source[5];\r\n if (value) {\r\n partials = data[5];\r\n data[5] = partials ? composeArgsRight(partials, value, source[6]) : value;\r\n data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6];\r\n }\r\n // Use source `argPos` if available.\r\n value = source[7];\r\n if (value) {\r\n data[7] = value;\r\n }\r\n // Use source `ary` if it's smaller.\r\n if (srcBitmask & WRAP_ARY_FLAG) {\r\n data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]);\r\n }\r\n // Use source `arity` if one is not provided.\r\n if (data[9] == null) {\r\n data[9] = source[9];\r\n }\r\n // Use source `func` and merge bitmasks.\r\n data[0] = source[0];\r\n data[1] = newBitmask;\r\n\r\n return data;\r\n }\r\n\r\n /**\r\n * This function is like\r\n * [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)\r\n * except that it includes inherited enumerable properties.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names.\r\n */\r\n function nativeKeysIn(object) {\r\n var result = [];\r\n if (object != null) {\r\n for (var key in Object(object)) {\r\n result.push(key);\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Converts `value` to a string using `Object.prototype.toString`.\r\n *\r\n * @private\r\n * @param {*} value The value to convert.\r\n * @returns {string} Returns the converted string.\r\n */\r\n function objectToString(value) {\r\n return nativeObjectToString.call(value);\r\n }\r\n\r\n /**\r\n * A specialized version of `baseRest` which transforms the rest array.\r\n *\r\n * @private\r\n * @param {Function} func The function to apply a rest parameter to.\r\n * @param {number} [start=func.length-1] The start position of the rest parameter.\r\n * @param {Function} transform The rest array transform.\r\n * @returns {Function} Returns the new function.\r\n */\r\n function overRest(func, start, transform) {\r\n start = nativeMax(start === undefined ? (func.length - 1) : start, 0);\r\n return function() {\r\n var args = arguments,\r\n index = -1,\r\n length = nativeMax(args.length - start, 0),\r\n array = Array(length);\r\n\r\n while (++index < length) {\r\n array[index] = args[start + index];\r\n }\r\n index = -1;\r\n var otherArgs = Array(start + 1);\r\n while (++index < start) {\r\n otherArgs[index] = args[index];\r\n }\r\n otherArgs[start] = transform(array);\r\n return apply(func, this, otherArgs);\r\n };\r\n }\r\n\r\n /**\r\n * Gets the parent value at `path` of `object`.\r\n *\r\n * @private\r\n * @param {Object} object The object to query.\r\n * @param {Array} path The path to get the parent value of.\r\n * @returns {*} Returns the parent value.\r\n */\r\n function parent(object, path) {\r\n return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1));\r\n }\r\n\r\n /**\r\n * Reorder `array` according to the specified indexes where the element at\r\n * the first index is assigned as the first element, the element at\r\n * the second index is assigned as the second element, and so on.\r\n *\r\n * @private\r\n * @param {Array} array The array to reorder.\r\n * @param {Array} indexes The arranged array indexes.\r\n * @returns {Array} Returns `array`.\r\n */\r\n function reorder(array, indexes) {\r\n var arrLength = array.length,\r\n length = nativeMin(indexes.length, arrLength),\r\n oldArray = copyArray(array);\r\n\r\n while (length--) {\r\n var index = indexes[length];\r\n array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined;\r\n }\r\n return array;\r\n }\r\n\r\n /**\r\n * Sets metadata for `func`.\r\n *\r\n * **Note:** If this function becomes hot, i.e. is invoked a lot in a short\r\n * period of time, it will trip its breaker and transition to an identity\r\n * function to avoid garbage collection pauses in V8. See\r\n * [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070)\r\n * for more details.\r\n *\r\n * @private\r\n * @param {Function} func The function to associate metadata with.\r\n * @param {*} data The metadata.\r\n * @returns {Function} Returns `func`.\r\n */\r\n var setData = shortOut(baseSetData);\r\n\r\n /**\r\n * Sets the `toString` method of `func` to return `string`.\r\n *\r\n * @private\r\n * @param {Function} func The function to modify.\r\n * @param {Function} string The `toString` result.\r\n * @returns {Function} Returns `func`.\r\n */\r\n var setToString = shortOut(baseSetToString);\r\n\r\n /**\r\n * Sets the `toString` method of `wrapper` to mimic the source of `reference`\r\n * with wrapper details in a comment at the top of the source body.\r\n *\r\n * @private\r\n * @param {Function} wrapper The function to modify.\r\n * @param {Function} reference The reference function.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @returns {Function} Returns `wrapper`.\r\n */\r\n function setWrapToString(wrapper, reference, bitmask) {\r\n var source = (reference + '');\r\n return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask)));\r\n }\r\n\r\n /**\r\n * Creates a function that'll short out and invoke `identity` instead\r\n * of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN`\r\n * milliseconds.\r\n *\r\n * @private\r\n * @param {Function} func The function to restrict.\r\n * @returns {Function} Returns the new shortable function.\r\n */\r\n function shortOut(func) {\r\n var count = 0,\r\n lastCalled = 0;\r\n\r\n return function() {\r\n var stamp = nativeNow(),\r\n remaining = HOT_SPAN - (stamp - lastCalled);\r\n\r\n lastCalled = stamp;\r\n if (remaining > 0) {\r\n if (++count >= HOT_COUNT) {\r\n return arguments[0];\r\n }\r\n } else {\r\n count = 0;\r\n }\r\n return func.apply(undefined, arguments);\r\n };\r\n }\r\n\r\n /**\r\n * Converts `string` to a property path array.\r\n *\r\n * @private\r\n * @param {string} string The string to convert.\r\n * @returns {Array} Returns the property path array.\r\n */\r\n var stringToPath = memoizeCapped(function(string) {\r\n var result = [];\r\n if (string.charCodeAt(0) === 46 /* . */) {\r\n result.push('');\r\n }\r\n string.replace(rePropName, function(match, number, quote, subString) {\r\n result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match));\r\n });\r\n return result;\r\n });\r\n\r\n /**\r\n * Converts `value` to a string key if it's not a string or symbol.\r\n *\r\n * @private\r\n * @param {*} value The value to inspect.\r\n * @returns {string|symbol} Returns the key.\r\n */\r\n function toKey(value) {\r\n if (typeof value == 'string' || isSymbol(value)) {\r\n return value;\r\n }\r\n var result = (value + '');\r\n return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;\r\n }\r\n\r\n /**\r\n * Converts `func` to its source code.\r\n *\r\n * @private\r\n * @param {Function} func The function to convert.\r\n * @returns {string} Returns the source code.\r\n */\r\n function toSource(func) {\r\n if (func != null) {\r\n try {\r\n return funcToString.call(func);\r\n } catch (e) {}\r\n try {\r\n return (func + '');\r\n } catch (e) {}\r\n }\r\n return '';\r\n }\r\n\r\n /**\r\n * Updates wrapper `details` based on `bitmask` flags.\r\n *\r\n * @private\r\n * @returns {Array} details The details to modify.\r\n * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\r\n * @returns {Array} Returns `details`.\r\n */\r\n function updateWrapDetails(details, bitmask) {\r\n arrayEach(wrapFlags, function(pair) {\r\n var value = '_.' + pair[0];\r\n if ((bitmask & pair[1]) && !arrayIncludes(details, value)) {\r\n details.push(value);\r\n }\r\n });\r\n return details.sort();\r\n }\r\n\r\n /**\r\n * Creates a clone of `wrapper`.\r\n *\r\n * @private\r\n * @param {Object} wrapper The wrapper to clone.\r\n * @returns {Object} Returns the cloned wrapper.\r\n */\r\n function wrapperClone(wrapper) {\r\n if (wrapper instanceof LazyWrapper) {\r\n return wrapper.clone();\r\n }\r\n var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__);\r\n result.__actions__ = copyArray(wrapper.__actions__);\r\n result.__index__ = wrapper.__index__;\r\n result.__values__ = wrapper.__values__;\r\n return result;\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates an array with all falsey values removed. The values `false`, `null`,\r\n * `0`, `\"\"`, `undefined`, and `NaN` are falsey.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to compact.\r\n * @returns {Array} Returns the new array of filtered values.\r\n * @example\r\n *\r\n * _.compact([0, 1, false, 2, '', 3]);\r\n * // => [1, 2, 3]\r\n */\r\n function compact(array) {\r\n var index = -1,\r\n length = array == null ? 0 : array.length,\r\n resIndex = 0,\r\n result = [];\r\n\r\n while (++index < length) {\r\n var value = array[index];\r\n if (value) {\r\n result[resIndex++] = value;\r\n }\r\n }\r\n return result;\r\n }\r\n\r\n /**\r\n * Creates a new array concatenating `array` with any additional arrays\r\n * and/or values.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Array\r\n * @param {Array} array The array to concatenate.\r\n * @param {...*} [values] The values to concatenate.\r\n * @returns {Array} Returns the new concatenated array.\r\n * @example\r\n *\r\n * var array = [1];\r\n * var other = _.concat(array, 2, [3], [[4]]);\r\n *\r\n * console.log(other);\r\n * // => [1, 2, 3, [4]]\r\n *\r\n * console.log(array);\r\n * // => [1]\r\n */\r\n function concat() {\r\n var length = arguments.length;\r\n if (!length) {\r\n return [];\r\n }\r\n var args = Array(length - 1),\r\n array = arguments[0],\r\n index = length;\r\n\r\n while (index--) {\r\n args[index - 1] = arguments[index];\r\n }\r\n return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1));\r\n }\r\n\r\n /**\r\n * Creates an array of `array` values not included in the other given arrays\r\n * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons. The order and references of result values are\r\n * determined by the first array.\r\n *\r\n * **Note:** Unlike `_.pullAll`, this method returns a new array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {...Array} [values] The values to exclude.\r\n * @returns {Array} Returns the new array of filtered values.\r\n * @see _.without, _.xor\r\n * @example\r\n *\r\n * _.difference([2, 1], [2, 3]);\r\n * // => [1]\r\n */\r\n var difference = baseRest(function(array, values) {\r\n return isArrayLikeObject(array)\r\n ? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true))\r\n : [];\r\n });\r\n\r\n /**\r\n * Creates a slice of `array` with `n` elements dropped from the beginning.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.5.0\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @param {number} [n=1] The number of elements to drop.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {Array} Returns the slice of `array`.\r\n * @example\r\n *\r\n * _.drop([1, 2, 3]);\r\n * // => [2, 3]\r\n *\r\n * _.drop([1, 2, 3], 2);\r\n * // => [3]\r\n *\r\n * _.drop([1, 2, 3], 5);\r\n * // => []\r\n *\r\n * _.drop([1, 2, 3], 0);\r\n * // => [1, 2, 3]\r\n */\r\n function drop(array, n, guard) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return [];\r\n }\r\n n = (guard || n === undefined) ? 1 : toInteger(n);\r\n return baseSlice(array, n < 0 ? 0 : n, length);\r\n }\r\n\r\n /**\r\n * This method is like `_.find` except that it returns the index of the first\r\n * element `predicate` returns truthy for instead of the element itself.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 1.1.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @param {number} [fromIndex=0] The index to search from.\r\n * @returns {number} Returns the index of the found element, else `-1`.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'active': false },\r\n * { 'user': 'fred', 'active': false },\r\n * { 'user': 'pebbles', 'active': true }\r\n * ];\r\n *\r\n * _.findIndex(users, function(o) { return o.user == 'barney'; });\r\n * // => 0\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.findIndex(users, { 'user': 'fred', 'active': false });\r\n * // => 1\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.findIndex(users, ['active', false]);\r\n * // => 0\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.findIndex(users, 'active');\r\n * // => 2\r\n */\r\n function findIndex(array, predicate, fromIndex) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return -1;\r\n }\r\n var index = fromIndex == null ? 0 : toInteger(fromIndex);\r\n if (index < 0) {\r\n index = nativeMax(length + index, 0);\r\n }\r\n return baseFindIndex(array, baseIteratee(predicate, 3), index);\r\n }\r\n\r\n /**\r\n * This method is like `_.findIndex` except that it iterates over elements\r\n * of `collection` from right to left.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.0.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @param {number} [fromIndex=array.length-1] The index to search from.\r\n * @returns {number} Returns the index of the found element, else `-1`.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'active': true },\r\n * { 'user': 'fred', 'active': false },\r\n * { 'user': 'pebbles', 'active': false }\r\n * ];\r\n *\r\n * _.findLastIndex(users, function(o) { return o.user == 'pebbles'; });\r\n * // => 2\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.findLastIndex(users, { 'user': 'barney', 'active': true });\r\n * // => 0\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.findLastIndex(users, ['active', false]);\r\n * // => 2\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.findLastIndex(users, 'active');\r\n * // => 0\r\n */\r\n function findLastIndex(array, predicate, fromIndex) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return -1;\r\n }\r\n var index = length - 1;\r\n if (fromIndex !== undefined) {\r\n index = toInteger(fromIndex);\r\n index = fromIndex < 0\r\n ? nativeMax(length + index, 0)\r\n : nativeMin(index, length - 1);\r\n }\r\n return baseFindIndex(array, baseIteratee(predicate, 3), index, true);\r\n }\r\n\r\n /**\r\n * Flattens `array` a single level deep.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to flatten.\r\n * @returns {Array} Returns the new flattened array.\r\n * @example\r\n *\r\n * _.flatten([1, [2, [3, [4]], 5]]);\r\n * // => [1, 2, [3, [4]], 5]\r\n */\r\n function flatten(array) {\r\n var length = array == null ? 0 : array.length;\r\n return length ? baseFlatten(array, 1) : [];\r\n }\r\n\r\n /**\r\n * Recursively flattens `array`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Array\r\n * @param {Array} array The array to flatten.\r\n * @returns {Array} Returns the new flattened array.\r\n * @example\r\n *\r\n * _.flattenDeep([1, [2, [3, [4]], 5]]);\r\n * // => [1, 2, 3, 4, 5]\r\n */\r\n function flattenDeep(array) {\r\n var length = array == null ? 0 : array.length;\r\n return length ? baseFlatten(array, INFINITY) : [];\r\n }\r\n\r\n /**\r\n * Gets the first element of `array`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @alias first\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @returns {*} Returns the first element of `array`.\r\n * @example\r\n *\r\n * _.head([1, 2, 3]);\r\n * // => 1\r\n *\r\n * _.head([]);\r\n * // => undefined\r\n */\r\n function head(array) {\r\n return (array && array.length) ? array[0] : undefined;\r\n }\r\n\r\n /**\r\n * Gets the index at which the first occurrence of `value` is found in `array`\r\n * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons. If `fromIndex` is negative, it's used as the\r\n * offset from the end of `array`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {*} value The value to search for.\r\n * @param {number} [fromIndex=0] The index to search from.\r\n * @returns {number} Returns the index of the matched value, else `-1`.\r\n * @example\r\n *\r\n * _.indexOf([1, 2, 1, 2], 2);\r\n * // => 1\r\n *\r\n * // Search from the `fromIndex`.\r\n * _.indexOf([1, 2, 1, 2], 2, 2);\r\n * // => 3\r\n */\r\n function indexOf(array, value, fromIndex) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return -1;\r\n }\r\n var index = fromIndex == null ? 0 : toInteger(fromIndex);\r\n if (index < 0) {\r\n index = nativeMax(length + index, 0);\r\n }\r\n return baseIndexOf(array, value, index);\r\n }\r\n\r\n /**\r\n * Gets all but the last element of `array`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @returns {Array} Returns the slice of `array`.\r\n * @example\r\n *\r\n * _.initial([1, 2, 3]);\r\n * // => [1, 2]\r\n */\r\n function initial(array) {\r\n var length = array == null ? 0 : array.length;\r\n return length ? baseSlice(array, 0, -1) : [];\r\n }\r\n\r\n /**\r\n * Creates an array of unique values that are included in all given arrays\r\n * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons. The order and references of result values are\r\n * determined by the first array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {...Array} [arrays] The arrays to inspect.\r\n * @returns {Array} Returns the new array of intersecting values.\r\n * @example\r\n *\r\n * _.intersection([2, 1], [2, 3]);\r\n * // => [2]\r\n */\r\n var intersection = baseRest(function(arrays) {\r\n var mapped = arrayMap(arrays, castArrayLikeObject);\r\n return (mapped.length && mapped[0] === arrays[0])\r\n ? baseIntersection(mapped)\r\n : [];\r\n });\r\n\r\n /**\r\n * Gets the last element of `array`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @returns {*} Returns the last element of `array`.\r\n * @example\r\n *\r\n * _.last([1, 2, 3]);\r\n * // => 3\r\n */\r\n function last(array) {\r\n var length = array == null ? 0 : array.length;\r\n return length ? array[length - 1] : undefined;\r\n }\r\n\r\n /**\r\n * Reverses `array` so that the first element becomes the last, the second\r\n * element becomes the second to last, and so on.\r\n *\r\n * **Note:** This method mutates `array` and is based on\r\n * [`Array#reverse`](https://mdn.io/Array/reverse).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Array\r\n * @param {Array} array The array to modify.\r\n * @returns {Array} Returns `array`.\r\n * @example\r\n *\r\n * var array = [1, 2, 3];\r\n *\r\n * _.reverse(array);\r\n * // => [3, 2, 1]\r\n *\r\n * console.log(array);\r\n * // => [3, 2, 1]\r\n */\r\n function reverse(array) {\r\n return array == null ? array : nativeReverse.call(array);\r\n }\r\n\r\n /**\r\n * Creates a slice of `array` from `start` up to, but not including, `end`.\r\n *\r\n * **Note:** This method is used instead of\r\n * [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are\r\n * returned.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Array\r\n * @param {Array} array The array to slice.\r\n * @param {number} [start=0] The start position.\r\n * @param {number} [end=array.length] The end position.\r\n * @returns {Array} Returns the slice of `array`.\r\n */\r\n function slice(array, start, end) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return [];\r\n }\r\n if (end && typeof end != 'number' && isIterateeCall(array, start, end)) {\r\n start = 0;\r\n end = length;\r\n }\r\n else {\r\n start = start == null ? 0 : toInteger(start);\r\n end = end === undefined ? length : toInteger(end);\r\n }\r\n return baseSlice(array, start, end);\r\n }\r\n\r\n /**\r\n * Creates a slice of `array` with `n` elements taken from the beginning.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @param {number} [n=1] The number of elements to take.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {Array} Returns the slice of `array`.\r\n * @example\r\n *\r\n * _.take([1, 2, 3]);\r\n * // => [1]\r\n *\r\n * _.take([1, 2, 3], 2);\r\n * // => [1, 2]\r\n *\r\n * _.take([1, 2, 3], 5);\r\n * // => [1, 2, 3]\r\n *\r\n * _.take([1, 2, 3], 0);\r\n * // => []\r\n */\r\n function take(array, n, guard) {\r\n if (!(array && array.length)) {\r\n return [];\r\n }\r\n n = (guard || n === undefined) ? 1 : toInteger(n);\r\n return baseSlice(array, 0, n < 0 ? 0 : n);\r\n }\r\n\r\n /**\r\n * Creates a slice of `array` with `n` elements taken from the end.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Array\r\n * @param {Array} array The array to query.\r\n * @param {number} [n=1] The number of elements to take.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {Array} Returns the slice of `array`.\r\n * @example\r\n *\r\n * _.takeRight([1, 2, 3]);\r\n * // => [3]\r\n *\r\n * _.takeRight([1, 2, 3], 2);\r\n * // => [2, 3]\r\n *\r\n * _.takeRight([1, 2, 3], 5);\r\n * // => [1, 2, 3]\r\n *\r\n * _.takeRight([1, 2, 3], 0);\r\n * // => []\r\n */\r\n function takeRight(array, n, guard) {\r\n var length = array == null ? 0 : array.length;\r\n if (!length) {\r\n return [];\r\n }\r\n n = (guard || n === undefined) ? 1 : toInteger(n);\r\n n = length - n;\r\n return baseSlice(array, n < 0 ? 0 : n, length);\r\n }\r\n\r\n /**\r\n * Creates an array of unique values, in order, from all given arrays using\r\n * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {...Array} [arrays] The arrays to inspect.\r\n * @returns {Array} Returns the new array of combined values.\r\n * @example\r\n *\r\n * _.union([2], [1, 2]);\r\n * // => [2, 1]\r\n */\r\n var union = baseRest(function(arrays) {\r\n return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true));\r\n });\r\n\r\n /**\r\n * Creates a duplicate-free version of an array, using\r\n * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons, in which only the first occurrence of each element\r\n * is kept. The order of result values is determined by the order they occur\r\n * in the array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @returns {Array} Returns the new duplicate free array.\r\n * @example\r\n *\r\n * _.uniq([2, 1, 2]);\r\n * // => [2, 1]\r\n */\r\n function uniq(array) {\r\n return (array && array.length) ? baseUniq(array) : [];\r\n }\r\n\r\n /**\r\n * This method is like `_.uniq` except that it accepts `iteratee` which is\r\n * invoked for each element in `array` to generate the criterion by which\r\n * uniqueness is computed. The order of result values is determined by the\r\n * order they occur in the array. The iteratee is invoked with one argument:\r\n * (value).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {Function} [iteratee=_.identity] The iteratee invoked per element.\r\n * @returns {Array} Returns the new duplicate free array.\r\n * @example\r\n *\r\n * _.uniqBy([2.1, 1.2, 2.3], Math.floor);\r\n * // => [2.1, 1.2]\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x');\r\n * // => [{ 'x': 1 }, { 'x': 2 }]\r\n */\r\n function uniqBy(array, iteratee) {\r\n return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : [];\r\n }\r\n\r\n /**\r\n * This method is like `_.zip` except that it accepts an array of grouped\r\n * elements and creates an array regrouping the elements to their pre-zip\r\n * configuration.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 1.2.0\r\n * @category Array\r\n * @param {Array} array The array of grouped elements to process.\r\n * @returns {Array} Returns the new array of regrouped elements.\r\n * @example\r\n *\r\n * var zipped = _.zip(['a', 'b'], [1, 2], [true, false]);\r\n * // => [['a', 1, true], ['b', 2, false]]\r\n *\r\n * _.unzip(zipped);\r\n * // => [['a', 'b'], [1, 2], [true, false]]\r\n */\r\n function unzip(array) {\r\n if (!(array && array.length)) {\r\n return [];\r\n }\r\n var length = 0;\r\n array = arrayFilter(array, function(group) {\r\n if (isArrayLikeObject(group)) {\r\n length = nativeMax(group.length, length);\r\n return true;\r\n }\r\n });\r\n return baseTimes(length, function(index) {\r\n return arrayMap(array, baseProperty(index));\r\n });\r\n }\r\n\r\n /**\r\n * Creates an array excluding all given values using\r\n * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * for equality comparisons.\r\n *\r\n * **Note:** Unlike `_.pull`, this method returns a new array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {Array} array The array to inspect.\r\n * @param {...*} [values] The values to exclude.\r\n * @returns {Array} Returns the new array of filtered values.\r\n * @see _.difference, _.xor\r\n * @example\r\n *\r\n * _.without([2, 1, 2, 3], 1, 2);\r\n * // => [3]\r\n */\r\n var without = baseRest(function(array, values) {\r\n return isArrayLikeObject(array)\r\n ? baseDifference(array, values)\r\n : [];\r\n });\r\n\r\n /**\r\n * Creates an array of grouped elements, the first of which contains the\r\n * first elements of the given arrays, the second of which contains the\r\n * second elements of the given arrays, and so on.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Array\r\n * @param {...Array} [arrays] The arrays to process.\r\n * @returns {Array} Returns the new array of grouped elements.\r\n * @example\r\n *\r\n * _.zip(['a', 'b'], [1, 2], [true, false]);\r\n * // => [['a', 1, true], ['b', 2, false]]\r\n */\r\n var zip = baseRest(unzip);\r\n\r\n /**\r\n * This method is like `_.fromPairs` except that it accepts two arrays,\r\n * one of property identifiers and one of corresponding values.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.4.0\r\n * @category Array\r\n * @param {Array} [props=[]] The property identifiers.\r\n * @param {Array} [values=[]] The property values.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * _.zipObject(['a', 'b'], [1, 2]);\r\n * // => { 'a': 1, 'b': 2 }\r\n */\r\n function zipObject(props, values) {\r\n return baseZipObject(props || [], values || [], assignValue);\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a `lodash` wrapper instance that wraps `value` with explicit method\r\n * chain sequences enabled. The result of such sequences must be unwrapped\r\n * with `_#value`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 1.3.0\r\n * @category Seq\r\n * @param {*} value The value to wrap.\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36 },\r\n * { 'user': 'fred', 'age': 40 },\r\n * { 'user': 'pebbles', 'age': 1 }\r\n * ];\r\n *\r\n * var youngest = _\r\n * .chain(users)\r\n * .sortBy('age')\r\n * .map(function(o) {\r\n * return o.user + ' is ' + o.age;\r\n * })\r\n * .head()\r\n * .value();\r\n * // => 'pebbles is 1'\r\n */\r\n function chain(value) {\r\n var result = lodash(value);\r\n result.__chain__ = true;\r\n return result;\r\n }\r\n\r\n /**\r\n * This method invokes `interceptor` and returns `value`. The interceptor\r\n * is invoked with one argument; (value). The purpose of this method is to\r\n * \"tap into\" a method chain sequence in order to modify intermediate results.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Seq\r\n * @param {*} value The value to provide to `interceptor`.\r\n * @param {Function} interceptor The function to invoke.\r\n * @returns {*} Returns `value`.\r\n * @example\r\n *\r\n * _([1, 2, 3])\r\n * .tap(function(array) {\r\n * // Mutate input array.\r\n * array.pop();\r\n * })\r\n * .reverse()\r\n * .value();\r\n * // => [2, 1]\r\n */\r\n function tap(value, interceptor) {\r\n interceptor(value);\r\n return value;\r\n }\r\n\r\n /**\r\n * This method is like `_.tap` except that it returns the result of `interceptor`.\r\n * The purpose of this method is to \"pass thru\" values replacing intermediate\r\n * results in a method chain sequence.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Seq\r\n * @param {*} value The value to provide to `interceptor`.\r\n * @param {Function} interceptor The function to invoke.\r\n * @returns {*} Returns the result of `interceptor`.\r\n * @example\r\n *\r\n * _(' abc ')\r\n * .chain()\r\n * .trim()\r\n * .thru(function(value) {\r\n * return [value];\r\n * })\r\n * .value();\r\n * // => ['abc']\r\n */\r\n function thru(value, interceptor) {\r\n return interceptor(value);\r\n }\r\n\r\n /**\r\n * This method is the wrapper version of `_.at`.\r\n *\r\n * @name at\r\n * @memberOf _\r\n * @since 1.0.0\r\n * @category Seq\r\n * @param {...(string|string[])} [paths] The property paths to pick.\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * var object = { 'a': [{ 'b': { 'c': 3 } }, 4] };\r\n *\r\n * _(object).at(['a[0].b.c', 'a[1]']).value();\r\n * // => [3, 4]\r\n */\r\n var wrapperAt = flatRest(function(paths) {\r\n var length = paths.length,\r\n start = length ? paths[0] : 0,\r\n value = this.__wrapped__,\r\n interceptor = function(object) { return baseAt(object, paths); };\r\n\r\n if (length > 1 || this.__actions__.length ||\r\n !(value instanceof LazyWrapper) || !isIndex(start)) {\r\n return this.thru(interceptor);\r\n }\r\n value = value.slice(start, +start + (length ? 1 : 0));\r\n value.__actions__.push({\r\n 'func': thru,\r\n 'args': [interceptor],\r\n 'thisArg': undefined\r\n });\r\n return new LodashWrapper(value, this.__chain__).thru(function(array) {\r\n if (length && !array.length) {\r\n array.push(undefined);\r\n }\r\n return array;\r\n });\r\n });\r\n\r\n /**\r\n * Creates a `lodash` wrapper instance with explicit method chain sequences enabled.\r\n *\r\n * @name chain\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Seq\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36 },\r\n * { 'user': 'fred', 'age': 40 }\r\n * ];\r\n *\r\n * // A sequence without explicit chaining.\r\n * _(users).head();\r\n * // => { 'user': 'barney', 'age': 36 }\r\n *\r\n * // A sequence with explicit chaining.\r\n * _(users)\r\n * .chain()\r\n * .head()\r\n * .pick('user')\r\n * .value();\r\n * // => { 'user': 'barney' }\r\n */\r\n function wrapperChain() {\r\n return chain(this);\r\n }\r\n\r\n /**\r\n * Executes the chain sequence and returns the wrapped result.\r\n *\r\n * @name commit\r\n * @memberOf _\r\n * @since 3.2.0\r\n * @category Seq\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * var array = [1, 2];\r\n * var wrapped = _(array).push(3);\r\n *\r\n * console.log(array);\r\n * // => [1, 2]\r\n *\r\n * wrapped = wrapped.commit();\r\n * console.log(array);\r\n * // => [1, 2, 3]\r\n *\r\n * wrapped.last();\r\n * // => 3\r\n *\r\n * console.log(array);\r\n * // => [1, 2, 3]\r\n */\r\n function wrapperCommit() {\r\n return new LodashWrapper(this.value(), this.__chain__);\r\n }\r\n\r\n /**\r\n * Gets the next value on a wrapped object following the\r\n * [iterator protocol](https://mdn.io/iteration_protocols#iterator).\r\n *\r\n * @name next\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Seq\r\n * @returns {Object} Returns the next iterator value.\r\n * @example\r\n *\r\n * var wrapped = _([1, 2]);\r\n *\r\n * wrapped.next();\r\n * // => { 'done': false, 'value': 1 }\r\n *\r\n * wrapped.next();\r\n * // => { 'done': false, 'value': 2 }\r\n *\r\n * wrapped.next();\r\n * // => { 'done': true, 'value': undefined }\r\n */\r\n function wrapperNext() {\r\n if (this.__values__ === undefined) {\r\n this.__values__ = toArray(this.value());\r\n }\r\n var done = this.__index__ >= this.__values__.length,\r\n value = done ? undefined : this.__values__[this.__index__++];\r\n\r\n return { 'done': done, 'value': value };\r\n }\r\n\r\n /**\r\n * Enables the wrapper to be iterable.\r\n *\r\n * @name Symbol.iterator\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Seq\r\n * @returns {Object} Returns the wrapper object.\r\n * @example\r\n *\r\n * var wrapped = _([1, 2]);\r\n *\r\n * wrapped[Symbol.iterator]() === wrapped;\r\n * // => true\r\n *\r\n * Array.from(wrapped);\r\n * // => [1, 2]\r\n */\r\n function wrapperToIterator() {\r\n return this;\r\n }\r\n\r\n /**\r\n * Creates a clone of the chain sequence planting `value` as the wrapped value.\r\n *\r\n * @name plant\r\n * @memberOf _\r\n * @since 3.2.0\r\n * @category Seq\r\n * @param {*} value The value to plant.\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * function square(n) {\r\n * return n * n;\r\n * }\r\n *\r\n * var wrapped = _([1, 2]).map(square);\r\n * var other = wrapped.plant([3, 4]);\r\n *\r\n * other.value();\r\n * // => [9, 16]\r\n *\r\n * wrapped.value();\r\n * // => [1, 4]\r\n */\r\n function wrapperPlant(value) {\r\n var result,\r\n parent = this;\r\n\r\n while (parent instanceof baseLodash) {\r\n var clone = wrapperClone(parent);\r\n clone.__index__ = 0;\r\n clone.__values__ = undefined;\r\n if (result) {\r\n previous.__wrapped__ = clone;\r\n } else {\r\n result = clone;\r\n }\r\n var previous = clone;\r\n parent = parent.__wrapped__;\r\n }\r\n previous.__wrapped__ = value;\r\n return result;\r\n }\r\n\r\n /**\r\n * This method is the wrapper version of `_.reverse`.\r\n *\r\n * **Note:** This method mutates the wrapped array.\r\n *\r\n * @name reverse\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Seq\r\n * @returns {Object} Returns the new `lodash` wrapper instance.\r\n * @example\r\n *\r\n * var array = [1, 2, 3];\r\n *\r\n * _(array).reverse().value()\r\n * // => [3, 2, 1]\r\n *\r\n * console.log(array);\r\n * // => [3, 2, 1]\r\n */\r\n function wrapperReverse() {\r\n var value = this.__wrapped__;\r\n if (value instanceof LazyWrapper) {\r\n var wrapped = value;\r\n if (this.__actions__.length) {\r\n wrapped = new LazyWrapper(this);\r\n }\r\n wrapped = wrapped.reverse();\r\n wrapped.__actions__.push({\r\n 'func': thru,\r\n 'args': [reverse],\r\n 'thisArg': undefined\r\n });\r\n return new LodashWrapper(wrapped, this.__chain__);\r\n }\r\n return this.thru(reverse);\r\n }\r\n\r\n /**\r\n * Executes the chain sequence to resolve the unwrapped value.\r\n *\r\n * @name value\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @alias toJSON, valueOf\r\n * @category Seq\r\n * @returns {*} Returns the resolved unwrapped value.\r\n * @example\r\n *\r\n * _([1, 2, 3]).value();\r\n * // => [1, 2, 3]\r\n */\r\n function wrapperValue() {\r\n return baseWrapperValue(this.__wrapped__, this.__actions__);\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates an object composed of keys generated from the results of running\r\n * each element of `collection` thru `iteratee`. The corresponding value of\r\n * each key is the number of times the key was returned by `iteratee`. The\r\n * iteratee is invoked with one argument: (value).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.5.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [iteratee=_.identity] The iteratee to transform keys.\r\n * @returns {Object} Returns the composed aggregate object.\r\n * @example\r\n *\r\n * _.countBy([6.1, 4.2, 6.3], Math.floor);\r\n * // => { '4': 1, '6': 2 }\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.countBy(['one', 'two', 'three'], 'length');\r\n * // => { '3': 2, '5': 1 }\r\n */\r\n var countBy = createAggregator(function(result, value, key) {\r\n if (hasOwnProperty.call(result, key)) {\r\n ++result[key];\r\n } else {\r\n baseAssignValue(result, key, 1);\r\n }\r\n });\r\n\r\n /**\r\n * Checks if `predicate` returns truthy for **all** elements of `collection`.\r\n * Iteration is stopped once `predicate` returns falsey. The predicate is\r\n * invoked with three arguments: (value, index|key, collection).\r\n *\r\n * **Note:** This method returns `true` for\r\n * [empty collections](https://en.wikipedia.org/wiki/Empty_set) because\r\n * [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of\r\n * elements of empty collections.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {boolean} Returns `true` if all elements pass the predicate check,\r\n * else `false`.\r\n * @example\r\n *\r\n * _.every([true, 1, null, 'yes'], Boolean);\r\n * // => false\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36, 'active': false },\r\n * { 'user': 'fred', 'age': 40, 'active': false }\r\n * ];\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.every(users, { 'user': 'barney', 'active': false });\r\n * // => false\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.every(users, ['active', false]);\r\n * // => true\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.every(users, 'active');\r\n * // => false\r\n */\r\n function every(collection, predicate, guard) {\r\n var func = isArray(collection) ? arrayEvery : baseEvery;\r\n if (guard && isIterateeCall(collection, predicate, guard)) {\r\n predicate = undefined;\r\n }\r\n return func(collection, baseIteratee(predicate, 3));\r\n }\r\n\r\n /**\r\n * Iterates over elements of `collection`, returning an array of all elements\r\n * `predicate` returns truthy for. The predicate is invoked with three\r\n * arguments: (value, index|key, collection).\r\n *\r\n * **Note:** Unlike `_.remove`, this method returns a new array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @returns {Array} Returns the new filtered array.\r\n * @see _.reject\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36, 'active': true },\r\n * { 'user': 'fred', 'age': 40, 'active': false }\r\n * ];\r\n *\r\n * _.filter(users, function(o) { return !o.active; });\r\n * // => objects for ['fred']\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.filter(users, { 'age': 36, 'active': true });\r\n * // => objects for ['barney']\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.filter(users, ['active', false]);\r\n * // => objects for ['fred']\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.filter(users, 'active');\r\n * // => objects for ['barney']\r\n */\r\n function filter(collection, predicate) {\r\n var func = isArray(collection) ? arrayFilter : baseFilter;\r\n return func(collection, baseIteratee(predicate, 3));\r\n }\r\n\r\n /**\r\n * Iterates over elements of `collection`, returning the first element\r\n * `predicate` returns truthy for. The predicate is invoked with three\r\n * arguments: (value, index|key, collection).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to inspect.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @param {number} [fromIndex=0] The index to search from.\r\n * @returns {*} Returns the matched element, else `undefined`.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36, 'active': true },\r\n * { 'user': 'fred', 'age': 40, 'active': false },\r\n * { 'user': 'pebbles', 'age': 1, 'active': true }\r\n * ];\r\n *\r\n * _.find(users, function(o) { return o.age < 40; });\r\n * // => object for 'barney'\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.find(users, { 'age': 1, 'active': true });\r\n * // => object for 'pebbles'\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.find(users, ['active', false]);\r\n * // => object for 'fred'\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.find(users, 'active');\r\n * // => object for 'barney'\r\n */\r\n var find = createFind(findIndex);\r\n\r\n /**\r\n * Iterates over elements of `collection` and invokes `iteratee` for each element.\r\n * The iteratee is invoked with three arguments: (value, index|key, collection).\r\n * Iteratee functions may exit iteration early by explicitly returning `false`.\r\n *\r\n * **Note:** As with other \"Collections\" methods, objects with a \"length\"\r\n * property are iterated like arrays. To avoid this behavior use `_.forIn`\r\n * or `_.forOwn` for object iteration.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @alias each\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [iteratee=_.identity] The function invoked per iteration.\r\n * @returns {Array|Object} Returns `collection`.\r\n * @see _.forEachRight\r\n * @example\r\n *\r\n * _.forEach([1, 2], function(value) {\r\n * console.log(value);\r\n * });\r\n * // => Logs `1` then `2`.\r\n *\r\n * _.forEach({ 'a': 1, 'b': 2 }, function(value, key) {\r\n * console.log(key);\r\n * });\r\n * // => Logs 'a' then 'b' (iteration order is not guaranteed).\r\n */\r\n function forEach(collection, iteratee) {\r\n var func = isArray(collection) ? arrayEach : baseEach;\r\n return func(collection, baseIteratee(iteratee, 3));\r\n }\r\n\r\n /**\r\n * Creates an object composed of keys generated from the results of running\r\n * each element of `collection` thru `iteratee`. The order of grouped values\r\n * is determined by the order they occur in `collection`. The corresponding\r\n * value of each key is an array of elements responsible for generating the\r\n * key. The iteratee is invoked with one argument: (value).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [iteratee=_.identity] The iteratee to transform keys.\r\n * @returns {Object} Returns the composed aggregate object.\r\n * @example\r\n *\r\n * _.groupBy([6.1, 4.2, 6.3], Math.floor);\r\n * // => { '4': [4.2], '6': [6.1, 6.3] }\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.groupBy(['one', 'two', 'three'], 'length');\r\n * // => { '3': ['one', 'two'], '5': ['three'] }\r\n */\r\n var groupBy = createAggregator(function(result, value, key) {\r\n if (hasOwnProperty.call(result, key)) {\r\n result[key].push(value);\r\n } else {\r\n baseAssignValue(result, key, [value]);\r\n }\r\n });\r\n\r\n /**\r\n * Creates an array of values by running each element in `collection` thru\r\n * `iteratee`. The iteratee is invoked with three arguments:\r\n * (value, index|key, collection).\r\n *\r\n * Many lodash methods are guarded to work as iteratees for methods like\r\n * `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`.\r\n *\r\n * The guarded methods are:\r\n * `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`,\r\n * `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`,\r\n * `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`,\r\n * `template`, `trim`, `trimEnd`, `trimStart`, and `words`\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [iteratee=_.identity] The function invoked per iteration.\r\n * @returns {Array} Returns the new mapped array.\r\n * @example\r\n *\r\n * function square(n) {\r\n * return n * n;\r\n * }\r\n *\r\n * _.map([4, 8], square);\r\n * // => [16, 64]\r\n *\r\n * _.map({ 'a': 4, 'b': 8 }, square);\r\n * // => [16, 64] (iteration order is not guaranteed)\r\n *\r\n * var users = [\r\n * { 'user': 'barney' },\r\n * { 'user': 'fred' }\r\n * ];\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.map(users, 'user');\r\n * // => ['barney', 'fred']\r\n */\r\n function map(collection, iteratee) {\r\n var func = isArray(collection) ? arrayMap : baseMap;\r\n return func(collection, baseIteratee(iteratee, 3));\r\n }\r\n\r\n /**\r\n * Reduces `collection` to a value which is the accumulated result of running\r\n * each element in `collection` thru `iteratee`, where each successive\r\n * invocation is supplied the return value of the previous. If `accumulator`\r\n * is not given, the first element of `collection` is used as the initial\r\n * value. The iteratee is invoked with four arguments:\r\n * (accumulator, value, index|key, collection).\r\n *\r\n * Many lodash methods are guarded to work as iteratees for methods like\r\n * `_.reduce`, `_.reduceRight`, and `_.transform`.\r\n *\r\n * The guarded methods are:\r\n * `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`,\r\n * and `sortBy`\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [iteratee=_.identity] The function invoked per iteration.\r\n * @param {*} [accumulator] The initial value.\r\n * @returns {*} Returns the accumulated value.\r\n * @see _.reduceRight\r\n * @example\r\n *\r\n * _.reduce([1, 2], function(sum, n) {\r\n * return sum + n;\r\n * }, 0);\r\n * // => 3\r\n *\r\n * _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) {\r\n * (result[value] || (result[value] = [])).push(key);\r\n * return result;\r\n * }, {});\r\n * // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed)\r\n */\r\n function reduce(collection, iteratee, accumulator) {\r\n var func = isArray(collection) ? arrayReduce : baseReduce,\r\n initAccum = arguments.length < 3;\r\n\r\n return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach);\r\n }\r\n\r\n /**\r\n * The opposite of `_.filter`; this method returns the elements of `collection`\r\n * that `predicate` does **not** return truthy for.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @returns {Array} Returns the new filtered array.\r\n * @see _.filter\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36, 'active': false },\r\n * { 'user': 'fred', 'age': 40, 'active': true }\r\n * ];\r\n *\r\n * _.reject(users, function(o) { return !o.active; });\r\n * // => objects for ['fred']\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.reject(users, { 'age': 40, 'active': true });\r\n * // => objects for ['barney']\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.reject(users, ['active', false]);\r\n * // => objects for ['fred']\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.reject(users, 'active');\r\n * // => objects for ['barney']\r\n */\r\n function reject(collection, predicate) {\r\n var func = isArray(collection) ? arrayFilter : baseFilter;\r\n return func(collection, negate(baseIteratee(predicate, 3)));\r\n }\r\n\r\n /**\r\n * Gets the size of `collection` by returning its length for array-like\r\n * values or the number of own enumerable string keyed properties for objects.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object|string} collection The collection to inspect.\r\n * @returns {number} Returns the collection size.\r\n * @example\r\n *\r\n * _.size([1, 2, 3]);\r\n * // => 3\r\n *\r\n * _.size({ 'a': 1, 'b': 2 });\r\n * // => 2\r\n *\r\n * _.size('pebbles');\r\n * // => 7\r\n */\r\n function size(collection) {\r\n if (collection == null) {\r\n return 0;\r\n }\r\n if (isArrayLike(collection)) {\r\n return isString(collection) ? stringSize(collection) : collection.length;\r\n }\r\n var tag = getTag(collection);\r\n if (tag == mapTag || tag == setTag) {\r\n return collection.size;\r\n }\r\n return baseKeys(collection).length;\r\n }\r\n\r\n /**\r\n * Checks if `predicate` returns truthy for **any** element of `collection`.\r\n * Iteration is stopped once `predicate` returns truthy. The predicate is\r\n * invoked with three arguments: (value, index|key, collection).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {boolean} Returns `true` if any element passes the predicate check,\r\n * else `false`.\r\n * @example\r\n *\r\n * _.some([null, 0, 'yes', false], Boolean);\r\n * // => true\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'active': true },\r\n * { 'user': 'fred', 'active': false }\r\n * ];\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.some(users, { 'user': 'barney', 'active': false });\r\n * // => false\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.some(users, ['active', false]);\r\n * // => true\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.some(users, 'active');\r\n * // => true\r\n */\r\n function some(collection, predicate, guard) {\r\n var func = isArray(collection) ? arraySome : baseSome;\r\n if (guard && isIterateeCall(collection, predicate, guard)) {\r\n predicate = undefined;\r\n }\r\n return func(collection, baseIteratee(predicate, 3));\r\n }\r\n\r\n /**\r\n * Creates an array of elements, sorted in ascending order by the results of\r\n * running each element in a collection thru each iteratee. This method\r\n * performs a stable sort, that is, it preserves the original sort order of\r\n * equal elements. The iteratees are invoked with one argument: (value).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Collection\r\n * @param {Array|Object} collection The collection to iterate over.\r\n * @param {...(Function|Function[])} [iteratees=[_.identity]]\r\n * The iteratees to sort by.\r\n * @returns {Array} Returns the new sorted array.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'fred', 'age': 48 },\r\n * { 'user': 'barney', 'age': 36 },\r\n * { 'user': 'fred', 'age': 40 },\r\n * { 'user': 'barney', 'age': 34 }\r\n * ];\r\n *\r\n * _.sortBy(users, [function(o) { return o.user; }]);\r\n * // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]]\r\n *\r\n * _.sortBy(users, ['user', 'age']);\r\n * // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]]\r\n */\r\n var sortBy = baseRest(function(collection, iteratees) {\r\n if (collection == null) {\r\n return [];\r\n }\r\n var length = iteratees.length;\r\n if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) {\r\n iteratees = [];\r\n } else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) {\r\n iteratees = [iteratees[0]];\r\n }\r\n return baseOrderBy(collection, baseFlatten(iteratees, 1), []);\r\n });\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Gets the timestamp of the number of milliseconds that have elapsed since\r\n * the Unix epoch (1 January 1970 00:00:00 UTC).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.4.0\r\n * @category Date\r\n * @returns {number} Returns the timestamp.\r\n * @example\r\n *\r\n * _.defer(function(stamp) {\r\n * console.log(_.now() - stamp);\r\n * }, _.now());\r\n * // => Logs the number of milliseconds it took for the deferred invocation.\r\n */\r\n var now = function() {\r\n return root.Date.now();\r\n };\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * The opposite of `_.before`; this method creates a function that invokes\r\n * `func` once it's called `n` or more times.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {number} n The number of calls before `func` is invoked.\r\n * @param {Function} func The function to restrict.\r\n * @returns {Function} Returns the new restricted function.\r\n * @example\r\n *\r\n * var saves = ['profile', 'settings'];\r\n *\r\n * var done = _.after(saves.length, function() {\r\n * console.log('done saving!');\r\n * });\r\n *\r\n * _.forEach(saves, function(type) {\r\n * asyncSave({ 'type': type, 'complete': done });\r\n * });\r\n * // => Logs 'done saving!' after the two async saves have completed.\r\n */\r\n function after(n, func) {\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n n = toInteger(n);\r\n return function() {\r\n if (--n < 1) {\r\n return func.apply(this, arguments);\r\n }\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that invokes `func`, with the `this` binding and arguments\r\n * of the created function, while it's called less than `n` times. Subsequent\r\n * calls to the created function return the result of the last `func` invocation.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Function\r\n * @param {number} n The number of calls at which `func` is no longer invoked.\r\n * @param {Function} func The function to restrict.\r\n * @returns {Function} Returns the new restricted function.\r\n * @example\r\n *\r\n * jQuery(element).on('click', _.before(5, addContactToList));\r\n * // => Allows adding up to 4 contacts to the list.\r\n */\r\n function before(n, func) {\r\n var result;\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n n = toInteger(n);\r\n return function() {\r\n if (--n > 0) {\r\n result = func.apply(this, arguments);\r\n }\r\n if (n <= 1) {\r\n func = undefined;\r\n }\r\n return result;\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that invokes `func` with the `this` binding of `thisArg`\r\n * and `partials` prepended to the arguments it receives.\r\n *\r\n * The `_.bind.placeholder` value, which defaults to `_` in monolithic builds,\r\n * may be used as a placeholder for partially applied arguments.\r\n *\r\n * **Note:** Unlike native `Function#bind`, this method doesn't set the \"length\"\r\n * property of bound functions.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to bind.\r\n * @param {*} thisArg The `this` binding of `func`.\r\n * @param {...*} [partials] The arguments to be partially applied.\r\n * @returns {Function} Returns the new bound function.\r\n * @example\r\n *\r\n * function greet(greeting, punctuation) {\r\n * return greeting + ' ' + this.user + punctuation;\r\n * }\r\n *\r\n * var object = { 'user': 'fred' };\r\n *\r\n * var bound = _.bind(greet, object, 'hi');\r\n * bound('!');\r\n * // => 'hi fred!'\r\n *\r\n * // Bound with placeholders.\r\n * var bound = _.bind(greet, object, _, '!');\r\n * bound('hi');\r\n * // => 'hi fred!'\r\n */\r\n var bind = baseRest(function(func, thisArg, partials) {\r\n var bitmask = WRAP_BIND_FLAG;\r\n if (partials.length) {\r\n var holders = replaceHolders(partials, getHolder(bind));\r\n bitmask |= WRAP_PARTIAL_FLAG;\r\n }\r\n return createWrap(func, bitmask, thisArg, partials, holders);\r\n });\r\n\r\n /**\r\n * Creates a debounced function that delays invoking `func` until after `wait`\r\n * milliseconds have elapsed since the last time the debounced function was\r\n * invoked. The debounced function comes with a `cancel` method to cancel\r\n * delayed `func` invocations and a `flush` method to immediately invoke them.\r\n * Provide `options` to indicate whether `func` should be invoked on the\r\n * leading and/or trailing edge of the `wait` timeout. The `func` is invoked\r\n * with the last arguments provided to the debounced function. Subsequent\r\n * calls to the debounced function return the result of the last `func`\r\n * invocation.\r\n *\r\n * **Note:** If `leading` and `trailing` options are `true`, `func` is\r\n * invoked on the trailing edge of the timeout only if the debounced function\r\n * is invoked more than once during the `wait` timeout.\r\n *\r\n * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred\r\n * until to the next tick, similar to `setTimeout` with a timeout of `0`.\r\n *\r\n * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)\r\n * for details over the differences between `_.debounce` and `_.throttle`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to debounce.\r\n * @param {number} [wait=0] The number of milliseconds to delay.\r\n * @param {Object} [options={}] The options object.\r\n * @param {boolean} [options.leading=false]\r\n * Specify invoking on the leading edge of the timeout.\r\n * @param {number} [options.maxWait]\r\n * The maximum time `func` is allowed to be delayed before it's invoked.\r\n * @param {boolean} [options.trailing=true]\r\n * Specify invoking on the trailing edge of the timeout.\r\n * @returns {Function} Returns the new debounced function.\r\n * @example\r\n *\r\n * // Avoid costly calculations while the window size is in flux.\r\n * jQuery(window).on('resize', _.debounce(calculateLayout, 150));\r\n *\r\n * // Invoke `sendMail` when clicked, debouncing subsequent calls.\r\n * jQuery(element).on('click', _.debounce(sendMail, 300, {\r\n * 'leading': true,\r\n * 'trailing': false\r\n * }));\r\n *\r\n * // Ensure `batchLog` is invoked once after 1 second of debounced calls.\r\n * var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 });\r\n * var source = new EventSource('/stream');\r\n * jQuery(source).on('message', debounced);\r\n *\r\n * // Cancel the trailing debounced invocation.\r\n * jQuery(window).on('popstate', debounced.cancel);\r\n */\r\n function debounce(func, wait, options) {\r\n var lastArgs,\r\n lastThis,\r\n maxWait,\r\n result,\r\n timerId,\r\n lastCallTime,\r\n lastInvokeTime = 0,\r\n leading = false,\r\n maxing = false,\r\n trailing = true;\r\n\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n wait = toNumber(wait) || 0;\r\n if (isObject(options)) {\r\n leading = !!options.leading;\r\n maxing = 'maxWait' in options;\r\n maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait;\r\n trailing = 'trailing' in options ? !!options.trailing : trailing;\r\n }\r\n\r\n function invokeFunc(time) {\r\n var args = lastArgs,\r\n thisArg = lastThis;\r\n\r\n lastArgs = lastThis = undefined;\r\n lastInvokeTime = time;\r\n result = func.apply(thisArg, args);\r\n return result;\r\n }\r\n\r\n function leadingEdge(time) {\r\n // Reset any `maxWait` timer.\r\n lastInvokeTime = time;\r\n // Start the timer for the trailing edge.\r\n timerId = setTimeout(timerExpired, wait);\r\n // Invoke the leading edge.\r\n return leading ? invokeFunc(time) : result;\r\n }\r\n\r\n function remainingWait(time) {\r\n var timeSinceLastCall = time - lastCallTime,\r\n timeSinceLastInvoke = time - lastInvokeTime,\r\n timeWaiting = wait - timeSinceLastCall;\r\n\r\n return maxing\r\n ? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke)\r\n : timeWaiting;\r\n }\r\n\r\n function shouldInvoke(time) {\r\n var timeSinceLastCall = time - lastCallTime,\r\n timeSinceLastInvoke = time - lastInvokeTime;\r\n\r\n // Either this is the first call, activity has stopped and we're at the\r\n // trailing edge, the system time has gone backwards and we're treating\r\n // it as the trailing edge, or we've hit the `maxWait` limit.\r\n return (lastCallTime === undefined || (timeSinceLastCall >= wait) ||\r\n (timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait));\r\n }\r\n\r\n function timerExpired() {\r\n var time = now();\r\n if (shouldInvoke(time)) {\r\n return trailingEdge(time);\r\n }\r\n // Restart the timer.\r\n timerId = setTimeout(timerExpired, remainingWait(time));\r\n }\r\n\r\n function trailingEdge(time) {\r\n timerId = undefined;\r\n\r\n // Only invoke if we have `lastArgs` which means `func` has been\r\n // debounced at least once.\r\n if (trailing && lastArgs) {\r\n return invokeFunc(time);\r\n }\r\n lastArgs = lastThis = undefined;\r\n return result;\r\n }\r\n\r\n function cancel() {\r\n if (timerId !== undefined) {\r\n clearTimeout(timerId);\r\n }\r\n lastInvokeTime = 0;\r\n lastArgs = lastCallTime = lastThis = timerId = undefined;\r\n }\r\n\r\n function flush() {\r\n return timerId === undefined ? result : trailingEdge(now());\r\n }\r\n\r\n function debounced() {\r\n var time = now(),\r\n isInvoking = shouldInvoke(time);\r\n\r\n lastArgs = arguments;\r\n lastThis = this;\r\n lastCallTime = time;\r\n\r\n if (isInvoking) {\r\n if (timerId === undefined) {\r\n return leadingEdge(lastCallTime);\r\n }\r\n if (maxing) {\r\n // Handle invocations in a tight loop.\r\n timerId = setTimeout(timerExpired, wait);\r\n return invokeFunc(lastCallTime);\r\n }\r\n }\r\n if (timerId === undefined) {\r\n timerId = setTimeout(timerExpired, wait);\r\n }\r\n return result;\r\n }\r\n debounced.cancel = cancel;\r\n debounced.flush = flush;\r\n return debounced;\r\n }\r\n\r\n /**\r\n * Defers invoking the `func` until the current call stack has cleared. Any\r\n * additional arguments are provided to `func` when it's invoked.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to defer.\r\n * @param {...*} [args] The arguments to invoke `func` with.\r\n * @returns {number} Returns the timer id.\r\n * @example\r\n *\r\n * _.defer(function(text) {\r\n * console.log(text);\r\n * }, 'deferred');\r\n * // => Logs 'deferred' after one millisecond.\r\n */\r\n var defer = baseRest(function(func, args) {\r\n return baseDelay(func, 1, args);\r\n });\r\n\r\n /**\r\n * Invokes `func` after `wait` milliseconds. Any additional arguments are\r\n * provided to `func` when it's invoked.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to delay.\r\n * @param {number} wait The number of milliseconds to delay invocation.\r\n * @param {...*} [args] The arguments to invoke `func` with.\r\n * @returns {number} Returns the timer id.\r\n * @example\r\n *\r\n * _.delay(function(text) {\r\n * console.log(text);\r\n * }, 1000, 'later');\r\n * // => Logs 'later' after one second.\r\n */\r\n var delay = baseRest(function(func, wait, args) {\r\n return baseDelay(func, toNumber(wait) || 0, args);\r\n });\r\n\r\n /**\r\n * Creates a function that memoizes the result of `func`. If `resolver` is\r\n * provided, it determines the cache key for storing the result based on the\r\n * arguments provided to the memoized function. By default, the first argument\r\n * provided to the memoized function is used as the map cache key. The `func`\r\n * is invoked with the `this` binding of the memoized function.\r\n *\r\n * **Note:** The cache is exposed as the `cache` property on the memoized\r\n * function. Its creation may be customized by replacing the `_.memoize.Cache`\r\n * constructor with one whose instances implement the\r\n * [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object)\r\n * method interface of `clear`, `delete`, `get`, `has`, and `set`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to have its output memoized.\r\n * @param {Function} [resolver] The function to resolve the cache key.\r\n * @returns {Function} Returns the new memoized function.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': 2 };\r\n * var other = { 'c': 3, 'd': 4 };\r\n *\r\n * var values = _.memoize(_.values);\r\n * values(object);\r\n * // => [1, 2]\r\n *\r\n * values(other);\r\n * // => [3, 4]\r\n *\r\n * object.a = 2;\r\n * values(object);\r\n * // => [1, 2]\r\n *\r\n * // Modify the result cache.\r\n * values.cache.set(object, ['a', 'b']);\r\n * values(object);\r\n * // => ['a', 'b']\r\n *\r\n * // Replace `_.memoize.Cache`.\r\n * _.memoize.Cache = WeakMap;\r\n */\r\n function memoize(func, resolver) {\r\n if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n var memoized = function() {\r\n var args = arguments,\r\n key = resolver ? resolver.apply(this, args) : args[0],\r\n cache = memoized.cache;\r\n\r\n if (cache.has(key)) {\r\n return cache.get(key);\r\n }\r\n var result = func.apply(this, args);\r\n memoized.cache = cache.set(key, result) || cache;\r\n return result;\r\n };\r\n memoized.cache = new (memoize.Cache || MapCache);\r\n return memoized;\r\n }\r\n\r\n // Expose `MapCache`.\r\n memoize.Cache = MapCache;\r\n\r\n /**\r\n * Creates a function that negates the result of the predicate `func`. The\r\n * `func` predicate is invoked with the `this` binding and arguments of the\r\n * created function.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Function\r\n * @param {Function} predicate The predicate to negate.\r\n * @returns {Function} Returns the new negated function.\r\n * @example\r\n *\r\n * function isEven(n) {\r\n * return n % 2 == 0;\r\n * }\r\n *\r\n * _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven));\r\n * // => [1, 3, 5]\r\n */\r\n function negate(predicate) {\r\n if (typeof predicate != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n return function() {\r\n var args = arguments;\r\n switch (args.length) {\r\n case 0: return !predicate.call(this);\r\n case 1: return !predicate.call(this, args[0]);\r\n case 2: return !predicate.call(this, args[0], args[1]);\r\n case 3: return !predicate.call(this, args[0], args[1], args[2]);\r\n }\r\n return !predicate.apply(this, args);\r\n };\r\n }\r\n\r\n /**\r\n * Creates a function that is restricted to invoking `func` once. Repeat calls\r\n * to the function return the value of the first invocation. The `func` is\r\n * invoked with the `this` binding and arguments of the created function.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to restrict.\r\n * @returns {Function} Returns the new restricted function.\r\n * @example\r\n *\r\n * var initialize = _.once(createApplication);\r\n * initialize();\r\n * initialize();\r\n * // => `createApplication` is invoked once\r\n */\r\n function once(func) {\r\n return before(2, func);\r\n }\r\n\r\n /**\r\n * Creates a function that invokes `func` with the `this` binding of the\r\n * created function and arguments from `start` and beyond provided as\r\n * an array.\r\n *\r\n * **Note:** This method is based on the\r\n * [rest parameter](https://mdn.io/rest_parameters).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Function\r\n * @param {Function} func The function to apply a rest parameter to.\r\n * @param {number} [start=func.length-1] The start position of the rest parameter.\r\n * @returns {Function} Returns the new function.\r\n * @example\r\n *\r\n * var say = _.rest(function(what, names) {\r\n * return what + ' ' + _.initial(names).join(', ') +\r\n * (_.size(names) > 1 ? ', & ' : '') + _.last(names);\r\n * });\r\n *\r\n * say('hello', 'fred', 'barney', 'pebbles');\r\n * // => 'hello fred, barney, & pebbles'\r\n */\r\n function rest(func, start) {\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n start = start === undefined ? start : toInteger(start);\r\n return baseRest(func, start);\r\n }\r\n\r\n /**\r\n * Creates a throttled function that only invokes `func` at most once per\r\n * every `wait` milliseconds. The throttled function comes with a `cancel`\r\n * method to cancel delayed `func` invocations and a `flush` method to\r\n * immediately invoke them. Provide `options` to indicate whether `func`\r\n * should be invoked on the leading and/or trailing edge of the `wait`\r\n * timeout. The `func` is invoked with the last arguments provided to the\r\n * throttled function. Subsequent calls to the throttled function return the\r\n * result of the last `func` invocation.\r\n *\r\n * **Note:** If `leading` and `trailing` options are `true`, `func` is\r\n * invoked on the trailing edge of the timeout only if the throttled function\r\n * is invoked more than once during the `wait` timeout.\r\n *\r\n * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred\r\n * until to the next tick, similar to `setTimeout` with a timeout of `0`.\r\n *\r\n * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)\r\n * for details over the differences between `_.throttle` and `_.debounce`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Function\r\n * @param {Function} func The function to throttle.\r\n * @param {number} [wait=0] The number of milliseconds to throttle invocations to.\r\n * @param {Object} [options={}] The options object.\r\n * @param {boolean} [options.leading=true]\r\n * Specify invoking on the leading edge of the timeout.\r\n * @param {boolean} [options.trailing=true]\r\n * Specify invoking on the trailing edge of the timeout.\r\n * @returns {Function} Returns the new throttled function.\r\n * @example\r\n *\r\n * // Avoid excessively updating the position while scrolling.\r\n * jQuery(window).on('scroll', _.throttle(updatePosition, 100));\r\n *\r\n * // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes.\r\n * var throttled = _.throttle(renewToken, 300000, { 'trailing': false });\r\n * jQuery(element).on('click', throttled);\r\n *\r\n * // Cancel the trailing throttled invocation.\r\n * jQuery(window).on('popstate', throttled.cancel);\r\n */\r\n function throttle(func, wait, options) {\r\n var leading = true,\r\n trailing = true;\r\n\r\n if (typeof func != 'function') {\r\n throw new TypeError(FUNC_ERROR_TEXT);\r\n }\r\n if (isObject(options)) {\r\n leading = 'leading' in options ? !!options.leading : leading;\r\n trailing = 'trailing' in options ? !!options.trailing : trailing;\r\n }\r\n return debounce(func, wait, {\r\n 'leading': leading,\r\n 'maxWait': wait,\r\n 'trailing': trailing\r\n });\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a shallow clone of `value`.\r\n *\r\n * **Note:** This method is loosely based on the\r\n * [structured clone algorithm](https://mdn.io/Structured_clone_algorithm)\r\n * and supports cloning arrays, array buffers, booleans, date objects, maps,\r\n * numbers, `Object` objects, regexes, sets, strings, symbols, and typed\r\n * arrays. The own enumerable properties of `arguments` objects are cloned\r\n * as plain objects. An empty object is returned for uncloneable values such\r\n * as error objects, functions, DOM nodes, and WeakMaps.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to clone.\r\n * @returns {*} Returns the cloned value.\r\n * @see _.cloneDeep\r\n * @example\r\n *\r\n * var objects = [{ 'a': 1 }, { 'b': 2 }];\r\n *\r\n * var shallow = _.clone(objects);\r\n * console.log(shallow[0] === objects[0]);\r\n * // => true\r\n */\r\n function clone(value) {\r\n return baseClone(value, CLONE_SYMBOLS_FLAG);\r\n }\r\n\r\n /**\r\n * This method is like `_.clone` except that it recursively clones `value`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 1.0.0\r\n * @category Lang\r\n * @param {*} value The value to recursively clone.\r\n * @returns {*} Returns the deep cloned value.\r\n * @see _.clone\r\n * @example\r\n *\r\n * var objects = [{ 'a': 1 }, { 'b': 2 }];\r\n *\r\n * var deep = _.cloneDeep(objects);\r\n * console.log(deep[0] === objects[0]);\r\n * // => false\r\n */\r\n function cloneDeep(value) {\r\n return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG);\r\n }\r\n\r\n /**\r\n * Performs a\r\n * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\r\n * comparison between two values to determine if they are equivalent.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\r\n * @example\r\n *\r\n * var object = { 'a': 1 };\r\n * var other = { 'a': 1 };\r\n *\r\n * _.eq(object, object);\r\n * // => true\r\n *\r\n * _.eq(object, other);\r\n * // => false\r\n *\r\n * _.eq('a', 'a');\r\n * // => true\r\n *\r\n * _.eq('a', Object('a'));\r\n * // => false\r\n *\r\n * _.eq(NaN, NaN);\r\n * // => true\r\n */\r\n function eq(value, other) {\r\n return value === other || (value !== value && other !== other);\r\n }\r\n\r\n /**\r\n * Checks if `value` is likely an `arguments` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is an `arguments` object,\r\n * else `false`.\r\n * @example\r\n *\r\n * _.isArguments(function() { return arguments; }());\r\n * // => true\r\n *\r\n * _.isArguments([1, 2, 3]);\r\n * // => false\r\n */\r\n var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) {\r\n return isObjectLike(value) && hasOwnProperty.call(value, 'callee') &&\r\n !propertyIsEnumerable.call(value, 'callee');\r\n };\r\n\r\n /**\r\n * Checks if `value` is classified as an `Array` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is an array, else `false`.\r\n * @example\r\n *\r\n * _.isArray([1, 2, 3]);\r\n * // => true\r\n *\r\n * _.isArray(document.body.children);\r\n * // => false\r\n *\r\n * _.isArray('abc');\r\n * // => false\r\n *\r\n * _.isArray(_.noop);\r\n * // => false\r\n */\r\n var isArray = Array.isArray;\r\n\r\n /**\r\n * Checks if `value` is array-like. A value is considered array-like if it's\r\n * not a function and has a `value.length` that's an integer greater than or\r\n * equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is array-like, else `false`.\r\n * @example\r\n *\r\n * _.isArrayLike([1, 2, 3]);\r\n * // => true\r\n *\r\n * _.isArrayLike(document.body.children);\r\n * // => true\r\n *\r\n * _.isArrayLike('abc');\r\n * // => true\r\n *\r\n * _.isArrayLike(_.noop);\r\n * // => false\r\n */\r\n function isArrayLike(value) {\r\n return value != null && isLength(value.length) && !isFunction(value);\r\n }\r\n\r\n /**\r\n * This method is like `_.isArrayLike` except that it also checks if `value`\r\n * is an object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is an array-like object,\r\n * else `false`.\r\n * @example\r\n *\r\n * _.isArrayLikeObject([1, 2, 3]);\r\n * // => true\r\n *\r\n * _.isArrayLikeObject(document.body.children);\r\n * // => true\r\n *\r\n * _.isArrayLikeObject('abc');\r\n * // => false\r\n *\r\n * _.isArrayLikeObject(_.noop);\r\n * // => false\r\n */\r\n function isArrayLikeObject(value) {\r\n return isObjectLike(value) && isArrayLike(value);\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a boolean primitive or object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a boolean, else `false`.\r\n * @example\r\n *\r\n * _.isBoolean(false);\r\n * // => true\r\n *\r\n * _.isBoolean(null);\r\n * // => false\r\n */\r\n function isBoolean(value) {\r\n return value === true || value === false ||\r\n (isObjectLike(value) && baseGetTag(value) == boolTag);\r\n }\r\n\r\n /**\r\n * Checks if `value` is a buffer.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.3.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a buffer, else `false`.\r\n * @example\r\n *\r\n * _.isBuffer(new Buffer(2));\r\n * // => true\r\n *\r\n * _.isBuffer(new Uint8Array(2));\r\n * // => false\r\n */\r\n var isBuffer = nativeIsBuffer || stubFalse;\r\n\r\n /**\r\n * Checks if `value` is classified as a `Date` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a date object, else `false`.\r\n * @example\r\n *\r\n * _.isDate(new Date);\r\n * // => true\r\n *\r\n * _.isDate('Mon April 23 2012');\r\n * // => false\r\n */\r\n var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate;\r\n\r\n /**\r\n * Checks if `value` is an empty object, collection, map, or set.\r\n *\r\n * Objects are considered empty if they have no own enumerable string keyed\r\n * properties.\r\n *\r\n * Array-like values such as `arguments` objects, arrays, buffers, strings, or\r\n * jQuery-like collections are considered empty if they have a `length` of `0`.\r\n * Similarly, maps and sets are considered empty if they have a `size` of `0`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is empty, else `false`.\r\n * @example\r\n *\r\n * _.isEmpty(null);\r\n * // => true\r\n *\r\n * _.isEmpty(true);\r\n * // => true\r\n *\r\n * _.isEmpty(1);\r\n * // => true\r\n *\r\n * _.isEmpty([1, 2, 3]);\r\n * // => false\r\n *\r\n * _.isEmpty({ 'a': 1 });\r\n * // => false\r\n */\r\n function isEmpty(value) {\r\n if (value == null) {\r\n return true;\r\n }\r\n if (isArrayLike(value) &&\r\n (isArray(value) || typeof value == 'string' || typeof value.splice == 'function' ||\r\n isBuffer(value) || isTypedArray(value) || isArguments(value))) {\r\n return !value.length;\r\n }\r\n var tag = getTag(value);\r\n if (tag == mapTag || tag == setTag) {\r\n return !value.size;\r\n }\r\n if (isPrototype(value)) {\r\n return !baseKeys(value).length;\r\n }\r\n for (var key in value) {\r\n if (hasOwnProperty.call(value, key)) {\r\n return false;\r\n }\r\n }\r\n return true;\r\n }\r\n\r\n /**\r\n * Performs a deep comparison between two values to determine if they are\r\n * equivalent.\r\n *\r\n * **Note:** This method supports comparing arrays, array buffers, booleans,\r\n * date objects, error objects, maps, numbers, `Object` objects, regexes,\r\n * sets, strings, symbols, and typed arrays. `Object` objects are compared\r\n * by their own, not inherited, enumerable properties. Functions and DOM\r\n * nodes are compared by strict equality, i.e. `===`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to compare.\r\n * @param {*} other The other value to compare.\r\n * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\r\n * @example\r\n *\r\n * var object = { 'a': 1 };\r\n * var other = { 'a': 1 };\r\n *\r\n * _.isEqual(object, other);\r\n * // => true\r\n *\r\n * object === other;\r\n * // => false\r\n */\r\n function isEqual(value, other) {\r\n return baseIsEqual(value, other);\r\n }\r\n\r\n /**\r\n * Checks if `value` is a finite primitive number.\r\n *\r\n * **Note:** This method is based on\r\n * [`Number.isFinite`](https://mdn.io/Number/isFinite).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a finite number, else `false`.\r\n * @example\r\n *\r\n * _.isFinite(3);\r\n * // => true\r\n *\r\n * _.isFinite(Number.MIN_VALUE);\r\n * // => true\r\n *\r\n * _.isFinite(Infinity);\r\n * // => false\r\n *\r\n * _.isFinite('3');\r\n * // => false\r\n */\r\n function isFinite(value) {\r\n return typeof value == 'number' && nativeIsFinite(value);\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a `Function` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a function, else `false`.\r\n * @example\r\n *\r\n * _.isFunction(_);\r\n * // => true\r\n *\r\n * _.isFunction(/abc/);\r\n * // => false\r\n */\r\n function isFunction(value) {\r\n if (!isObject(value)) {\r\n return false;\r\n }\r\n // The use of `Object#toString` avoids issues with the `typeof` operator\r\n // in Safari 9 which returns 'object' for typed arrays and other constructors.\r\n var tag = baseGetTag(value);\r\n return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag;\r\n }\r\n\r\n /**\r\n * Checks if `value` is a valid array-like length.\r\n *\r\n * **Note:** This method is loosely based on\r\n * [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a valid length, else `false`.\r\n * @example\r\n *\r\n * _.isLength(3);\r\n * // => true\r\n *\r\n * _.isLength(Number.MIN_VALUE);\r\n * // => false\r\n *\r\n * _.isLength(Infinity);\r\n * // => false\r\n *\r\n * _.isLength('3');\r\n * // => false\r\n */\r\n function isLength(value) {\r\n return typeof value == 'number' &&\r\n value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER;\r\n }\r\n\r\n /**\r\n * Checks if `value` is the\r\n * [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types)\r\n * of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`)\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is an object, else `false`.\r\n * @example\r\n *\r\n * _.isObject({});\r\n * // => true\r\n *\r\n * _.isObject([1, 2, 3]);\r\n * // => true\r\n *\r\n * _.isObject(_.noop);\r\n * // => true\r\n *\r\n * _.isObject(null);\r\n * // => false\r\n */\r\n function isObject(value) {\r\n var type = typeof value;\r\n return value != null && (type == 'object' || type == 'function');\r\n }\r\n\r\n /**\r\n * Checks if `value` is object-like. A value is object-like if it's not `null`\r\n * and has a `typeof` result of \"object\".\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is object-like, else `false`.\r\n * @example\r\n *\r\n * _.isObjectLike({});\r\n * // => true\r\n *\r\n * _.isObjectLike([1, 2, 3]);\r\n * // => true\r\n *\r\n * _.isObjectLike(_.noop);\r\n * // => false\r\n *\r\n * _.isObjectLike(null);\r\n * // => false\r\n */\r\n function isObjectLike(value) {\r\n return value != null && typeof value == 'object';\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a `Map` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.3.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a map, else `false`.\r\n * @example\r\n *\r\n * _.isMap(new Map);\r\n * // => true\r\n *\r\n * _.isMap(new WeakMap);\r\n * // => false\r\n */\r\n var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap;\r\n\r\n /**\r\n * Checks if `value` is `NaN`.\r\n *\r\n * **Note:** This method is based on\r\n * [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as\r\n * global [`isNaN`](https://mdn.io/isNaN) which returns `true` for\r\n * `undefined` and other non-number values.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.\r\n * @example\r\n *\r\n * _.isNaN(NaN);\r\n * // => true\r\n *\r\n * _.isNaN(new Number(NaN));\r\n * // => true\r\n *\r\n * isNaN(undefined);\r\n * // => true\r\n *\r\n * _.isNaN(undefined);\r\n * // => false\r\n */\r\n function isNaN(value) {\r\n // An `NaN` primitive is the only value that is not equal to itself.\r\n // Perform the `toStringTag` check first to avoid errors with some\r\n // ActiveX objects in IE.\r\n return isNumber(value) && value != +value;\r\n }\r\n\r\n /**\r\n * Checks if `value` is `null`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is `null`, else `false`.\r\n * @example\r\n *\r\n * _.isNull(null);\r\n * // => true\r\n *\r\n * _.isNull(void 0);\r\n * // => false\r\n */\r\n function isNull(value) {\r\n return value === null;\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a `Number` primitive or object.\r\n *\r\n * **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are\r\n * classified as numbers, use the `_.isFinite` method.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a number, else `false`.\r\n * @example\r\n *\r\n * _.isNumber(3);\r\n * // => true\r\n *\r\n * _.isNumber(Number.MIN_VALUE);\r\n * // => true\r\n *\r\n * _.isNumber(Infinity);\r\n * // => true\r\n *\r\n * _.isNumber('3');\r\n * // => false\r\n */\r\n function isNumber(value) {\r\n return typeof value == 'number' ||\r\n (isObjectLike(value) && baseGetTag(value) == numberTag);\r\n }\r\n\r\n /**\r\n * Checks if `value` is a plain object, that is, an object created by the\r\n * `Object` constructor or one with a `[[Prototype]]` of `null`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.8.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a plain object, else `false`.\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.a = 1;\r\n * }\r\n *\r\n * _.isPlainObject(new Foo);\r\n * // => false\r\n *\r\n * _.isPlainObject([1, 2, 3]);\r\n * // => false\r\n *\r\n * _.isPlainObject({ 'x': 0, 'y': 0 });\r\n * // => true\r\n *\r\n * _.isPlainObject(Object.create(null));\r\n * // => true\r\n */\r\n function isPlainObject(value) {\r\n if (!isObjectLike(value) || baseGetTag(value) != objectTag) {\r\n return false;\r\n }\r\n var proto = getPrototype(value);\r\n if (proto === null) {\r\n return true;\r\n }\r\n var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor;\r\n return typeof Ctor == 'function' && Ctor instanceof Ctor &&\r\n funcToString.call(Ctor) == objectCtorString;\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a `RegExp` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.1.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.\r\n * @example\r\n *\r\n * _.isRegExp(/abc/);\r\n * // => true\r\n *\r\n * _.isRegExp('/abc/');\r\n * // => false\r\n */\r\n var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp;\r\n\r\n /**\r\n * Checks if `value` is classified as a `Set` object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.3.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a set, else `false`.\r\n * @example\r\n *\r\n * _.isSet(new Set);\r\n * // => true\r\n *\r\n * _.isSet(new WeakSet);\r\n * // => false\r\n */\r\n var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet;\r\n\r\n /**\r\n * Checks if `value` is classified as a `String` primitive or object.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a string, else `false`.\r\n * @example\r\n *\r\n * _.isString('abc');\r\n * // => true\r\n *\r\n * _.isString(1);\r\n * // => false\r\n */\r\n function isString(value) {\r\n return typeof value == 'string' ||\r\n (!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag);\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a `Symbol` primitive or object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a symbol, else `false`.\r\n * @example\r\n *\r\n * _.isSymbol(Symbol.iterator);\r\n * // => true\r\n *\r\n * _.isSymbol('abc');\r\n * // => false\r\n */\r\n function isSymbol(value) {\r\n return typeof value == 'symbol' ||\r\n (isObjectLike(value) && baseGetTag(value) == symbolTag);\r\n }\r\n\r\n /**\r\n * Checks if `value` is classified as a typed array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.\r\n * @example\r\n *\r\n * _.isTypedArray(new Uint8Array);\r\n * // => true\r\n *\r\n * _.isTypedArray([]);\r\n * // => false\r\n */\r\n var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray;\r\n\r\n /**\r\n * Checks if `value` is `undefined`.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Lang\r\n * @param {*} value The value to check.\r\n * @returns {boolean} Returns `true` if `value` is `undefined`, else `false`.\r\n * @example\r\n *\r\n * _.isUndefined(void 0);\r\n * // => true\r\n *\r\n * _.isUndefined(null);\r\n * // => false\r\n */\r\n function isUndefined(value) {\r\n return value === undefined;\r\n }\r\n\r\n /**\r\n * Converts `value` to an array.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Lang\r\n * @param {*} value The value to convert.\r\n * @returns {Array} Returns the converted array.\r\n * @example\r\n *\r\n * _.toArray({ 'a': 1, 'b': 2 });\r\n * // => [1, 2]\r\n *\r\n * _.toArray('abc');\r\n * // => ['a', 'b', 'c']\r\n *\r\n * _.toArray(1);\r\n * // => []\r\n *\r\n * _.toArray(null);\r\n * // => []\r\n */\r\n function toArray(value) {\r\n if (!value) {\r\n return [];\r\n }\r\n if (isArrayLike(value)) {\r\n return isString(value) ? stringToArray(value) : copyArray(value);\r\n }\r\n if (symIterator && value[symIterator]) {\r\n return iteratorToArray(value[symIterator]());\r\n }\r\n var tag = getTag(value),\r\n func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values);\r\n\r\n return func(value);\r\n }\r\n\r\n /**\r\n * Converts `value` to a finite number.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.12.0\r\n * @category Lang\r\n * @param {*} value The value to convert.\r\n * @returns {number} Returns the converted number.\r\n * @example\r\n *\r\n * _.toFinite(3.2);\r\n * // => 3.2\r\n *\r\n * _.toFinite(Number.MIN_VALUE);\r\n * // => 5e-324\r\n *\r\n * _.toFinite(Infinity);\r\n * // => 1.7976931348623157e+308\r\n *\r\n * _.toFinite('3.2');\r\n * // => 3.2\r\n */\r\n function toFinite(value) {\r\n if (!value) {\r\n return value === 0 ? value : 0;\r\n }\r\n value = toNumber(value);\r\n if (value === INFINITY || value === -INFINITY) {\r\n var sign = (value < 0 ? -1 : 1);\r\n return sign * MAX_INTEGER;\r\n }\r\n return value === value ? value : 0;\r\n }\r\n\r\n /**\r\n * Converts `value` to an integer.\r\n *\r\n * **Note:** This method is loosely based on\r\n * [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to convert.\r\n * @returns {number} Returns the converted integer.\r\n * @example\r\n *\r\n * _.toInteger(3.2);\r\n * // => 3\r\n *\r\n * _.toInteger(Number.MIN_VALUE);\r\n * // => 0\r\n *\r\n * _.toInteger(Infinity);\r\n * // => 1.7976931348623157e+308\r\n *\r\n * _.toInteger('3.2');\r\n * // => 3\r\n */\r\n function toInteger(value) {\r\n var result = toFinite(value),\r\n remainder = result % 1;\r\n\r\n return result === result ? (remainder ? result - remainder : result) : 0;\r\n }\r\n\r\n /**\r\n * Converts `value` to a number.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to process.\r\n * @returns {number} Returns the number.\r\n * @example\r\n *\r\n * _.toNumber(3.2);\r\n * // => 3.2\r\n *\r\n * _.toNumber(Number.MIN_VALUE);\r\n * // => 5e-324\r\n *\r\n * _.toNumber(Infinity);\r\n * // => Infinity\r\n *\r\n * _.toNumber('3.2');\r\n * // => 3.2\r\n */\r\n function toNumber(value) {\r\n if (typeof value == 'number') {\r\n return value;\r\n }\r\n if (isSymbol(value)) {\r\n return NAN;\r\n }\r\n if (isObject(value)) {\r\n var other = typeof value.valueOf == 'function' ? value.valueOf() : value;\r\n value = isObject(other) ? (other + '') : other;\r\n }\r\n if (typeof value != 'string') {\r\n return value === 0 ? value : +value;\r\n }\r\n value = value.replace(reTrim, '');\r\n var isBinary = reIsBinary.test(value);\r\n return (isBinary || reIsOctal.test(value))\r\n ? freeParseInt(value.slice(2), isBinary ? 2 : 8)\r\n : (reIsBadHex.test(value) ? NAN : +value);\r\n }\r\n\r\n /**\r\n * Converts `value` to a plain object flattening inherited enumerable string\r\n * keyed properties of `value` to own properties of the plain object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Lang\r\n * @param {*} value The value to convert.\r\n * @returns {Object} Returns the converted plain object.\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.b = 2;\r\n * }\r\n *\r\n * Foo.prototype.c = 3;\r\n *\r\n * _.assign({ 'a': 1 }, new Foo);\r\n * // => { 'a': 1, 'b': 2 }\r\n *\r\n * _.assign({ 'a': 1 }, _.toPlainObject(new Foo));\r\n * // => { 'a': 1, 'b': 2, 'c': 3 }\r\n */\r\n function toPlainObject(value) {\r\n return copyObject(value, keysIn(value));\r\n }\r\n\r\n /**\r\n * Converts `value` to a string. An empty string is returned for `null`\r\n * and `undefined` values. The sign of `-0` is preserved.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Lang\r\n * @param {*} value The value to convert.\r\n * @returns {string} Returns the converted string.\r\n * @example\r\n *\r\n * _.toString(null);\r\n * // => ''\r\n *\r\n * _.toString(-0);\r\n * // => '-0'\r\n *\r\n * _.toString([1, 2, 3]);\r\n * // => '1,2,3'\r\n */\r\n function toString(value) {\r\n return value == null ? '' : baseToString(value);\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * This method is like `_.assign` except that it iterates over own and\r\n * inherited source properties.\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @alias extend\r\n * @category Object\r\n * @param {Object} object The destination object.\r\n * @param {...Object} [sources] The source objects.\r\n * @returns {Object} Returns `object`.\r\n * @see _.assign\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.a = 1;\r\n * }\r\n *\r\n * function Bar() {\r\n * this.c = 3;\r\n * }\r\n *\r\n * Foo.prototype.b = 2;\r\n * Bar.prototype.d = 4;\r\n *\r\n * _.assignIn({ 'a': 0 }, new Foo, new Bar);\r\n * // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 }\r\n */\r\n var assignIn = createAssigner(function(object, source) {\r\n copyObject(source, keysIn(source), object);\r\n });\r\n\r\n /**\r\n * Creates an object that inherits from the `prototype` object. If a\r\n * `properties` object is given, its own enumerable string keyed properties\r\n * are assigned to the created object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.3.0\r\n * @category Object\r\n * @param {Object} prototype The object to inherit from.\r\n * @param {Object} [properties] The properties to assign to the object.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * function Shape() {\r\n * this.x = 0;\r\n * this.y = 0;\r\n * }\r\n *\r\n * function Circle() {\r\n * Shape.call(this);\r\n * }\r\n *\r\n * Circle.prototype = _.create(Shape.prototype, {\r\n * 'constructor': Circle\r\n * });\r\n *\r\n * var circle = new Circle;\r\n * circle instanceof Circle;\r\n * // => true\r\n *\r\n * circle instanceof Shape;\r\n * // => true\r\n */\r\n function create(prototype, properties) {\r\n var result = baseCreate(prototype);\r\n return properties == null ? result : baseAssign(result, properties);\r\n }\r\n\r\n /**\r\n * Assigns own and inherited enumerable string keyed properties of source\r\n * objects to the destination object for all destination properties that\r\n * resolve to `undefined`. Source objects are applied from left to right.\r\n * Once a property is set, additional values of the same property are ignored.\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The destination object.\r\n * @param {...Object} [sources] The source objects.\r\n * @returns {Object} Returns `object`.\r\n * @see _.defaultsDeep\r\n * @example\r\n *\r\n * _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 });\r\n * // => { 'a': 1, 'b': 2 }\r\n */\r\n var defaults = baseRest(function(object, sources) {\r\n object = Object(object);\r\n\r\n var index = -1;\r\n var length = sources.length;\r\n var guard = length > 2 ? sources[2] : undefined;\r\n\r\n if (guard && isIterateeCall(sources[0], sources[1], guard)) {\r\n length = 1;\r\n }\r\n\r\n while (++index < length) {\r\n var source = sources[index];\r\n var props = keysIn(source);\r\n var propsIndex = -1;\r\n var propsLength = props.length;\r\n\r\n while (++propsIndex < propsLength) {\r\n var key = props[propsIndex];\r\n var value = object[key];\r\n\r\n if (value === undefined ||\r\n (eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) {\r\n object[key] = source[key];\r\n }\r\n }\r\n }\r\n\r\n return object;\r\n });\r\n\r\n /**\r\n * This method is like `_.defaults` except that it recursively assigns\r\n * default properties.\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.10.0\r\n * @category Object\r\n * @param {Object} object The destination object.\r\n * @param {...Object} [sources] The source objects.\r\n * @returns {Object} Returns `object`.\r\n * @see _.defaults\r\n * @example\r\n *\r\n * _.defaultsDeep({ 'a': { 'b': 2 } }, { 'a': { 'b': 1, 'c': 3 } });\r\n * // => { 'a': { 'b': 2, 'c': 3 } }\r\n */\r\n var defaultsDeep = baseRest(function(args) {\r\n args.push(undefined, customDefaultsMerge);\r\n return apply(mergeWith, undefined, args);\r\n });\r\n\r\n /**\r\n * This method is like `_.find` except that it returns the key of the first\r\n * element `predicate` returns truthy for instead of the element itself.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 1.1.0\r\n * @category Object\r\n * @param {Object} object The object to inspect.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @returns {string|undefined} Returns the key of the matched element,\r\n * else `undefined`.\r\n * @example\r\n *\r\n * var users = {\r\n * 'barney': { 'age': 36, 'active': true },\r\n * 'fred': { 'age': 40, 'active': false },\r\n * 'pebbles': { 'age': 1, 'active': true }\r\n * };\r\n *\r\n * _.findKey(users, function(o) { return o.age < 40; });\r\n * // => 'barney' (iteration order is not guaranteed)\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.findKey(users, { 'age': 1, 'active': true });\r\n * // => 'pebbles'\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.findKey(users, ['active', false]);\r\n * // => 'fred'\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.findKey(users, 'active');\r\n * // => 'barney'\r\n */\r\n function findKey(object, predicate) {\r\n return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn);\r\n }\r\n\r\n /**\r\n * This method is like `_.findKey` except that it iterates over elements of\r\n * a collection in the opposite order.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.0.0\r\n * @category Object\r\n * @param {Object} object The object to inspect.\r\n * @param {Function} [predicate=_.identity] The function invoked per iteration.\r\n * @returns {string|undefined} Returns the key of the matched element,\r\n * else `undefined`.\r\n * @example\r\n *\r\n * var users = {\r\n * 'barney': { 'age': 36, 'active': true },\r\n * 'fred': { 'age': 40, 'active': false },\r\n * 'pebbles': { 'age': 1, 'active': true }\r\n * };\r\n *\r\n * _.findLastKey(users, function(o) { return o.age < 40; });\r\n * // => returns 'pebbles' assuming `_.findKey` returns 'barney'\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.findLastKey(users, { 'age': 36, 'active': true });\r\n * // => 'barney'\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.findLastKey(users, ['active', false]);\r\n * // => 'fred'\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.findLastKey(users, 'active');\r\n * // => 'pebbles'\r\n */\r\n function findLastKey(object, predicate) {\r\n return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight);\r\n }\r\n\r\n /**\r\n * Gets the value at `path` of `object`. If the resolved value is\r\n * `undefined`, the `defaultValue` is returned in its place.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.7.0\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path of the property to get.\r\n * @param {*} [defaultValue] The value returned for `undefined` resolved values.\r\n * @returns {*} Returns the resolved value.\r\n * @example\r\n *\r\n * var object = { 'a': [{ 'b': { 'c': 3 } }] };\r\n *\r\n * _.get(object, 'a[0].b.c');\r\n * // => 3\r\n *\r\n * _.get(object, ['a', '0', 'b', 'c']);\r\n * // => 3\r\n *\r\n * _.get(object, 'a.b.c', 'default');\r\n * // => 'default'\r\n */\r\n function get(object, path, defaultValue) {\r\n var result = object == null ? undefined : baseGet(object, path);\r\n return result === undefined ? defaultValue : result;\r\n }\r\n\r\n /**\r\n * Checks if `path` is a direct property of `object`.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path to check.\r\n * @returns {boolean} Returns `true` if `path` exists, else `false`.\r\n * @example\r\n *\r\n * var object = { 'a': { 'b': 2 } };\r\n * var other = _.create({ 'a': _.create({ 'b': 2 }) });\r\n *\r\n * _.has(object, 'a');\r\n * // => true\r\n *\r\n * _.has(object, 'a.b');\r\n * // => true\r\n *\r\n * _.has(object, ['a', 'b']);\r\n * // => true\r\n *\r\n * _.has(other, 'a');\r\n * // => false\r\n */\r\n function has(object, path) {\r\n return object != null && hasPath(object, path, baseHas);\r\n }\r\n\r\n /**\r\n * Checks if `path` is a direct or inherited property of `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path to check.\r\n * @returns {boolean} Returns `true` if `path` exists, else `false`.\r\n * @example\r\n *\r\n * var object = _.create({ 'a': _.create({ 'b': 2 }) });\r\n *\r\n * _.hasIn(object, 'a');\r\n * // => true\r\n *\r\n * _.hasIn(object, 'a.b');\r\n * // => true\r\n *\r\n * _.hasIn(object, ['a', 'b']);\r\n * // => true\r\n *\r\n * _.hasIn(object, 'b');\r\n * // => false\r\n */\r\n function hasIn(object, path) {\r\n return object != null && hasPath(object, path, baseHasIn);\r\n }\r\n\r\n /**\r\n * Creates an object composed of the inverted keys and values of `object`.\r\n * If `object` contains duplicate values, subsequent values overwrite\r\n * property assignments of previous values.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.7.0\r\n * @category Object\r\n * @param {Object} object The object to invert.\r\n * @returns {Object} Returns the new inverted object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': 2, 'c': 1 };\r\n *\r\n * _.invert(object);\r\n * // => { '1': 'c', '2': 'b' }\r\n */\r\n var invert = createInverter(function(result, value, key) {\r\n if (value != null &&\r\n typeof value.toString != 'function') {\r\n value = nativeObjectToString.call(value);\r\n }\r\n\r\n result[value] = key;\r\n }, constant(identity));\r\n\r\n /**\r\n * This method is like `_.invert` except that the inverted object is generated\r\n * from the results of running each element of `object` thru `iteratee`. The\r\n * corresponding inverted value of each inverted key is an array of keys\r\n * responsible for generating the inverted value. The iteratee is invoked\r\n * with one argument: (value).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.1.0\r\n * @category Object\r\n * @param {Object} object The object to invert.\r\n * @param {Function} [iteratee=_.identity] The iteratee invoked per element.\r\n * @returns {Object} Returns the new inverted object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': 2, 'c': 1 };\r\n *\r\n * _.invertBy(object);\r\n * // => { '1': ['a', 'c'], '2': ['b'] }\r\n *\r\n * _.invertBy(object, function(value) {\r\n * return 'group' + value;\r\n * });\r\n * // => { 'group1': ['a', 'c'], 'group2': ['b'] }\r\n */\r\n var invertBy = createInverter(function(result, value, key) {\r\n if (value != null &&\r\n typeof value.toString != 'function') {\r\n value = nativeObjectToString.call(value);\r\n }\r\n\r\n if (hasOwnProperty.call(result, value)) {\r\n result[value].push(key);\r\n } else {\r\n result[value] = [key];\r\n }\r\n }, baseIteratee);\r\n\r\n /**\r\n * Creates an array of the own enumerable property names of `object`.\r\n *\r\n * **Note:** Non-object values are coerced to objects. See the\r\n * [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)\r\n * for more details.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names.\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.a = 1;\r\n * this.b = 2;\r\n * }\r\n *\r\n * Foo.prototype.c = 3;\r\n *\r\n * _.keys(new Foo);\r\n * // => ['a', 'b'] (iteration order is not guaranteed)\r\n *\r\n * _.keys('hi');\r\n * // => ['0', '1']\r\n */\r\n function keys(object) {\r\n return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object);\r\n }\r\n\r\n /**\r\n * Creates an array of the own and inherited enumerable property names of `object`.\r\n *\r\n * **Note:** Non-object values are coerced to objects.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property names.\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.a = 1;\r\n * this.b = 2;\r\n * }\r\n *\r\n * Foo.prototype.c = 3;\r\n *\r\n * _.keysIn(new Foo);\r\n * // => ['a', 'b', 'c'] (iteration order is not guaranteed)\r\n */\r\n function keysIn(object) {\r\n return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object);\r\n }\r\n\r\n /**\r\n * This method is like `_.assign` except that it recursively merges own and\r\n * inherited enumerable string keyed properties of source objects into the\r\n * destination object. Source properties that resolve to `undefined` are\r\n * skipped if a destination value exists. Array and plain object properties\r\n * are merged recursively. Other objects and value types are overridden by\r\n * assignment. Source objects are applied from left to right. Subsequent\r\n * sources overwrite property assignments of previous sources.\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.5.0\r\n * @category Object\r\n * @param {Object} object The destination object.\r\n * @param {...Object} [sources] The source objects.\r\n * @returns {Object} Returns `object`.\r\n * @example\r\n *\r\n * var object = {\r\n * 'a': [{ 'b': 2 }, { 'd': 4 }]\r\n * };\r\n *\r\n * var other = {\r\n * 'a': [{ 'c': 3 }, { 'e': 5 }]\r\n * };\r\n *\r\n * _.merge(object, other);\r\n * // => { 'a': [{ 'b': 2, 'c': 3 }, { 'd': 4, 'e': 5 }] }\r\n */\r\n var merge = createAssigner(function(object, source, srcIndex) {\r\n baseMerge(object, source, srcIndex);\r\n });\r\n\r\n /**\r\n * This method is like `_.merge` except that it accepts `customizer` which\r\n * is invoked to produce the merged values of the destination and source\r\n * properties. If `customizer` returns `undefined`, merging is handled by the\r\n * method instead. The `customizer` is invoked with six arguments:\r\n * (objValue, srcValue, key, object, source, stack).\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Object\r\n * @param {Object} object The destination object.\r\n * @param {...Object} sources The source objects.\r\n * @param {Function} customizer The function to customize assigned values.\r\n * @returns {Object} Returns `object`.\r\n * @example\r\n *\r\n * function customizer(objValue, srcValue) {\r\n * if (_.isArray(objValue)) {\r\n * return objValue.concat(srcValue);\r\n * }\r\n * }\r\n *\r\n * var object = { 'a': [1], 'b': [2] };\r\n * var other = { 'a': [3], 'b': [4] };\r\n *\r\n * _.mergeWith(object, other, customizer);\r\n * // => { 'a': [1, 3], 'b': [2, 4] }\r\n */\r\n var mergeWith = createAssigner(function(object, source, srcIndex, customizer) {\r\n baseMerge(object, source, srcIndex, customizer);\r\n });\r\n\r\n /**\r\n * The opposite of `_.pick`; this method creates an object composed of the\r\n * own and inherited enumerable property paths of `object` that are not omitted.\r\n *\r\n * **Note:** This method is considerably slower than `_.pick`.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The source object.\r\n * @param {...(string|string[])} [paths] The property paths to omit.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': '2', 'c': 3 };\r\n *\r\n * _.omit(object, ['a', 'c']);\r\n * // => { 'b': '2' }\r\n */\r\n var omit = flatRest(function(object, paths) {\r\n var result = {};\r\n if (object == null) {\r\n return result;\r\n }\r\n var isDeep = false;\r\n paths = arrayMap(paths, function(path) {\r\n path = castPath(path, object);\r\n isDeep || (isDeep = path.length > 1);\r\n return path;\r\n });\r\n copyObject(object, getAllKeysIn(object), result);\r\n if (isDeep) {\r\n result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone);\r\n }\r\n var length = paths.length;\r\n while (length--) {\r\n baseUnset(result, paths[length]);\r\n }\r\n return result;\r\n });\r\n\r\n /**\r\n * The opposite of `_.pickBy`; this method creates an object composed of\r\n * the own and inherited enumerable string keyed properties of `object` that\r\n * `predicate` doesn't return truthy for. The predicate is invoked with two\r\n * arguments: (value, key).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Object\r\n * @param {Object} object The source object.\r\n * @param {Function} [predicate=_.identity] The function invoked per property.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': '2', 'c': 3 };\r\n *\r\n * _.omitBy(object, _.isNumber);\r\n * // => { 'b': '2' }\r\n */\r\n function omitBy(object, predicate) {\r\n return pickBy(object, negate(baseIteratee(predicate)));\r\n }\r\n\r\n /**\r\n * Creates an object composed of the picked `object` properties.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The source object.\r\n * @param {...(string|string[])} [paths] The property paths to pick.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': '2', 'c': 3 };\r\n *\r\n * _.pick(object, ['a', 'c']);\r\n * // => { 'a': 1, 'c': 3 }\r\n */\r\n var pick = flatRest(function(object, paths) {\r\n return object == null ? {} : basePick(object, paths);\r\n });\r\n\r\n /**\r\n * Creates an object composed of the `object` properties `predicate` returns\r\n * truthy for. The predicate is invoked with two arguments: (value, key).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Object\r\n * @param {Object} object The source object.\r\n * @param {Function} [predicate=_.identity] The function invoked per property.\r\n * @returns {Object} Returns the new object.\r\n * @example\r\n *\r\n * var object = { 'a': 1, 'b': '2', 'c': 3 };\r\n *\r\n * _.pickBy(object, _.isNumber);\r\n * // => { 'a': 1, 'c': 3 }\r\n */\r\n function pickBy(object, predicate) {\r\n if (object == null) {\r\n return {};\r\n }\r\n var props = arrayMap(getAllKeysIn(object), function(prop) {\r\n return [prop];\r\n });\r\n predicate = baseIteratee(predicate);\r\n return basePickBy(object, props, function(value, path) {\r\n return predicate(value, path[0]);\r\n });\r\n }\r\n\r\n /**\r\n * This method is like `_.get` except that if the resolved value is a\r\n * function it's invoked with the `this` binding of its parent object and\r\n * its result is returned.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @param {Array|string} path The path of the property to resolve.\r\n * @param {*} [defaultValue] The value returned for `undefined` resolved values.\r\n * @returns {*} Returns the resolved value.\r\n * @example\r\n *\r\n * var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] };\r\n *\r\n * _.result(object, 'a[0].b.c1');\r\n * // => 3\r\n *\r\n * _.result(object, 'a[0].b.c2');\r\n * // => 4\r\n *\r\n * _.result(object, 'a[0].b.c3', 'default');\r\n * // => 'default'\r\n *\r\n * _.result(object, 'a[0].b.c3', _.constant('default'));\r\n * // => 'default'\r\n */\r\n function result(object, path, defaultValue) {\r\n path = castPath(path, object);\r\n\r\n var index = -1,\r\n length = path.length;\r\n\r\n // Ensure the loop is entered when path is empty.\r\n if (!length) {\r\n length = 1;\r\n object = undefined;\r\n }\r\n while (++index < length) {\r\n var value = object == null ? undefined : object[toKey(path[index])];\r\n if (value === undefined) {\r\n index = length;\r\n value = defaultValue;\r\n }\r\n object = isFunction(value) ? value.call(object) : value;\r\n }\r\n return object;\r\n }\r\n\r\n /**\r\n * Sets the value at `path` of `object`. If a portion of `path` doesn't exist,\r\n * it's created. Arrays are created for missing index properties while objects\r\n * are created for all other missing properties. Use `_.setWith` to customize\r\n * `path` creation.\r\n *\r\n * **Note:** This method mutates `object`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.7.0\r\n * @category Object\r\n * @param {Object} object The object to modify.\r\n * @param {Array|string} path The path of the property to set.\r\n * @param {*} value The value to set.\r\n * @returns {Object} Returns `object`.\r\n * @example\r\n *\r\n * var object = { 'a': [{ 'b': { 'c': 3 } }] };\r\n *\r\n * _.set(object, 'a[0].b.c', 4);\r\n * console.log(object.a[0].b.c);\r\n * // => 4\r\n *\r\n * _.set(object, ['x', '0', 'y', 'z'], 5);\r\n * console.log(object.x[0].y.z);\r\n * // => 5\r\n */\r\n function set(object, path, value) {\r\n return object == null ? object : baseSet(object, path, value);\r\n }\r\n\r\n /**\r\n * Creates an array of the own enumerable string keyed property values of `object`.\r\n *\r\n * **Note:** Non-object values are coerced to objects.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Object\r\n * @param {Object} object The object to query.\r\n * @returns {Array} Returns the array of property values.\r\n * @example\r\n *\r\n * function Foo() {\r\n * this.a = 1;\r\n * this.b = 2;\r\n * }\r\n *\r\n * Foo.prototype.c = 3;\r\n *\r\n * _.values(new Foo);\r\n * // => [1, 2] (iteration order is not guaranteed)\r\n *\r\n * _.values('hi');\r\n * // => ['h', 'i']\r\n */\r\n function values(object) {\r\n return object == null ? [] : baseValues(object, keys(object));\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Clamps `number` within the inclusive `lower` and `upper` bounds.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.0.0\r\n * @category Number\r\n * @param {number} number The number to clamp.\r\n * @param {number} [lower] The lower bound.\r\n * @param {number} upper The upper bound.\r\n * @returns {number} Returns the clamped number.\r\n * @example\r\n *\r\n * _.clamp(-10, -5, 5);\r\n * // => -5\r\n *\r\n * _.clamp(10, -5, 5);\r\n * // => 5\r\n */\r\n function clamp(number, lower, upper) {\r\n if (upper === undefined) {\r\n upper = lower;\r\n lower = undefined;\r\n }\r\n if (upper !== undefined) {\r\n upper = toNumber(upper);\r\n upper = upper === upper ? upper : 0;\r\n }\r\n if (lower !== undefined) {\r\n lower = toNumber(lower);\r\n lower = lower === lower ? lower : 0;\r\n }\r\n return baseClamp(toNumber(number), lower, upper);\r\n }\r\n\r\n /**\r\n * Produces a random number between the inclusive `lower` and `upper` bounds.\r\n * If only one argument is provided a number between `0` and the given number\r\n * is returned. If `floating` is `true`, or either `lower` or `upper` are\r\n * floats, a floating-point number is returned instead of an integer.\r\n *\r\n * **Note:** JavaScript follows the IEEE-754 standard for resolving\r\n * floating-point values which can produce unexpected results.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.7.0\r\n * @category Number\r\n * @param {number} [lower=0] The lower bound.\r\n * @param {number} [upper=1] The upper bound.\r\n * @param {boolean} [floating] Specify returning a floating-point number.\r\n * @returns {number} Returns the random number.\r\n * @example\r\n *\r\n * _.random(0, 5);\r\n * // => an integer between 0 and 5\r\n *\r\n * _.random(5);\r\n * // => also an integer between 0 and 5\r\n *\r\n * _.random(5, true);\r\n * // => a floating-point number between 0 and 5\r\n *\r\n * _.random(1.2, 5.2);\r\n * // => a floating-point number between 1.2 and 5.2\r\n */\r\n function random(lower, upper, floating) {\r\n if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) {\r\n upper = floating = undefined;\r\n }\r\n if (floating === undefined) {\r\n if (typeof upper == 'boolean') {\r\n floating = upper;\r\n upper = undefined;\r\n }\r\n else if (typeof lower == 'boolean') {\r\n floating = lower;\r\n lower = undefined;\r\n }\r\n }\r\n if (lower === undefined && upper === undefined) {\r\n lower = 0;\r\n upper = 1;\r\n }\r\n else {\r\n lower = toFinite(lower);\r\n if (upper === undefined) {\r\n upper = lower;\r\n lower = 0;\r\n } else {\r\n upper = toFinite(upper);\r\n }\r\n }\r\n if (lower > upper) {\r\n var temp = lower;\r\n lower = upper;\r\n upper = temp;\r\n }\r\n if (floating || lower % 1 || upper % 1) {\r\n var rand = nativeRandom();\r\n return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper);\r\n }\r\n return baseRandom(lower, upper);\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Converts the characters \"&\", \"<\", \">\", '\"', and \"'\" in `string` to their\r\n * corresponding HTML entities.\r\n *\r\n * **Note:** No other characters are escaped. To escape additional\r\n * characters use a third-party library like [_he_](https://mths.be/he).\r\n *\r\n * Though the \">\" character is escaped for symmetry, characters like\r\n * \">\" and \"/\" don't need escaping in HTML and have no special meaning\r\n * unless they're part of a tag or unquoted attribute value. See\r\n * [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands)\r\n * (under \"semi-related fun fact\") for more details.\r\n *\r\n * When working with HTML you should always\r\n * [quote attribute values](http://wonko.com/post/html-escaping) to reduce\r\n * XSS vectors.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category String\r\n * @param {string} [string=''] The string to escape.\r\n * @returns {string} Returns the escaped string.\r\n * @example\r\n *\r\n * _.escape('fred, barney, & pebbles');\r\n * // => 'fred, barney, & pebbles'\r\n */\r\n function escape(string) {\r\n string = toString(string);\r\n return (string && reHasUnescapedHtml.test(string))\r\n ? string.replace(reUnescapedHtml, escapeHtmlChar)\r\n : string;\r\n }\r\n\r\n /**\r\n * Removes leading and trailing whitespace or specified characters from `string`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category String\r\n * @param {string} [string=''] The string to trim.\r\n * @param {string} [chars=whitespace] The characters to trim.\r\n * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\r\n * @returns {string} Returns the trimmed string.\r\n * @example\r\n *\r\n * _.trim(' abc ');\r\n * // => 'abc'\r\n *\r\n * _.trim('-_-abc-_-', '_-');\r\n * // => 'abc'\r\n *\r\n * _.map([' foo ', ' bar '], _.trim);\r\n * // => ['foo', 'bar']\r\n */\r\n function trim(string, chars, guard) {\r\n string = toString(string);\r\n if (string && (guard || chars === undefined)) {\r\n return string.replace(reTrim, '');\r\n }\r\n if (!string || !(chars = baseToString(chars))) {\r\n return string;\r\n }\r\n var strSymbols = stringToArray(string),\r\n chrSymbols = stringToArray(chars),\r\n start = charsStartIndex(strSymbols, chrSymbols),\r\n end = charsEndIndex(strSymbols, chrSymbols) + 1;\r\n\r\n return castSlice(strSymbols, start, end).join('');\r\n }\r\n\r\n /**\r\n * The inverse of `_.escape`; this method converts the HTML entities\r\n * `&`, `<`, `>`, `"`, and `'` in `string` to\r\n * their corresponding characters.\r\n *\r\n * **Note:** No other HTML entities are unescaped. To unescape additional\r\n * HTML entities use a third-party library like [_he_](https://mths.be/he).\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 0.6.0\r\n * @category String\r\n * @param {string} [string=''] The string to unescape.\r\n * @returns {string} Returns the unescaped string.\r\n * @example\r\n *\r\n * _.unescape('fred, barney, & pebbles');\r\n * // => 'fred, barney, & pebbles'\r\n */\r\n function unescape(string) {\r\n string = toString(string);\r\n return (string && reHasEscapedHtml.test(string))\r\n ? string.replace(reEscapedHtml, unescapeHtmlChar)\r\n : string;\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Creates a function that returns `value`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.4.0\r\n * @category Util\r\n * @param {*} value The value to return from the new function.\r\n * @returns {Function} Returns the new constant function.\r\n * @example\r\n *\r\n * var objects = _.times(2, _.constant({ 'a': 1 }));\r\n *\r\n * console.log(objects);\r\n * // => [{ 'a': 1 }, { 'a': 1 }]\r\n *\r\n * console.log(objects[0] === objects[1]);\r\n * // => true\r\n */\r\n function constant(value) {\r\n return function() {\r\n return value;\r\n };\r\n }\r\n\r\n /**\r\n * This method returns the first argument it receives.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Util\r\n * @param {*} value Any value.\r\n * @returns {*} Returns `value`.\r\n * @example\r\n *\r\n * var object = { 'a': 1 };\r\n *\r\n * console.log(_.identity(object) === object);\r\n * // => true\r\n */\r\n function identity(value) {\r\n return value;\r\n }\r\n\r\n /**\r\n * Creates a function that invokes `func` with the arguments of the created\r\n * function. If `func` is a property name, the created function returns the\r\n * property value for a given element. If `func` is an array or object, the\r\n * created function returns `true` for elements that contain the equivalent\r\n * source properties, otherwise it returns `false`.\r\n *\r\n * @static\r\n * @since 4.0.0\r\n * @memberOf _\r\n * @category Util\r\n * @param {*} [func=_.identity] The value to convert to a callback.\r\n * @returns {Function} Returns the callback.\r\n * @example\r\n *\r\n * var users = [\r\n * { 'user': 'barney', 'age': 36, 'active': true },\r\n * { 'user': 'fred', 'age': 40, 'active': false }\r\n * ];\r\n *\r\n * // The `_.matches` iteratee shorthand.\r\n * _.filter(users, _.iteratee({ 'user': 'barney', 'active': true }));\r\n * // => [{ 'user': 'barney', 'age': 36, 'active': true }]\r\n *\r\n * // The `_.matchesProperty` iteratee shorthand.\r\n * _.filter(users, _.iteratee(['user', 'fred']));\r\n * // => [{ 'user': 'fred', 'age': 40 }]\r\n *\r\n * // The `_.property` iteratee shorthand.\r\n * _.map(users, _.iteratee('user'));\r\n * // => ['barney', 'fred']\r\n *\r\n * // Create custom iteratee shorthands.\r\n * _.iteratee = _.wrap(_.iteratee, function(iteratee, func) {\r\n * return !_.isRegExp(func) ? iteratee(func) : function(string) {\r\n * return func.test(string);\r\n * };\r\n * });\r\n *\r\n * _.filter(['abc', 'def'], /ef/);\r\n * // => ['def']\r\n */\r\n function iteratee(func) {\r\n return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG));\r\n }\r\n\r\n /**\r\n * Creates a function that performs a partial deep comparison between a given\r\n * object and `source`, returning `true` if the given object has equivalent\r\n * property values, else `false`.\r\n *\r\n * **Note:** The created function is equivalent to `_.isMatch` with `source`\r\n * partially applied.\r\n *\r\n * Partial comparisons will match empty array and empty object `source`\r\n * values against any array or object value, respectively. See `_.isEqual`\r\n * for a list of supported value comparisons.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 3.0.0\r\n * @category Util\r\n * @param {Object} source The object of property values to match.\r\n * @returns {Function} Returns the new spec function.\r\n * @example\r\n *\r\n * var objects = [\r\n * { 'a': 1, 'b': 2, 'c': 3 },\r\n * { 'a': 4, 'b': 5, 'c': 6 }\r\n * ];\r\n *\r\n * _.filter(objects, _.matches({ 'a': 4, 'c': 6 }));\r\n * // => [{ 'a': 4, 'b': 5, 'c': 6 }]\r\n */\r\n function matches(source) {\r\n return baseMatches(baseClone(source, CLONE_DEEP_FLAG));\r\n }\r\n\r\n /**\r\n * Adds all own enumerable string keyed function properties of a source\r\n * object to the destination object. If `object` is a function, then methods\r\n * are added to its prototype as well.\r\n *\r\n * **Note:** Use `_.runInContext` to create a pristine `lodash` function to\r\n * avoid conflicts caused by modifying the original.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Util\r\n * @param {Function|Object} [object=lodash] The destination object.\r\n * @param {Object} source The object of functions to add.\r\n * @param {Object} [options={}] The options object.\r\n * @param {boolean} [options.chain=true] Specify whether mixins are chainable.\r\n * @returns {Function|Object} Returns `object`.\r\n * @example\r\n *\r\n * function vowels(string) {\r\n * return _.filter(string, function(v) {\r\n * return /[aeiou]/i.test(v);\r\n * });\r\n * }\r\n *\r\n * _.mixin({ 'vowels': vowels });\r\n * _.vowels('fred');\r\n * // => ['e']\r\n *\r\n * _('fred').vowels().value();\r\n * // => ['e']\r\n *\r\n * _.mixin({ 'vowels': vowels }, { 'chain': false });\r\n * _('fred').vowels();\r\n * // => ['e']\r\n */\r\n function mixin(object, source, options) {\r\n var props = keys(source),\r\n methodNames = baseFunctions(source, props);\r\n\r\n if (options == null &&\r\n !(isObject(source) && (methodNames.length || !props.length))) {\r\n options = source;\r\n source = object;\r\n object = this;\r\n methodNames = baseFunctions(source, keys(source));\r\n }\r\n var chain = !(isObject(options) && 'chain' in options) || !!options.chain,\r\n isFunc = isFunction(object);\r\n\r\n arrayEach(methodNames, function(methodName) {\r\n var func = source[methodName];\r\n object[methodName] = func;\r\n if (isFunc) {\r\n object.prototype[methodName] = function() {\r\n var chainAll = this.__chain__;\r\n if (chain || chainAll) {\r\n var result = object(this.__wrapped__),\r\n actions = result.__actions__ = copyArray(this.__actions__);\r\n\r\n actions.push({ 'func': func, 'args': arguments, 'thisArg': object });\r\n result.__chain__ = chainAll;\r\n return result;\r\n }\r\n return func.apply(object, arrayPush([this.value()], arguments));\r\n };\r\n }\r\n });\r\n\r\n return object;\r\n }\r\n\r\n /**\r\n * Reverts the `_` variable to its previous value and returns a reference to\r\n * the `lodash` function.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Util\r\n * @returns {Function} Returns the `lodash` function.\r\n * @example\r\n *\r\n * var lodash = _.noConflict();\r\n */\r\n function noConflict() {\r\n if (root._ === this) {\r\n root._ = oldDash;\r\n }\r\n return this;\r\n }\r\n\r\n /**\r\n * This method returns `undefined`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.3.0\r\n * @category Util\r\n * @example\r\n *\r\n * _.times(2, _.noop);\r\n * // => [undefined, undefined]\r\n */\r\n function noop() {\r\n // No operation performed.\r\n }\r\n\r\n /**\r\n * Creates a function that returns the value at `path` of a given object.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 2.4.0\r\n * @category Util\r\n * @param {Array|string} path The path of the property to get.\r\n * @returns {Function} Returns the new accessor function.\r\n * @example\r\n *\r\n * var objects = [\r\n * { 'a': { 'b': 2 } },\r\n * { 'a': { 'b': 1 } }\r\n * ];\r\n *\r\n * _.map(objects, _.property('a.b'));\r\n * // => [2, 1]\r\n *\r\n * _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b');\r\n * // => [1, 2]\r\n */\r\n function property(path) {\r\n return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path);\r\n }\r\n\r\n /**\r\n * Creates an array of numbers (positive and/or negative) progressing from\r\n * `start` up to, but not including, `end`. A step of `-1` is used if a negative\r\n * `start` is specified without an `end` or `step`. If `end` is not specified,\r\n * it's set to `start` with `start` then set to `0`.\r\n *\r\n * **Note:** JavaScript follows the IEEE-754 standard for resolving\r\n * floating-point values which can produce unexpected results.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Util\r\n * @param {number} [start=0] The start of the range.\r\n * @param {number} end The end of the range.\r\n * @param {number} [step=1] The value to increment or decrement by.\r\n * @returns {Array} Returns the range of numbers.\r\n * @see _.inRange, _.rangeRight\r\n * @example\r\n *\r\n * _.range(4);\r\n * // => [0, 1, 2, 3]\r\n *\r\n * _.range(-4);\r\n * // => [0, -1, -2, -3]\r\n *\r\n * _.range(1, 5);\r\n * // => [1, 2, 3, 4]\r\n *\r\n * _.range(0, 20, 5);\r\n * // => [0, 5, 10, 15]\r\n *\r\n * _.range(0, -4, -1);\r\n * // => [0, -1, -2, -3]\r\n *\r\n * _.range(1, 4, 0);\r\n * // => [1, 1, 1]\r\n *\r\n * _.range(0);\r\n * // => []\r\n */\r\n var range = createRange();\r\n\r\n /**\r\n * This method returns a new empty array.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.13.0\r\n * @category Util\r\n * @returns {Array} Returns the new empty array.\r\n * @example\r\n *\r\n * var arrays = _.times(2, _.stubArray);\r\n *\r\n * console.log(arrays);\r\n * // => [[], []]\r\n *\r\n * console.log(arrays[0] === arrays[1]);\r\n * // => false\r\n */\r\n function stubArray() {\r\n return [];\r\n }\r\n\r\n /**\r\n * This method returns `false`.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @since 4.13.0\r\n * @category Util\r\n * @returns {boolean} Returns `false`.\r\n * @example\r\n *\r\n * _.times(2, _.stubFalse);\r\n * // => [false, false]\r\n */\r\n function stubFalse() {\r\n return false;\r\n }\r\n\r\n /**\r\n * Generates a unique ID. If `prefix` is given, the ID is appended to it.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Util\r\n * @param {string} [prefix=''] The value to prefix the ID with.\r\n * @returns {string} Returns the unique ID.\r\n * @example\r\n *\r\n * _.uniqueId('contact_');\r\n * // => 'contact_104'\r\n *\r\n * _.uniqueId();\r\n * // => '105'\r\n */\r\n function uniqueId(prefix) {\r\n var id = ++idCounter;\r\n return toString(prefix) + id;\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * Computes the maximum value of `array`. If `array` is empty or falsey,\r\n * `undefined` is returned.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Math\r\n * @param {Array} array The array to iterate over.\r\n * @returns {*} Returns the maximum value.\r\n * @example\r\n *\r\n * _.max([4, 2, 8, 6]);\r\n * // => 8\r\n *\r\n * _.max([]);\r\n * // => undefined\r\n */\r\n function max(array) {\r\n return (array && array.length)\r\n ? baseExtremum(array, identity, baseGt)\r\n : undefined;\r\n }\r\n\r\n /**\r\n * Computes the minimum value of `array`. If `array` is empty or falsey,\r\n * `undefined` is returned.\r\n *\r\n * @static\r\n * @since 0.1.0\r\n * @memberOf _\r\n * @category Math\r\n * @param {Array} array The array to iterate over.\r\n * @returns {*} Returns the minimum value.\r\n * @example\r\n *\r\n * _.min([4, 2, 8, 6]);\r\n * // => 2\r\n *\r\n * _.min([]);\r\n * // => undefined\r\n */\r\n function min(array) {\r\n return (array && array.length)\r\n ? baseExtremum(array, identity, baseLt)\r\n : undefined;\r\n }\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n // Add methods that return wrapped values in chain sequences.\r\n lodash.after = after;\r\n lodash.assignIn = assignIn;\r\n lodash.before = before;\r\n lodash.bind = bind;\r\n lodash.chain = chain;\r\n lodash.compact = compact;\r\n lodash.concat = concat;\r\n lodash.countBy = countBy;\r\n lodash.create = create;\r\n lodash.debounce = debounce;\r\n lodash.defaults = defaults;\r\n lodash.defaultsDeep = defaultsDeep;\r\n lodash.defer = defer;\r\n lodash.delay = delay;\r\n lodash.difference = difference;\r\n lodash.drop = drop;\r\n lodash.filter = filter;\r\n lodash.flatten = flatten;\r\n lodash.flattenDeep = flattenDeep;\r\n lodash.groupBy = groupBy;\r\n lodash.initial = initial;\r\n lodash.intersection = intersection;\r\n lodash.invert = invert;\r\n lodash.invertBy = invertBy;\r\n lodash.iteratee = iteratee;\r\n lodash.keys = keys;\r\n lodash.map = map;\r\n lodash.matches = matches;\r\n lodash.merge = merge;\r\n lodash.mixin = mixin;\r\n lodash.negate = negate;\r\n lodash.omit = omit;\r\n lodash.omitBy = omitBy;\r\n lodash.once = once;\r\n lodash.pick = pick;\r\n lodash.range = range;\r\n lodash.reject = reject;\r\n lodash.rest = rest;\r\n lodash.set = set;\r\n lodash.slice = slice;\r\n lodash.sortBy = sortBy;\r\n lodash.take = take;\r\n lodash.takeRight = takeRight;\r\n lodash.tap = tap;\r\n lodash.throttle = throttle;\r\n lodash.thru = thru;\r\n lodash.toArray = toArray;\r\n lodash.union = union;\r\n lodash.uniq = uniq;\r\n lodash.uniqBy = uniqBy;\r\n lodash.unzip = unzip;\r\n lodash.values = values;\r\n lodash.without = without;\r\n lodash.zip = zip;\r\n lodash.zipObject = zipObject;\r\n\r\n // Add aliases.\r\n lodash.extend = assignIn;\r\n\r\n // Add methods to `lodash.prototype`.\r\n mixin(lodash, lodash);\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n // Add methods that return unwrapped values in chain sequences.\r\n lodash.clamp = clamp;\r\n lodash.clone = clone;\r\n lodash.cloneDeep = cloneDeep;\r\n lodash.escape = escape;\r\n lodash.every = every;\r\n lodash.find = find;\r\n lodash.findIndex = findIndex;\r\n lodash.findKey = findKey;\r\n lodash.findLastIndex = findLastIndex;\r\n lodash.findLastKey = findLastKey;\r\n lodash.forEach = forEach;\r\n lodash.get = get;\r\n lodash.has = has;\r\n lodash.head = head;\r\n lodash.identity = identity;\r\n lodash.indexOf = indexOf;\r\n lodash.isArguments = isArguments;\r\n lodash.isArray = isArray;\r\n lodash.isArrayLike = isArrayLike;\r\n lodash.isBoolean = isBoolean;\r\n lodash.isDate = isDate;\r\n lodash.isEmpty = isEmpty;\r\n lodash.isEqual = isEqual;\r\n lodash.isFinite = isFinite;\r\n lodash.isFunction = isFunction;\r\n lodash.isNaN = isNaN;\r\n lodash.isNull = isNull;\r\n lodash.isNumber = isNumber;\r\n lodash.isObject = isObject;\r\n lodash.isPlainObject = isPlainObject;\r\n lodash.isRegExp = isRegExp;\r\n lodash.isString = isString;\r\n lodash.isUndefined = isUndefined;\r\n lodash.last = last;\r\n lodash.max = max;\r\n lodash.min = min;\r\n lodash.noConflict = noConflict;\r\n lodash.noop = noop;\r\n lodash.random = random;\r\n lodash.reduce = reduce;\r\n lodash.result = result;\r\n lodash.size = size;\r\n lodash.some = some;\r\n lodash.trim = trim;\r\n lodash.unescape = unescape;\r\n lodash.uniqueId = uniqueId;\r\n\r\n // Add aliases.\r\n lodash.each = forEach;\r\n lodash.first = head;\r\n\r\n mixin(lodash, (function() {\r\n var source = {};\r\n baseForOwn(lodash, function(func, methodName) {\r\n if (!hasOwnProperty.call(lodash.prototype, methodName)) {\r\n source[methodName] = func;\r\n }\r\n });\r\n return source;\r\n }()), { 'chain': false });\r\n\r\n /*------------------------------------------------------------------------*/\r\n\r\n /**\r\n * The semantic version number.\r\n *\r\n * @static\r\n * @memberOf _\r\n * @type {string}\r\n */\r\n lodash.VERSION = VERSION;\r\n\r\n // Add `LazyWrapper` methods for `_.drop` and `_.take` variants.\r\n arrayEach(['drop', 'take'], function(methodName, index) {\r\n LazyWrapper.prototype[methodName] = function(n) {\r\n n = n === undefined ? 1 : nativeMax(toInteger(n), 0);\r\n\r\n var result = (this.__filtered__ && !index)\r\n ? new LazyWrapper(this)\r\n : this.clone();\r\n\r\n if (result.__filtered__) {\r\n result.__takeCount__ = nativeMin(n, result.__takeCount__);\r\n } else {\r\n result.__views__.push({\r\n 'size': nativeMin(n, MAX_ARRAY_LENGTH),\r\n 'type': methodName + (result.__dir__ < 0 ? 'Right' : '')\r\n });\r\n }\r\n return result;\r\n };\r\n\r\n LazyWrapper.prototype[methodName + 'Right'] = function(n) {\r\n return this.reverse()[methodName](n).reverse();\r\n };\r\n });\r\n\r\n // Add `LazyWrapper` methods that accept an `iteratee` value.\r\n arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) {\r\n var type = index + 1,\r\n isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG;\r\n\r\n LazyWrapper.prototype[methodName] = function(iteratee) {\r\n var result = this.clone();\r\n result.__iteratees__.push({\r\n 'iteratee': getIteratee(iteratee, 3),\r\n 'type': type\r\n });\r\n result.__filtered__ = result.__filtered__ || isFilter;\r\n return result;\r\n };\r\n });\r\n\r\n // Add `LazyWrapper` methods for `_.head` and `_.last`.\r\n arrayEach(['head', 'last'], function(methodName, index) {\r\n var takeName = 'take' + (index ? 'Right' : '');\r\n\r\n LazyWrapper.prototype[methodName] = function() {\r\n return this[takeName](1).value()[0];\r\n };\r\n });\r\n\r\n // Add `LazyWrapper` methods for `_.initial` and `_.tail`.\r\n arrayEach(['initial', 'tail'], function(methodName, index) {\r\n var dropName = 'drop' + (index ? '' : 'Right');\r\n\r\n LazyWrapper.prototype[methodName] = function() {\r\n return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1);\r\n };\r\n });\r\n\r\n LazyWrapper.prototype.compact = function() {\r\n return this.filter(identity);\r\n };\r\n\r\n LazyWrapper.prototype.find = function(predicate) {\r\n return this.filter(predicate).head();\r\n };\r\n\r\n LazyWrapper.prototype.findLast = function(predicate) {\r\n return this.reverse().find(predicate);\r\n };\r\n\r\n LazyWrapper.prototype.invokeMap = baseRest(function(path, args) {\r\n if (typeof path == 'function') {\r\n return new LazyWrapper(this);\r\n }\r\n return this.map(function(value) {\r\n return baseInvoke(value, path, args);\r\n });\r\n });\r\n\r\n LazyWrapper.prototype.reject = function(predicate) {\r\n return this.filter(negate(getIteratee(predicate)));\r\n };\r\n\r\n LazyWrapper.prototype.slice = function(start, end) {\r\n start = toInteger(start);\r\n\r\n var result = this;\r\n if (result.__filtered__ && (start > 0 || end < 0)) {\r\n return new LazyWrapper(result);\r\n }\r\n if (start < 0) {\r\n result = result.takeRight(-start);\r\n } else if (start) {\r\n result = result.drop(start);\r\n }\r\n if (end !== undefined) {\r\n end = toInteger(end);\r\n result = end < 0 ? result.dropRight(-end) : result.take(end - start);\r\n }\r\n return result;\r\n };\r\n\r\n LazyWrapper.prototype.takeRightWhile = function(predicate) {\r\n return this.reverse().takeWhile(predicate).reverse();\r\n };\r\n\r\n LazyWrapper.prototype.toArray = function() {\r\n return this.take(MAX_ARRAY_LENGTH);\r\n };\r\n\r\n // Add `LazyWrapper` methods to `lodash.prototype`.\r\n baseForOwn(LazyWrapper.prototype, function(func, methodName) {\r\n var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName),\r\n isTaker = /^(?:head|last)$/.test(methodName),\r\n lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName],\r\n retUnwrapped = isTaker || /^find/.test(methodName);\r\n\r\n if (!lodashFunc) {\r\n return;\r\n }\r\n lodash.prototype[methodName] = function() {\r\n var value = this.__wrapped__,\r\n args = isTaker ? [1] : arguments,\r\n isLazy = value instanceof LazyWrapper,\r\n iteratee = args[0],\r\n useLazy = isLazy || isArray(value);\r\n\r\n var interceptor = function(value) {\r\n var result = lodashFunc.apply(lodash, arrayPush([value], args));\r\n return (isTaker && chainAll) ? result[0] : result;\r\n };\r\n\r\n if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) {\r\n // Avoid lazy use if the iteratee has a \"length\" value other than `1`.\r\n isLazy = useLazy = false;\r\n }\r\n var chainAll = this.__chain__,\r\n isHybrid = !!this.__actions__.length,\r\n isUnwrapped = retUnwrapped && !chainAll,\r\n onlyLazy = isLazy && !isHybrid;\r\n\r\n if (!retUnwrapped && useLazy) {\r\n value = onlyLazy ? value : new LazyWrapper(this);\r\n var result = func.apply(value, args);\r\n result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined });\r\n return new LodashWrapper(result, chainAll);\r\n }\r\n if (isUnwrapped && onlyLazy) {\r\n return func.apply(this, args);\r\n }\r\n result = this.thru(interceptor);\r\n return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result;\r\n };\r\n });\r\n\r\n // Add `Array` methods to `lodash.prototype`.\r\n arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) {\r\n var func = arrayProto[methodName],\r\n chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru',\r\n retUnwrapped = /^(?:pop|shift)$/.test(methodName);\r\n\r\n lodash.prototype[methodName] = function() {\r\n var args = arguments;\r\n if (retUnwrapped && !this.__chain__) {\r\n var value = this.value();\r\n return func.apply(isArray(value) ? value : [], args);\r\n }\r\n return this[chainName](function(value) {\r\n return func.apply(isArray(value) ? value : [], args);\r\n });\r\n };\r\n });\r\n\r\n // Map minified method names to their real names.\r\n baseForOwn(LazyWrapper.prototype, function(func, methodName) {\r\n var lodashFunc = lodash[methodName];\r\n if (lodashFunc) {\r\n var key = (lodashFunc.name + ''),\r\n names = realNames[key] || (realNames[key] = []);\r\n\r\n names.push({ 'name': methodName, 'func': lodashFunc });\r\n }\r\n });\r\n\r\n realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{\r\n 'name': 'wrapper',\r\n 'func': undefined\r\n }];\r\n\r\n // Add methods to `LazyWrapper`.\r\n LazyWrapper.prototype.clone = lazyClone;\r\n LazyWrapper.prototype.reverse = lazyReverse;\r\n LazyWrapper.prototype.value = lazyValue;\r\n\r\n // Add lazy aliases.\r\n lodash.prototype.first = lodash.prototype.head;\r\n\r\n if (symIterator) {\r\n lodash.prototype[symIterator] = wrapperToIterator;\r\n }\r\n\r\n /*--------------------------------------------------------------------------*/\r\n\r\n // Some AMD build optimizers, like r.js, check for condition patterns like:\r\n if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) {\r\n // Expose Lodash on the global object to prevent errors when Lodash is\r\n // loaded by a script tag in the presence of an AMD loader.\r\n // See http://requirejs.org/docs/errors.html#mismatch for more details.\r\n // Use `_.noConflict` to remove Lodash from the global object.\r\n root._ = lodash;\r\n\r\n // Define as an anonymous module so, through path mapping, it can be\r\n // referenced as the \"underscore\" module.\r\n define(function() {\r\n return lodash;\r\n });\r\n }\r\n // Check for `exports` after `define` in case a build optimizer adds it.\r\n else if (freeModule) {\r\n // Export for Node.js.\r\n (freeModule.exports = lodash)._ = lodash;\r\n // Export for CommonJS support.\r\n freeExports._ = lodash;\r\n }\r\n else {\r\n // Export to the global object.\r\n root._ = lodash;\r\n }\r\n}.call(this));\r\n"},158:function(r,e,n){(function(r,e){_global=undefined,"undefined"!=typeof window?_global=window:void 0!==r?_global=r:"undefined"!=typeof self?_global=self:_global=this,_global.BI||(_global.BI={}),function(r){var n=function(r,e){return function(n,t,a){return r.call(e,t,n,a)}},t=function(r){return function(){return _[r].apply(_,arguments)}},a=function(r){return function(){var e=Array.prototype.slice.call(arguments,0);return e[1]=_.isFunction(e[1])?n(e[1],e[2]):e[1],_[r].apply(_,e)}};_.extend(BI,{assert:function(r,e){if(this.isFunction(e)){if(e(r))return!0;throw new Error(r+" error")}if(this.isArray(e)||(e=[e]),!this.deepContains(e,r))throw new Error(r+" error");return!0},warn:function(r){console.warn(r)},UUID:function(){for(var r=["0","1","2","3","4","5","6","7","8","9","a","b","c","d","e","f"],e="",n=0;n<16;n++){e+=r[parseInt(r.length*Math.random(),10)]}return e},isWidget:function(r){return r instanceof BI.Widget},createWidgets:function(r,e,n){if(!BI.isArray(r))throw new Error("items必须是数组",r);return BI.isWidget(e)?(n=e,e={}):e||(e={}),BI.map(BI.flatten(r),(function(r,t){return BI.createWidget(t,BI.deepClone(e),n)}))},createItems:function(r,e,n){return e=BI.isArray(e)?e:BI.makeArray(BI.flatten(r).length,e||{}),n=BI.isArray(n)?n:BI.makeArray(BI.flatten(r).length,n||{}),BI.map(r,(function(r,t){return BI.isArray(t)?BI.createItems(t,e,n):t instanceof BI.Widget?BI.extend({},e.shift(),n.shift(),{type:null,el:t}):e[0]instanceof BI.Widget?(n.shift(),BI.extend({},t,{el:e.shift()})):t.el instanceof BI.Widget?(e.shift(),BI.extend({},n.shift(),{type:null},t)):t.el?BI.extend({},n.shift(),t,{el:BI.extend({},e.shift(),t.el)}):BI.extend({},n.shift(),{el:BI.extend({},e.shift(),t)})}))},packageItems:function(r,e){for(var n=e.length-1;n>=0;n--)r=BI.map(r,(function(r,t){return BI.extend({},e[n],{items:[BI.extend({},e[n].el,{el:t})]})}));return r},formatEL:function(r){return r&&!r.type&&r.el?r:{el:r}},stripEL:function(r){return r.type&&r||r.el||r},trans2Element:function(r){return BI.map(r,(function(r,e){return e.element}))}}),_.each(["where","findWhere","invoke","pluck","shuffle","sample","toArray","size"],(function(r){BI[r]=t(r)})),_.each(["get","set","each","map","reduce","reduceRight","find","filter","reject","every","all","some","any","max","min","sortBy","groupBy","indexBy","countBy","partition","clamp"],(function(r){BI[r]=a("any"===r?"some":r)})),_.extend(BI,{count:function(r,e,n){var t;if(n)for(t=r;t=0;t--)e(t,r[t],r);return!1},backAny:function(r,e,n){e=BI.iteratee(e,n);for(var t=r.length-1;t>=0;t--)if(e(t,r[t],r))return!0;return!1},backEvery:function(r,e,n){e=BI.iteratee(e,n);for(var t=r.length-1;t>=0;t--)if(!e(t,r[t],r))return!1;return!0},backFindKey:function(r,e,n){e=BI.iteratee(e,n);for(var t,a=_.keys(r),o=a.length-1;o>=0;o--)if(e(r[t=a[o]],t,r))return t},backFind:function(r,e,n){var t;if(void 0!==(t=BI.isArray(r)?BI.findLastIndex(r,e,n):BI.backFindKey(r,e,n))&&-1!==t)return r[t]},remove:function(r,e,n){var t,a=BI.isFunction(e);if(e=a||BI.isArray(e)?e:[e],BI.isArray(r))for(t=0;t(2147483646-r.charAt(n).charCodeAt(0)+"A".charCodeAt(0))/26)return 0;return e},int2Abc:function(r){var e=["A","B","C","D","E","F","G","H","I","J","K","L","M","N","O","P","Q","R","S","T","U","V","W","X","Y","Z"],n=r,t="";if(0===r)return"";for(;0!==n;){var a=n%26;0===a&&(a=26),t=e[a-1]+t,n=(n-a)/26}return t}}),_.each(["first","initial","last","rest","compact","flatten","without","union","intersection","difference","zip","unzip","object","indexOf","lastIndexOf","sortedIndex","range","take","takeRight","uniqBy"],(function(r){BI[r]=t(r)})),_.each(["findIndex","findLastIndex"],(function(r){BI[r]=a(r)})),_.extend(BI,{makeArray:function(r,e){for(var n=[],t=0;t0;)BI.prepares.shift()();for(;_global.___fineuiExposedFunction&&_global.___fineuiExposedFunction.length>0;)_global.___fineuiExposedFunction.shift()();BI.initialized=!0},has:function(r,e){return BI.isArray(e)?0!==e.length&&BI.every(e,(function(e,n){return _.has(r,n)})):_.has.apply(_,arguments)},freeze:function(r){return Object.freeze&&BI.isObject(r)?Object.freeze(r):r},isKey:function(r){return BI.isNumber(r)||BI.isString(r)&&r.length>0},isCapitalEqual:function(r,e){return r=BI.isNull(r)?r:(""+r).toLowerCase(),e=BI.isNull(e)?e:(""+e).toLowerCase(),BI.isEqual(r,e)},isWidthOrHeight:function(r){return"number"==typeof r?r>=0:"string"==typeof r?/^\d{1,3}(\.\d)?%$/.test(r)||"auto"===r||/^\d+px$/.test(r)||/^calc/.test(r):void 0},isNotNull:function(r){return!BI.isNull(r)},isNull:function(r){return null==r},isEmptyArray:function(r){return BI.isArray(r)&&BI.isEmpty(r)},isNotEmptyArray:function(r){return BI.isArray(r)&&!BI.isEmpty(r)},isEmptyObject:function(r){return BI.isEqual(r,{})},isNotEmptyObject:function(r){return BI.isPlainObject(r)&&!BI.isEmptyObject(r)},isEmptyString:function(r){return BI.isString(r)&&0===r.length},isNotEmptyString:function(r){return BI.isString(r)&&!BI.isEmptyString(r)},isWindow:function(r){return null!=r&&r==r.window}}),_.extend(BI,{deepClone:_.cloneDeep,deepExtend:_.merge,isDeepMatch:function(r,e){var n=BI.keys(e),t=n.length;if(null==r)return!t;for(var a=Object(r),o=0;o=0},deepContains:function(r,e){return BI.isObject(e)?BI.any(r,(function(r,n){if(BI.isEqual(n,e))return!0})):BI.contains(r,e)},deepIndexOf:function(r,e){for(var n=0;na[0]?o=["y",1]:r>=t[0]&&r<=a[0]&&(r==t[0]&&(ea[1]?o=["m",1]:e==a[1]&&n>a[2]&&(o=["d",1]))),o},checkDateLegal:function(r){var e=r.match(/\d+/g),n=0|e[0],t=0|e[1],a=0|e[2];if(e.length<=1)return!0;if(e.length<=2)return t>=1&&t<=12;var o=BI.Date._MD.slice(0);return o[1]=BI.isLeapYear(n)?29:28,t>=1&&t<=12&&a<=o[t-1]},parseDateTime:function(r,e){var n=BI.getDate(),t=0,a=0,o=1,i=r.split(/\W+/);if("%y%x"==e.toLowerCase()||"%y%x%d"==e.toLowerCase()){i[0]=r.substring(0,4),i[1]=r.substring(4,6),i[2]=r.substring(6,8)}var s=e.match(/%./g),u=0,c=0,l=0,h=0,p=0;for(u=0;u29?1900:2e3);break;case"%b":case"%B":for(c=0;c<12;++c)if(BI.Date._MN[c].substr(0,i[u].length).toLowerCase()==i[u].toLowerCase()){a=c;break}break;case"%H":case"%I":case"%k":case"%l":l=parseInt(i[u],10);break;case"%P":case"%p":/pm/i.test(i[u])&&l<12?l+=12:/am/i.test(i[u])&&l>=12&&(l-=12);break;case"%Q":case"%q":a=3*(parseInt(i[u],10)-1);break;case"%M":h=parseInt(i[u],10);break;case"%S":p=parseInt(i[u],10)}if(isNaN(t)&&(t=n.getFullYear()),isNaN(a)&&(a=n.getMonth()),isNaN(o)&&(o=n.getDate()),isNaN(l)&&(l=n.getHours()),isNaN(h)&&(h=n.getMinutes()),isNaN(p)&&(p=n.getSeconds()),0!=t)return BI.getDate(t,a,o,l,h,p);for(t=0,a=-1,o=0,u=0;u31&&0==t?(t=parseInt(i[u],10))<100&&(t+=t>29?1900:2e3):0==o&&(o=i[u]);return 0==t&&(t=n.getFullYear()),-1===a&&(a=n.getMonth()),-1!=a&&0!=o?BI.getDate(t,a,o,l,h,p):n},getDate:function(){var r,e=arguments.length,n=arguments;switch(e){case 0:r=new Date;break;case 1:r=new Date(n[0]);break;case 2:r=new Date(n[0],n[1]);break;case 3:r=new Date(n[0],n[1],n[2]);break;case 4:r=new Date(n[0],n[1],n[2],n[3]);break;case 5:r=new Date(n[0],n[1],n[2],n[3],n[4]);break;case 6:r=new Date(n[0],n[1],n[2],n[3],n[4],n[5]);break;case 7:r=new Date(n[0],n[1],n[2],n[3],n[4],n[5],n[6]);break;default:r=new Date}if(BI.isNotNull(BI.timeZone)&&(0===arguments.length||1===arguments.length&&BI.isNumber(arguments[0]))){var t=r.getTime(),a=6e4*r.getTimezoneOffset(),o=t+a;return new Date(o+BI.timeZone)}return r},getTime:function(){var r,e=arguments.length,n=arguments;switch(e){case 0:r=new Date;break;case 1:r=new Date(n[0]);break;case 2:r=new Date(n[0],n[1]);break;case 3:r=new Date(n[0],n[1],n[2]);break;case 4:r=new Date(n[0],n[1],n[2],n[3]);break;case 5:r=new Date(n[0],n[1],n[2],n[3],n[4]);break;case 6:r=new Date(n[0],n[1],n[2],n[3],n[4],n[5]);break;case 7:r=new Date(n[0],n[1],n[2],n[3],n[4],n[5],n[6]);break;default:r=new Date}return BI.isNotNull(BI.timeZone)?r.getTime()-BI.timeZone-6e4*(new Date).getTimezoneOffset():r.getTime()}})}()}).call(this,n(15),n(61).setImmediate)},159:function(r,e,n){"use strict";(function(r,e){!function(r,n){if(!r.setImmediate){var t,a,o,i,s,u=1,c={},l=!1,h=r.document,p=Object.getPrototypeOf&&Object.getPrototypeOf(r);p=p&&p.setTimeout?p:r,"[object process]"==={}.toString.call(r.process)?t=function(r){e.nextTick((function(){d(r)}))}:!function(){if(r.postMessage&&!r.importScripts){var e=!0,n=r.onmessage;return r.onmessage=function(){e=!1},r.postMessage("","*"),r.onmessage=n,e}}()?r.MessageChannel?((o=new MessageChannel).port1.onmessage=function(r){d(r.data)},t=function(r){o.port2.postMessage(r)}):h&&"onreadystatechange"in h.createElement("script")?(a=h.documentElement,t=function(r){var e=h.createElement("script");e.onreadystatechange=function(){d(r),e.onreadystatechange=null,a.removeChild(e),e=null},a.appendChild(e)}):t=function(r){setTimeout(d,0,r)}:(i="setImmediate$"+Math.random()+"$",s=function(e){e.source===r&&"string"==typeof e.data&&0===e.data.indexOf(i)&&d(+e.data.slice(i.length))},r.addEventListener?r.addEventListener("message",s,!1):r.attachEvent("onmessage",s),t=function(e){r.postMessage(i+e,"*")}),p.setImmediate=function(r){"function"!=typeof r&&(r=new Function(""+r));for(var e=new Array(arguments.length-1),n=0;nv){f=!0;break}}}if(!0===f){_global.console&&console.error("moduleId: ["+b.moduleId+"] 接口: ["+t+"] 接口版本: ["+h+"] 已过期,版本要求为:",o[b.moduleId],"=>",r[b.moduleId]);continue}}n[t]?n[t]=p(n[t]):i[t]?(m[t]||(m[t]=new i[t]),y[t]&&delete y[t],p(m[t])):BI.Plugin.configWidget(t,p,l.opt)}};BI.config=BI.config||function(r,e,n){if(n=n||{},"bi.provider.system"===r)return m[r]||(m[r]=new i[r]),y[r]&&delete y[r],e(m[r]);s[r]||(s[r]=[]),s[r].push({fn:e,opt:n})},BI.getReference=BI.getReference||function(r,e){return BI.Plugin.registerObject(r,e)};var c={},l=[];BI.action=BI.action||function(r,e){return BI.isFunction(r)?(l.push(r),function(){BI.remove(l,(function(r){return l.indexOf(e)===r}))}):(c[r]||(c[r]=[]),c[r].push(e),function(){BI.remove(c[r],(function(n){return c[r].indexOf(e)===n})),0===c[r].length&&delete c[r]})};var h={};BI.point=BI.point||function(r,e,n,t){h[r]||(h[r]={}),h[r][e]||(h[r][e]={}),h[r][e][t?"after":"before"]||(h[r][e][t?"after":"before"]=[]),h[r][e][t?"after":"before"].push(n)},BI.Modules=BI.Modules||{getModule:function(e){return r[e]||_global.console&&console.error("module: ["+e+"] 未定义"),r[e]},getAllModules:function(){return r}},BI.Constants=BI.Constants||{getConstant:function(r){return BI.isNull(n[r])&&_global.console&&console.error("constant: ["+r+"] 未定义"),u(r),n[r]}};var p=function(r,e){e=BI.isArray(e)?e:[e],BI.each(e,(function(e,n){if(h[n])for(var t in h[n]){var a=h[n][t].before;a&&BI.aspect.before(r,t,function(e){return function(){for(var n=0,t=e.length;n0&&r<1?"floor":"ceil"](Math.log(r)/Math.log(10));if(!isFinite(a))return e.replace(/#/gi,"").replace(/\.e/gi,"E");(r/=Math.pow(10,a))>0&&r<1&&(r*=10,a-=1);var o=function(r,e){if(!/e/gi.test(e))return 0;var n,t,a=e.split(/e/gi)[0].split(".")[0],o=a.length,i=0;for(n=0;n1&&(a-=o-1,r*=Math.pow(10,o-1)),a<0&&(t="-",a*=-1);var i=function(r){if(!/e/gi.test(r))return 0;var e=r.split(/e/gi)[0].split(".");return e.length>1?e[1].length:0}(e),s=function(r){var e=Math.round(r);return r=(r+"").split(".")[0],e=(e+"").split(".")[0],r.length!==e.length}(r);return r*=Math.pow(10,i),r=Math.round(r),s&&(r/=10,a+="-"===t?-1:1),r=(r/=Math.pow(10,i)).toFixed(i),a=function(r,e,n){if(e+="",!/e/gi.test(r))return e;r=r.split(/e/gi)[1];for(;e.length-1)return r>=0?_numberFormat(r+"",e.substring(0,n)):_numberFormat(-r+"",e.substr(n+1));if(+r<0&&"-"!==e.charAt(0))return _numberFormat(-r+"","-"+e);var t=e.split("."),a=t[0]||"",o=t[1]||"",i=(r=_dealNumberPrecision(r,o)).split("."),s=i[0]||"",u=i[1]||"";if(/[%‰]$/.test(e)){var c=/[%]$/.test(e)?"00":"000";s=(s+=(u+=c).substr(0,c.length)).replace(/^0+/gi,""),u=u.substr(c.length).replace(/0+$/gi,"")}var l=_dealWithRight(u,o);l.leftPlus&&(s=parseInt(s)+1+"",s=isNaN(s)?"1":s),l=l.num;var h=_dealWithLeft(s,a);return/[0-9]/.test(h)||(h+="0"),/[0-9]/.test(l)?h+"."+l:h+l}function _dealWithRight(r,e){for(var n="",t=0,a=0,o=e.length;a4){c.leftPlus=!0;var l=n.match(/^[0-9]+/);if(l){var h=l[0],p=h.length,f=parseInt(h)+1+"";f.length>p?f=f.substr(1):(f=BI.leftPad(f,p,"0"),c.leftPlus=!1),n=n.replace(/^[0-9]+/,f)}}return c.num=n,c}function _dealWithLeft(r,e){for(var n="",t=r.length-1,a=-1,o=-1,i=e.length-1;i>=0;i--){var s=e.charAt(i),u=r.charAt(t);switch(s){case"0":isEmpty(u)&&(u="0"),o=-1,n=u+n,t--;break;case"#":o=i,n=u+n,t--;break;case",":if(!isEmpty(u)){var c=e.match(/,[#0]+/);c&&(a=c[0].length-1),n=","+n}break;default:n=s+n}}if(o>-1){var l=r.substr(0,t+1);n=n.substr(0,o)+l+n.substr(o)}if(a>0){var h=n.match(/[0-9]+,/);if(h){for(var p="",f=(h=h[0]).length-1-a;f>=0;f-=a)p=h.substr(f,a)+","+p;var d=h.substr(0,f+a);isEmpty(d)||(p=d+","+p)}n=n.replace(/[0-9]+,/,p)}return n}_global="undefined"!=typeof window?window:void 0!==global?global:"undefined"!=typeof self?self:this,_global.BI||(_global.BI={}),BI.cjkEncode=function(r){if("string"!=typeof r)return r;for(var e="",n=0;n=128||91===t||93===t?"["+t.toString(16)+"]":r.charAt(n)}return e},BI.cjkDecode=function(text){if(null==text)return"";if(!isNaN(text)||-1==text.indexOf("["))return text;for(var newText="",i=0;ii+1){var subText=text.substring(i+1,rightIdx);subText.length>0&&(ch=String.fromCharCode(eval("0x"+subText))),i=rightIdx}}newText+=ch}return newText};var SPECIAL_TAGS={"&":"&",'"':""","<":"<",">":">"," ":" "};BI.htmlEncode=function(r){return BI.isNull(r)?"":BI.replaceAll(r+"",'&|"|<|>|\\s',(function(r){return SPECIAL_TAGS[r]?SPECIAL_TAGS[r]:" "}))},BI.htmlDecode=function(r){return BI.isNull(r)?"":BI.replaceAll(r+"","&|"|<|>| ",(function(r){switch(r){case"&":return"&";case""":return'"';case"<":return"<";case">":return">";case" ":default:return" "}}))},BI.cjkEncodeDO=function(r){if(BI.isPlainObject(r)){var e={};return _.each(r,(function(r,n){"string"!=typeof r&&(r=BI.jsonEncode(r)),n=BI.cjkEncode(n),e[n]=BI.cjkEncode(r)})),e}return r},BI.jsonEncode=function(r){var e,n=!!{}.hasOwnProperty,t={"\b":"\\b","\t":"\\t","\n":"\\n","\f":"\\f","\r":"\\r",'"':'\\"',"\\":"\\\\"};if(null==r)return"null";if(BI.isArray(r))return function(r){var e,n,t,a=["["],o=r.length;for(n=0;n0){for(var a=e.charAt(0),o=0,i=a,s=1;s2?BI.Date._MN[e.getMonth()]:t<2?e.getMonth()+1:BI.leftPad(e.getMonth()+1+"",2,"0");break;case"d":n=t>1?BI.leftPad(e.getDate()+"",2,"0"):e.getDate();break;case"h":var a=e.getHours()%12;0===a&&(a=12),n=t>1?BI.leftPad(a+"",2,"0"):a;break;case"H":n=t>1?BI.leftPad(e.getHours()+"",2,"0"):e.getHours();break;case"m":n=t>1?BI.leftPad(e.getMinutes()+"",2,"0"):e.getMinutes();break;case"s":n=t>1?BI.leftPad(e.getSeconds()+"",2,"0"):e.getSeconds();break;case"a":n=e.getHours()<12?"am":"pm";break;case"z":n=BI.getTimezone(e);break;default:n=r.str}return n}},BI.object2Number=function(r){if(null==r)return 0;if("number"==typeof r)return r;var e=r+"";return-1===e.indexOf(".")?parseInt(e):parseFloat(e)},BI.object2Date=function(r){if(null==r)return new Date;if(r instanceof Date)return r;if("number"==typeof r)return new Date(r);var e=r+"";e=e.replace(/-/g,"/");var n=new Date(e);return isInvalidDate(n)?new Date:n},BI.object2Time=function(r){if(null==r)return new Date;if(r instanceof Date)return r;var e=r+"";e=e.replace(/-/g,"/");var n=new Date(e);return isInvalidDate(n)&&(-1!==e.indexOf("/")||-1===e.indexOf(":")||isInvalidDate(n=new Date("1970/01/01 "+e)))&&isInvalidDate(n=BI.parseDateTime(e,"HH:mm:ss"))?new Date:n}})()}).call(this,__webpack_require__(15))},166:function(r,e){_.extend(BI,{pushArray:function(r,e){for(var n=0;na&&(t=a),n.setDate(t),n.setMonth(n.getMonth()+3*parseInt(e)),n},getQuarterStartMonth:function(r){var e=0,n=r.getMonth();return n<3&&(e=0),28&&(e=9),e},getQuarterStartDate:function(r){return BI.getDate(r.getFullYear(),BI.getQuarterStartMonth(r),1)},getQuarterEndDate:function(r){var e=BI.getQuarterStartMonth(r)+2;return BI.getDate(r.getFullYear(),e,BI.getMonthDays(r,e))},getOffsetMonth:function(r,e){var n=BI.getDate(BI.getTime(r.getFullYear(),r.getMonth(),r.getDate(),r.getHours(),r.getMinutes(),r.getSeconds())),t=n.getDate(),a=BI.getMonthDays(BI.getDate(n.getFullYear(),n.getMonth()+parseInt(e),1));return t>a&&(t=a),n.setDate(t),n.setMonth(n.getMonth()+parseInt(e)),n},getWeekStartDate:function(r){var e=r.getDay(),n=BI.StartOfWeek%7;return BI.getOffsetDate(r,BI.Date._OFFSET[e=12,p=h?l-12:l,f=BI.getDayOfYear(r);0==p&&(p=12);var d=r.getMinutes(),m=r.getSeconds();c["%a"]=BI.Date._SDN[u],c["%A"]=BI.Date._DN[u],c["%b"]=BI.Date._SMN[n],c["%B"]=BI.Date._MN[n],c["%C"]=1+Math.floor(a/100),c["%d"]=t<10?"0"+t:t,c["%e"]=t,c["%H"]=l<10?"0"+l:l,c["%I"]=p<10?"0"+p:p,c["%j"]=f<100?f<10?"00"+f:"0"+f:f,c["%k"]=l+"",c["%l"]=p+"",c["%X"]=n<9?"0"+(1+n):1+n,c["%x"]=n+1,c["%M"]=d<10?"0"+d:d,c["%n"]="\n",c["%p"]=h?"PM":"AM",c["%P"]=h?"pm":"am",c["%s"]=Math.floor(r.getTime()/1e3),c["%S"]=m<10?"0"+m:m,c["%t"]="\t",c["%U"]=c["%W"]=c["%V"]=i<10?"0"+i:i,c["%u"]=u+1,c["%w"]=u,c["%y"]=o.substr(2,2),c["%Y"]=o,c["%%"]="%",c["%q"]="0"+s,c["%Q"]=s;var y=/%./g;if(BI.isKhtml=BI.isKhtml||function(){return!!_global.navigator&&/Konqueror|Safari|KHTML/i.test(navigator.userAgent)},!(-1===e.indexOf("%Y")&&-1===e.indexOf("%y")||-1===e.indexOf("%W")&&-1===e.indexOf("%U")&&-1===e.indexOf("%V")))switch(i){case 1:11===n&&(c["%y"]=parseInt(c["%y"])+1,c["%Y"]=parseInt(c["%Y"])+1);break;case 53:0===n&&(c["%y"]=parseInt(c["%y"])-1,c["%Y"]=parseInt(c["%Y"])-1)}if(!BI.isKhtml())return e.replace(y,(function(r){return c[r]||r}));for(var b=e.match(y),g=0;g-1?o===e?s?u.push(l):u[r]=l:s?c.push(l):c[r]=l:i.indexOf(e)>-1&&(o===e||e.length===o.length?s?u.push(l):u[r]=l:s?c.push(l):c[r]=l)))})),{match:u,find:c}},getSortedResult:function(r,e){var n=BI.isFunction(e)?e:function(r,e){return BI.isNotNull(e)?r[e]:BI.isNotNull(r.text)?r.text:BI.isNotNull(r.value)?r.value:r};return r.sort((function(r,t){var a=n(r,e),o=n(t,e);if(BI.isNull(a)&&BI.isNull(o))return 0;if(BI.isNull(a))return-1;if(BI.isNull(o))return 1;if(a===o)return 0;for(var i=a.length,s=o.length,u=0;u0){var i=Math.pow(10,o);n>t?(r=Number(r.toString().replace(".","")),e=Number(e.toString().replace(".",""))*i):(r=Number(r.toString().replace(".",""))*i,e=Number(e.toString().replace(".","")))}else r=Number(r.toString().replace(".","")),e=Number(e.toString().replace(".",""));return(r+e)/a}(e,r)},sub:function(r,e){return function(r,e){var n,t,a;try{n=r.toString().split(".")[1].length}catch(o){n=0}try{t=e.toString().split(".")[1].length}catch(o){t=0}return a=Math.pow(10,Math.max(n,t)),((r*a-e*a)/a).toFixed(n>=t?n:t)}(r,e)},mul:function(r,e){return function(r,e){var n=0,t=r.toString(),a=e.toString();try{n+=t.split(".")[1].length}catch(o){}try{n+=a.split(".")[1].length}catch(o){}return Number(t.replace(".",""))*Number(a.replace(".",""))/Math.pow(10,n)}(e,r)},div:function(r,e){return function o(r,e){for(var i=[],s=2;s0)return o.apply(void 0,[o(r,e),i[0]].concat(i.slice(1)));var u=t(r),c=t(e);return a(u/c,Math.pow(10,n(e)-n(r)))}(r,e);function n(r){var e=r.toString().split(/[eE]/),n=(e[0].split(".")[1]||"").length-+(e[1]||0);return n>0?n:0}function t(r){if(-1===r.toString().indexOf("e"))return Number(r.toString().replace(".",""));var e=n(r);return e>0?r*Math.pow(10,e):r}function a(r,e){for(var o=[],i=2;i0)return a.apply(void 0,[a(r,e),o[0]].concat(o.slice(1)));var s=t(r),u=t(e),c=n(r)+n(e),l=s*u;return l/Math.pow(10,c)}}})},170:function(r,e){_.extend(BI,{startWith:function(r,e){return r=r||"",!(null==e||""==e||0===r.length||e.length>r.length)&&r.substr(0,e.length)==e},endWith:function(r,e){return!(null==e||""==e||0===r.length||e.length>r.length)&&r.substring(r.length-e.length)==e},getQuery:function(r,e){var n=new RegExp("(^|&)"+e+"=([^&]*)(&|$)"),t=r.substr(r.indexOf("?")+1).match(n);return t?unescape(t[2]):null},appendQuery:function(r,e){if(!e)return r;var n=r;return-1===n.indexOf("?")&&(n+="?"),!1!==BI.endWith(n,"?")||(n+="&"),_.each(e,(function(r,e){"string"==typeof e&&(n+=e+"="+r+"&")})),n=n.substr(0,n.length-1)},replaceAll:function(r,e,n){return BI.isString(r)?r.replace(new RegExp(e,"gm"),n):r},perfectStart:function(r,e){return BI.startWith(r,e)?r:e+r},allIndexOf:function(r,e){if("string"!=typeof e)return[];for(var n=[],t=0;r.length>0;){var a=r.indexOf(e);if(-1===a)break;n.push(t+a),r=r.substring(a+e.length,r.length),t+=a+e.length}return n}})},171:function(r,e){var n,t;n={19969:"DZ",19975:"WM",19988:"QJ",20048:"YL",20056:"SC",20060:"NM",20094:"QG",20127:"QJ",20167:"QC",20193:"YG",20250:"KH",20256:"ZC",20282:"SC",20285:"QJG",20291:"TD",20314:"YD",20315:"BF",20340:"NE",20375:"TD",20389:"YJ",20391:"CZ",20415:"PB",20446:"YS",20447:"SQ",20504:"TC",20608:"KG",20854:"QJ",20857:"ZC",20911:"PF",20985:"AW",21032:"PB",21048:"XQ",21049:"SC",21089:"YS",21119:"JC",21242:"SB",21273:"SC",21305:"YP",21306:"QO",21330:"ZC",21333:"SDC",21345:"QK",21378:"CA",21397:"SC",21414:"XS",21442:"SC",21477:"JG",21480:"TD",21484:"ZS",21494:"YX",21505:"YX",21512:"HG",21523:"XH",21537:"PB",21542:"PF",21549:"KH",21571:"E",21574:"DA",21588:"TD",21589:"O",21618:"ZC",21621:"KHA",21632:"ZJ",21654:"KG",21679:"LKG",21683:"KH",21710:"A",21719:"YH",21734:"WOE",21769:"A",21780:"WN",21804:"XH",21834:"A",21899:"ZD",21903:"RN",21908:"WO",21939:"ZC",21956:"SA",21964:"YA",21970:"TD",22003:"A",22031:"JG",22040:"XS",22060:"ZC",22066:"ZC",22079:"MH",22129:"XJ",22179:"XA",22237:"NJ",22244:"TD",22280:"JQ",22300:"YH",22313:"XW",22331:"YQ",22343:"YJ",22351:"PH",22395:"DC",22412:"TD",22484:"PB",22500:"PB",22534:"ZD",22549:"DH",22561:"PB",22612:"TD",22771:"KQ",22831:"HB",22841:"JG",22855:"QJ",22865:"XQ",23013:"ML",23081:"WM",23487:"SX",23558:"QJ",23561:"YW",23586:"YW",23614:"YW",23615:"SN",23631:"PB",23646:"ZS",23663:"ZT",23673:"YG",23762:"TD",23769:"ZS",23780:"QJ",23884:"QK",24055:"XH",24113:"DC",24162:"ZC",24191:"GA",24273:"QJ",24324:"NL",24377:"TD",24378:"QJ",24439:"PF",24554:"ZS",24683:"TD",24694:"WE",24733:"LK",24925:"TN",25094:"ZG",25100:"XQ",25103:"XH",25153:"PB",25170:"PB",25179:"KG",25203:"PB",25240:"ZS",25282:"FB",25303:"NA",25324:"KG",25341:"ZY",25373:"WZ",25375:"XJ",25384:"A",25457:"A",25528:"SD",25530:"SC",25552:"TD",25774:"ZC",25874:"ZC",26044:"YW",26080:"WM",26292:"PB",26333:"PB",26355:"ZY",26366:"CZ",26397:"ZC",26399:"QJ",26415:"ZS",26451:"SB",26526:"ZC",26552:"JG",26561:"TD",26588:"JG",26597:"CZ",26629:"ZS",26638:"YL",26646:"XQ",26653:"KG",26657:"XJ",26727:"HG",26894:"ZC",26937:"ZS",26946:"ZC",26999:"KJ",27099:"KJ",27449:"YQ",27481:"XS",27542:"ZS",27663:"ZS",27748:"TS",27784:"SC",27788:"ZD",27795:"TD",27812:"O",27850:"PB",27852:"MB",27895:"SL",27898:"PL",27973:"QJ",27981:"KH",27986:"HX",27994:"XJ",28044:"YC",28065:"WG",28177:"SM",28267:"QJ",28291:"KH",28337:"ZQ",28463:"TL",28548:"DC",28601:"TD",28689:"PB",28805:"JG",28820:"QG",28846:"PB",28952:"TD",28975:"ZC",29100:"A",29325:"QJ",29575:"SL",29602:"FB",30010:"TD",30044:"CX",30058:"PF",30091:"YSP",30111:"YN",30229:"XJ",30427:"SC",30465:"SX",30631:"YQ",30655:"QJ",30684:"QJG",30707:"SD",30729:"XH",30796:"LG",30917:"PB",31074:"NM",31085:"JZ",31109:"SC",31181:"ZC",31192:"MLB",31293:"JQ",31400:"YX",31584:"YJ",31896:"ZN",31909:"ZY",31995:"XJ",32321:"PF",32327:"ZY",32418:"HG",32420:"XQ",32421:"HG",32438:"LG",32473:"GJ",32488:"TD",32521:"QJ",32527:"PB",32562:"ZSQ",32564:"JZ",32735:"ZD",32793:"PB",33071:"PF",33098:"XL",33100:"YA",33152:"PB",33261:"CX",33324:"BP",33333:"TD",33406:"YA",33426:"WM",33432:"PB",33445:"JG",33486:"ZN",33493:"TS",33507:"QJ",33540:"QJ",33544:"ZC",33564:"XQ",33617:"YT",33632:"QJ",33636:"XH",33637:"YX",33694:"WG",33705:"PF",33728:"YW",33882:"SR",34067:"WM",34074:"YW",34121:"QJ",34255:"ZC",34259:"XL",34425:"JH",34430:"XH",34485:"KH",34503:"YS",34532:"HG",34552:"XS",34558:"YE",34593:"ZL",34660:"YQ",34892:"XH",34928:"SC",34999:"QJ",35048:"PB",35059:"SC",35098:"ZC",35203:"TQ",35265:"JX",35299:"JX",35782:"SZ",35828:"YS",35830:"E",35843:"TD",35895:"YG",35977:"MH",36158:"JG",36228:"QJ",36426:"XQ",36466:"DC",36710:"CJ",36711:"ZYG",36767:"PB",36866:"SK",36951:"YW",37034:"YX",37063:"XH",37218:"ZC",37325:"ZC",38063:"PB",38079:"TD",38085:"QY",38107:"DC",38116:"TD",38123:"YD",38224:"HG",38241:"XTC",38271:"ZC",38415:"YE",38426:"KH",38461:"YD",38463:"AE",38466:"PB",38477:"XJ",38518:"YT",38551:"WK",38585:"ZC",38704:"XS",38739:"LJ",38761:"GJ",38808:"SQ",39048:"JG",39049:"XJ",39052:"HG",39076:"CZ",39271:"XT",39534:"TD",39552:"TD",39584:"PB",39647:"SB",39730:"LG",39748:"TPB",40109:"ZQ",40479:"ND",40516:"HG",40536:"HG",40583:"QJ",40765:"YQ",40784:"QJ",40840:"YK",40863:"QJG"},t=function(r){var e=r.charCodeAt(0);return e>40869||e<19968?r:n[e]?n[e]:"YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY".charAt(e-19968)},_.extend(BI,{makeFirstPY:function(r,e){if(e=e||{},"string"!=typeof r)return""+r;for(var n=[],a=0,o=r.length;a14||t){var h=c.substring(0,1);for(n=0;n1){if(!(e.indexOf("{R1}")>-1)){var a=Array.prototype.slice.call(arguments),o=1;return BI.replaceAll(e,"\\{\\s*\\}",(function(){return a[o++]+""}))}for(var i=1;i=0&&(r._idleTimeoutId=setTimeout((function(){r._onTimeout&&r._onTimeout()}),e))},n(159),e.setImmediate="undefined"!=typeof self&&self.setImmediate||void 0!==r&&r.setImmediate||void 0,e.clearImmediate="undefined"!=typeof self&&self.clearImmediate||void 0!==r&&r.clearImmediate||void 0}).call(this,n(15))},75:function(r,e,n){"use strict";var t,a,o=r.exports={};function i(){throw new Error("setTimeout has not been defined")}function s(){throw new Error("clearTimeout has not been defined")}function u(r){if(t===setTimeout)return setTimeout(r,0);if((t===i||!t)&&setTimeout)return t=setTimeout,setTimeout(r,0);try{return t(r,0)}catch(e){try{return t.call(null,r,0)}catch(e){return t.call(this,r,0)}}}!function(){try{t="function"==typeof setTimeout?setTimeout:i}catch(r){t=i}try{a="function"==typeof clearTimeout?clearTimeout:s}catch(r){a=s}}();var c,l=[],h=!1,p=-1;function f(){h&&c&&(h=!1,c.length?l=c.concat(l):p=-1,l.length&&d())}function d(){if(!h){var r=u(f);h=!0;for(var e=l.length;e;){for(c=l,l=[];++p1)for(var n=1;n