/*! time: 2020-7-3 11:57:08 */
!function(t){var r={};function a(e){if(r[e])return r[e].exports;var n=r[e]={i:e,l:!1,exports:{}};return t[e].call(n.exports,n,n.exports,a),n.l=!0,n.exports}a.m=t,a.c=r,a.d=function(e,n,t){a.o(e,n)||Object.defineProperty(e,n,{enumerable:!0,get:t})},a.r=function(e){"undefined"!=typeof Symbol&&Symbol.toStringTag&&Object.defineProperty(e,Symbol.toStringTag,{value:"Module"}),Object.defineProperty(e,"__esModule",{value:!0})},a.t=function(n,e){if(1&e&&(n=a(n)),8&e)return n;if(4&e&&"object"==typeof n&&n&&n.__esModule)return n;var t=Object.create(null);if(a.r(t),Object.defineProperty(t,"default",{enumerable:!0,value:n}),2&e&&"string"!=typeof n)for(var r in n)a.d(t,r,function(e){return n[e]}.bind(null,r));return t},a.n=function(e){var n=e&&e.__esModule?function(){return e["default"]}:function(){return e};return a.d(n,"a",n),n},a.o=function(e,n){return Object.prototype.hasOwnProperty.call(e,n)},a.p="",a(a.s=1073)}({101:function(e,n,t){(function(e){_global=undefined,_global="undefined"!=typeof window?window:void 0!==e?e:"undefined"!=typeof self?self:this,null==_global.BI&&(_global.BI={prepares:[]}),null==_global.BI.prepares&&(_global.BI.prepares=[])}).call(this,t(13))},102:function(e,n,t){t(103)(t(104))},103:function(e,n){e.exports=function(e){function n(e){"undefined"!=typeof console&&(console.error||console.log)("[Script Loader]",e)}try{"undefined"!=typeof execScript&&"undefined"!=typeof attachEvent&&"undefined"==typeof addEventListener?execScript(e):"undefined"!=typeof eval?eval.call(null,e):n("EvalError: No eval function available")}catch(t){n(t)}}},104:function(e,n){e.exports="/**\n * @license\n * Lodash (Custom Build) <https://lodash.com/>\n * Build: `lodash core plus=\"debounce,throttle,get,set,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference,defaultsDeep,trim,merge,groupBy,uniqBy,before,after\"`\n * Copyright JS Foundation and other contributors <https://js.foundation/>\n * Released under MIT license <https://lodash.com/license>\n * Based on Underscore.js 1.8.3 <http://underscorejs.org/LICENSE>\n * Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors\n */\n;(function() {\n\n  /** Used as a safe reference for `undefined` in pre-ES5 environments. */\n  var undefined;\n\n  /** Used as the semantic version number. */\n  var VERSION = '4.17.5';\n\n  /** Used as the size to enable large array optimizations. */\n  var LARGE_ARRAY_SIZE = 200;\n\n  /** Error message constants. */\n  var FUNC_ERROR_TEXT = 'Expected a function';\n\n  /** Used to stand-in for `undefined` hash values. */\n  var HASH_UNDEFINED = '__lodash_hash_undefined__';\n\n  /** Used as the maximum memoize cache size. */\n  var MAX_MEMOIZE_SIZE = 500;\n\n  /** Used as the internal argument placeholder. */\n  var PLACEHOLDER = '__lodash_placeholder__';\n\n  /** Used to compose bitmasks for cloning. */\n  var CLONE_DEEP_FLAG = 1,\n      CLONE_FLAT_FLAG = 2,\n      CLONE_SYMBOLS_FLAG = 4;\n\n  /** Used to compose bitmasks for value comparisons. */\n  var COMPARE_PARTIAL_FLAG = 1,\n      COMPARE_UNORDERED_FLAG = 2;\n\n  /** Used to compose bitmasks for function metadata. */\n  var WRAP_BIND_FLAG = 1,\n      WRAP_BIND_KEY_FLAG = 2,\n      WRAP_CURRY_BOUND_FLAG = 4,\n      WRAP_CURRY_FLAG = 8,\n      WRAP_CURRY_RIGHT_FLAG = 16,\n      WRAP_PARTIAL_FLAG = 32,\n      WRAP_PARTIAL_RIGHT_FLAG = 64,\n      WRAP_ARY_FLAG = 128,\n      WRAP_REARG_FLAG = 256,\n      WRAP_FLIP_FLAG = 512;\n\n  /** Used to detect hot functions by number of calls within a span of milliseconds. */\n  var HOT_COUNT = 800,\n      HOT_SPAN = 16;\n\n  /** Used to indicate the type of lazy iteratees. */\n  var LAZY_FILTER_FLAG = 1,\n      LAZY_MAP_FLAG = 2,\n      LAZY_WHILE_FLAG = 3;\n\n  /** Used as references for various `Number` constants. */\n  var INFINITY = 1 / 0,\n      MAX_SAFE_INTEGER = 9007199254740991,\n      MAX_INTEGER = 1.7976931348623157e+308,\n      NAN = 0 / 0;\n\n  /** Used as references for the maximum length and index of an array. */\n  var MAX_ARRAY_LENGTH = 4294967295;\n\n  /** Used to associate wrap methods with their bit flags. */\n  var wrapFlags = [\n    ['ary', WRAP_ARY_FLAG],\n    ['bind', WRAP_BIND_FLAG],\n    ['bindKey', WRAP_BIND_KEY_FLAG],\n    ['curry', WRAP_CURRY_FLAG],\n    ['curryRight', WRAP_CURRY_RIGHT_FLAG],\n    ['flip', WRAP_FLIP_FLAG],\n    ['partial', WRAP_PARTIAL_FLAG],\n    ['partialRight', WRAP_PARTIAL_RIGHT_FLAG],\n    ['rearg', WRAP_REARG_FLAG]\n  ];\n\n  /** `Object#toString` result references. */\n  var argsTag = '[object Arguments]',\n      arrayTag = '[object Array]',\n      asyncTag = '[object AsyncFunction]',\n      boolTag = '[object Boolean]',\n      dateTag = '[object Date]',\n      errorTag = '[object Error]',\n      funcTag = '[object Function]',\n      genTag = '[object GeneratorFunction]',\n      mapTag = '[object Map]',\n      numberTag = '[object Number]',\n      nullTag = '[object Null]',\n      objectTag = '[object Object]',\n      promiseTag = '[object Promise]',\n      proxyTag = '[object Proxy]',\n      regexpTag = '[object RegExp]',\n      setTag = '[object Set]',\n      stringTag = '[object String]',\n      symbolTag = '[object Symbol]',\n      undefinedTag = '[object Undefined]',\n      weakMapTag = '[object WeakMap]';\n\n  var arrayBufferTag = '[object ArrayBuffer]',\n      dataViewTag = '[object DataView]',\n      float32Tag = '[object Float32Array]',\n      float64Tag = '[object Float64Array]',\n      int8Tag = '[object Int8Array]',\n      int16Tag = '[object Int16Array]',\n      int32Tag = '[object Int32Array]',\n      uint8Tag = '[object Uint8Array]',\n      uint8ClampedTag = '[object Uint8ClampedArray]',\n      uint16Tag = '[object Uint16Array]',\n      uint32Tag = '[object Uint32Array]';\n\n  /** Used to match HTML entities and HTML characters. */\n  var reUnescapedHtml = /[&<>\"']/g,\n      reHasUnescapedHtml = RegExp(reUnescapedHtml.source);\n\n  /** Used to match property names within property paths. */\n  var reIsDeepProp = /\\.|\\[(?:[^[\\]]*|([\"'])(?:(?!\\1)[^\\\\]|\\\\.)*?\\1)\\]/,\n      reIsPlainProp = /^\\w*$/,\n      rePropName = /[^.[\\]]+|\\[(?:(-?\\d+(?:\\.\\d+)?)|([\"'])((?:(?!\\2)[^\\\\]|\\\\.)*?)\\2)\\]|(?=(?:\\.|\\[\\])(?:\\.|\\[\\]|$))/g;\n\n  /**\n   * Used to match `RegExp`\n   * [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns).\n   */\n  var reRegExpChar = /[\\\\^$.*+?()[\\]{}|]/g;\n\n  /** Used to match leading and trailing whitespace. */\n  var reTrim = /^\\s+|\\s+$/g;\n\n  /** Used to match wrap detail comments. */\n  var reWrapComment = /\\{(?:\\n\\/\\* \\[wrapped with .+\\] \\*\\/)?\\n?/,\n      reWrapDetails = /\\{\\n\\/\\* \\[wrapped with (.+)\\] \\*/,\n      reSplitDetails = /,? & /;\n\n  /** Used to match backslashes in property paths. */\n  var reEscapeChar = /\\\\(\\\\)?/g;\n\n  /** Used to match `RegExp` flags from their coerced string values. */\n  var reFlags = /\\w*$/;\n\n  /** Used to detect bad signed hexadecimal string values. */\n  var reIsBadHex = /^[-+]0x[0-9a-f]+$/i;\n\n  /** Used to detect binary string values. */\n  var reIsBinary = /^0b[01]+$/i;\n\n  /** Used to detect host constructors (Safari). */\n  var reIsHostCtor = /^\\[object .+?Constructor\\]$/;\n\n  /** Used to detect octal string values. */\n  var reIsOctal = /^0o[0-7]+$/i;\n\n  /** Used to detect unsigned integer values. */\n  var reIsUint = /^(?:0|[1-9]\\d*)$/;\n\n  /** Used to compose unicode character classes. */\n  var rsAstralRange = '\\\\ud800-\\\\udfff',\n      rsComboMarksRange = '\\\\u0300-\\\\u036f',\n      reComboHalfMarksRange = '\\\\ufe20-\\\\ufe2f',\n      rsComboSymbolsRange = '\\\\u20d0-\\\\u20ff',\n      rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange,\n      rsVarRange = '\\\\ufe0e\\\\ufe0f';\n\n  /** Used to compose unicode capture groups. */\n  var rsAstral = '[' + rsAstralRange + ']',\n      rsCombo = '[' + rsComboRange + ']',\n      rsFitz = '\\\\ud83c[\\\\udffb-\\\\udfff]',\n      rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')',\n      rsNonAstral = '[^' + rsAstralRange + ']',\n      rsRegional = '(?:\\\\ud83c[\\\\udde6-\\\\uddff]){2}',\n      rsSurrPair = '[\\\\ud800-\\\\udbff][\\\\udc00-\\\\udfff]',\n      rsZWJ = '\\\\u200d';\n\n  /** Used to compose unicode regexes. */\n  var reOptMod = rsModifier + '?',\n      rsOptVar = '[' + rsVarRange + ']?',\n      rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*',\n      rsSeq = rsOptVar + reOptMod + rsOptJoin,\n      rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')';\n\n  /** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */\n  var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g');\n\n  /** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */\n  var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange  + rsComboRange + rsVarRange + ']');\n\n  /** Used to identify `toStringTag` values of typed arrays. */\n  var typedArrayTags = {};\n  typedArrayTags[float32Tag] = typedArrayTags[float64Tag] =\n      typedArrayTags[int8Tag] = typedArrayTags[int16Tag] =\n          typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] =\n              typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] =\n                  typedArrayTags[uint32Tag] = true;\n  typedArrayTags[argsTag] = typedArrayTags[arrayTag] =\n      typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] =\n          typedArrayTags[dataViewTag] = typedArrayTags[dateTag] =\n              typedArrayTags[errorTag] = typedArrayTags[funcTag] =\n                  typedArrayTags[mapTag] = typedArrayTags[numberTag] =\n                      typedArrayTags[objectTag] = typedArrayTags[regexpTag] =\n                          typedArrayTags[setTag] = typedArrayTags[stringTag] =\n                              typedArrayTags[weakMapTag] = false;\n\n  /** Used to identify `toStringTag` values supported by `_.clone`. */\n  var cloneableTags = {};\n  cloneableTags[argsTag] = cloneableTags[arrayTag] =\n      cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] =\n          cloneableTags[boolTag] = cloneableTags[dateTag] =\n              cloneableTags[float32Tag] = cloneableTags[float64Tag] =\n                  cloneableTags[int8Tag] = cloneableTags[int16Tag] =\n                      cloneableTags[int32Tag] = cloneableTags[mapTag] =\n                          cloneableTags[numberTag] = cloneableTags[objectTag] =\n                              cloneableTags[regexpTag] = cloneableTags[setTag] =\n                                  cloneableTags[stringTag] = cloneableTags[symbolTag] =\n                                      cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] =\n                                          cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true;\n  cloneableTags[errorTag] = cloneableTags[funcTag] =\n      cloneableTags[weakMapTag] = false;\n\n  /** Used to map characters to HTML entities. */\n  var htmlEscapes = {\n    '&': '&amp;',\n    '<': '&lt;',\n    '>': '&gt;',\n    '\"': '&quot;',\n    \"'\": '&#39;'\n  };\n\n  /** Built-in method references without a dependency on `root`. */\n  var freeParseFloat = parseFloat,\n      freeParseInt = parseInt;\n\n  /** Detect free variable `global` from Node.js. */\n  var freeGlobal = typeof global == 'object' && global && global.Object === Object && global;\n\n  /** Detect free variable `self`. */\n  var freeSelf = typeof self == 'object' && self && self.Object === Object && self;\n\n  /** Used as a reference to the global object. */\n  var root = freeGlobal || freeSelf || Function('return this')();\n\n  /** Detect free variable `exports`. */\n  var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports;\n\n  /** Detect free variable `module`. */\n  var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module;\n\n  /** Detect the popular CommonJS extension `module.exports`. */\n  var moduleExports = freeModule && freeModule.exports === freeExports;\n\n  /** Detect free variable `process` from Node.js. */\n  var freeProcess = moduleExports && freeGlobal.process;\n\n  /** Used to access faster Node.js helpers. */\n  var nodeUtil = (function() {\n    try {\n      return freeProcess && freeProcess.binding && freeProcess.binding('util');\n    } catch (e) {}\n  }());\n\n  /* Node.js helper references. */\n  var nodeIsDate = nodeUtil && nodeUtil.isDate,\n      nodeIsMap = nodeUtil && nodeUtil.isMap,\n      nodeIsRegExp = nodeUtil && nodeUtil.isRegExp,\n      nodeIsSet = nodeUtil && nodeUtil.isSet,\n      nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray;\n\n  /*--------------------------------------------------------------------------*/\n\n  /**\n   * A faster alternative to `Function#apply`, this function invokes `func`\n   * with the `this` binding of `thisArg` and the arguments of `args`.\n   *\n   * @private\n   * @param {Function} func The function to invoke.\n   * @param {*} thisArg The `this` binding of `func`.\n   * @param {Array} args The arguments to invoke `func` with.\n   * @returns {*} Returns the result of `func`.\n   */\n  function apply(func, thisArg, args) {\n    switch (args.length) {\n      case 0: return func.call(thisArg);\n      case 1: return func.call(thisArg, args[0]);\n      case 2: return func.call(thisArg, args[0], args[1]);\n      case 3: return func.call(thisArg, args[0], args[1], args[2]);\n    }\n    return func.apply(thisArg, args);\n  }\n\n  /**\n   * A specialized version of `baseAggregator` for arrays.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} setter The function to set `accumulator` values.\n   * @param {Function} iteratee The iteratee to transform keys.\n   * @param {Object} accumulator The initial aggregated object.\n   * @returns {Function} Returns `accumulator`.\n   */\n  function arrayAggregator(array, setter, iteratee, accumulator) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    while (++index < length) {\n      var value = array[index];\n      setter(accumulator, value, iteratee(value), array);\n    }\n    return accumulator;\n  }\n\n  /**\n   * A specialized version of `_.forEach` for arrays without support for\n   * iteratee shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Array} Returns `array`.\n   */\n  function arrayEach(array, iteratee) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    while (++index < length) {\n      if (iteratee(array[index], index, array) === false) {\n        break;\n      }\n    }\n    return array;\n  }\n\n  /**\n   * A specialized version of `_.every` for arrays without support for\n   * iteratee shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {boolean} Returns `true` if all elements pass the predicate check,\n   *  else `false`.\n   */\n  function arrayEvery(array, predicate) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    while (++index < length) {\n      if (!predicate(array[index], index, array)) {\n        return false;\n      }\n    }\n    return true;\n  }\n\n  /**\n   * A specialized version of `_.filter` for arrays without support for\n   * iteratee shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {Array} Returns the new filtered array.\n   */\n  function arrayFilter(array, predicate) {\n    var index = -1,\n        length = array == null ? 0 : array.length,\n        resIndex = 0,\n        result = [];\n\n    while (++index < length) {\n      var value = array[index];\n      if (predicate(value, index, array)) {\n        result[resIndex++] = value;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * A specialized version of `_.includes` for arrays without support for\n   * specifying an index to search from.\n   *\n   * @private\n   * @param {Array} [array] The array to inspect.\n   * @param {*} target The value to search for.\n   * @returns {boolean} Returns `true` if `target` is found, else `false`.\n   */\n  function arrayIncludes(array, value) {\n    var length = array == null ? 0 : array.length;\n    return !!length && baseIndexOf(array, value, 0) > -1;\n  }\n\n  /**\n   * This function is like `arrayIncludes` except that it accepts a comparator.\n   *\n   * @private\n   * @param {Array} [array] The array to inspect.\n   * @param {*} target The value to search for.\n   * @param {Function} comparator The comparator invoked per element.\n   * @returns {boolean} Returns `true` if `target` is found, else `false`.\n   */\n  function arrayIncludesWith(array, value, comparator) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    while (++index < length) {\n      if (comparator(value, array[index])) {\n        return true;\n      }\n    }\n    return false;\n  }\n\n  /**\n   * A specialized version of `_.map` for arrays without support for iteratee\n   * shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Array} Returns the new mapped array.\n   */\n  function arrayMap(array, iteratee) {\n    var index = -1,\n        length = array == null ? 0 : array.length,\n        result = Array(length);\n\n    while (++index < length) {\n      result[index] = iteratee(array[index], index, array);\n    }\n    return result;\n  }\n\n  /**\n   * Appends the elements of `values` to `array`.\n   *\n   * @private\n   * @param {Array} array The array to modify.\n   * @param {Array} values The values to append.\n   * @returns {Array} Returns `array`.\n   */\n  function arrayPush(array, values) {\n    var index = -1,\n        length = values.length,\n        offset = array.length;\n\n    while (++index < length) {\n      array[offset + index] = values[index];\n    }\n    return array;\n  }\n\n  /**\n   * A specialized version of `_.reduce` for arrays without support for\n   * iteratee shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @param {*} [accumulator] The initial value.\n   * @param {boolean} [initAccum] Specify using the first element of `array` as\n   *  the initial value.\n   * @returns {*} Returns the accumulated value.\n   */\n  function arrayReduce(array, iteratee, accumulator, initAccum) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    if (initAccum && length) {\n      accumulator = array[++index];\n    }\n    while (++index < length) {\n      accumulator = iteratee(accumulator, array[index], index, array);\n    }\n    return accumulator;\n  }\n\n  /**\n   * A specialized version of `_.some` for arrays without support for iteratee\n   * shorthands.\n   *\n   * @private\n   * @param {Array} [array] The array to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {boolean} Returns `true` if any element passes the predicate check,\n   *  else `false`.\n   */\n  function arraySome(array, predicate) {\n    var index = -1,\n        length = array == null ? 0 : array.length;\n\n    while (++index < length) {\n      if (predicate(array[index], index, array)) {\n        return true;\n      }\n    }\n    return false;\n  }\n\n  /**\n   * Gets the size of an ASCII `string`.\n   *\n   * @private\n   * @param {string} string The string inspect.\n   * @returns {number} Returns the string size.\n   */\n  var asciiSize = baseProperty('length');\n\n  /**\n   * Converts an ASCII `string` to an array.\n   *\n   * @private\n   * @param {string} string The string to convert.\n   * @returns {Array} Returns the converted array.\n   */\n  function asciiToArray(string) {\n    return string.split('');\n  }\n\n  /**\n   * The base implementation of methods like `_.findKey` and `_.findLastKey`,\n   * without support for iteratee shorthands, which iterates over `collection`\n   * using `eachFunc`.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to inspect.\n   * @param {Function} predicate The function invoked per iteration.\n   * @param {Function} eachFunc The function to iterate over `collection`.\n   * @returns {*} Returns the found element or its key, else `undefined`.\n   */\n  function baseFindKey(collection, predicate, eachFunc) {\n    var result;\n    eachFunc(collection, function(value, key, collection) {\n      if (predicate(value, key, collection)) {\n        result = key;\n        return false;\n      }\n    });\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.findIndex` and `_.findLastIndex` without\n   * support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {Function} predicate The function invoked per iteration.\n   * @param {number} fromIndex The index to search from.\n   * @param {boolean} [fromRight] Specify iterating from right to left.\n   * @returns {number} Returns the index of the matched value, else `-1`.\n   */\n  function baseFindIndex(array, predicate, fromIndex, fromRight) {\n    var length = array.length,\n        index = fromIndex + (fromRight ? 1 : -1);\n\n    while ((fromRight ? index-- : ++index < length)) {\n      if (predicate(array[index], index, array)) {\n        return index;\n      }\n    }\n    return -1;\n  }\n\n  /**\n   * The base implementation of `_.indexOf` without `fromIndex` bounds checks.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {*} value The value to search for.\n   * @param {number} fromIndex The index to search from.\n   * @returns {number} Returns the index of the matched value, else `-1`.\n   */\n  function baseIndexOf(array, value, fromIndex) {\n    return value === value\n        ? strictIndexOf(array, value, fromIndex)\n        : baseFindIndex(array, baseIsNaN, fromIndex);\n  }\n\n  /**\n   * The base implementation of `_.isNaN` without support for number objects.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.\n   */\n  function baseIsNaN(value) {\n    return value !== value;\n  }\n\n  /**\n   * The base implementation of `_.property` without support for deep paths.\n   *\n   * @private\n   * @param {string} key The key of the property to get.\n   * @returns {Function} Returns the new accessor function.\n   */\n  function baseProperty(key) {\n    return function(object) {\n      return object == null ? undefined : object[key];\n    };\n  }\n\n  /**\n   * The base implementation of `_.propertyOf` without support for deep paths.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Function} Returns the new accessor function.\n   */\n  function basePropertyOf(object) {\n    return function(key) {\n      return object == null ? undefined : object[key];\n    };\n  }\n\n  /**\n   * The base implementation of `_.reduce` and `_.reduceRight`, without support\n   * for iteratee shorthands, which iterates over `collection` using `eachFunc`.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @param {*} accumulator The initial value.\n   * @param {boolean} initAccum Specify using the first or last element of\n   *  `collection` as the initial value.\n   * @param {Function} eachFunc The function to iterate over `collection`.\n   * @returns {*} Returns the accumulated value.\n   */\n  function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) {\n    eachFunc(collection, function(value, index, collection) {\n      accumulator = initAccum\n          ? (initAccum = false, value)\n          : iteratee(accumulator, value, index, collection);\n    });\n    return accumulator;\n  }\n\n  /**\n   * The base implementation of `_.sortBy` which uses `comparer` to define the\n   * sort order of `array` and replaces criteria objects with their corresponding\n   * values.\n   *\n   * @private\n   * @param {Array} array The array to sort.\n   * @param {Function} comparer The function to define sort order.\n   * @returns {Array} Returns `array`.\n   */\n  function baseSortBy(array, comparer) {\n    var length = array.length;\n\n    array.sort(comparer);\n    while (length--) {\n      array[length] = array[length].value;\n    }\n    return array;\n  }\n\n  /**\n   * The base implementation of `_.times` without support for iteratee shorthands\n   * or max array length checks.\n   *\n   * @private\n   * @param {number} n The number of times to invoke `iteratee`.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Array} Returns the array of results.\n   */\n  function baseTimes(n, iteratee) {\n    var index = -1,\n        result = Array(n);\n\n    while (++index < n) {\n      result[index] = iteratee(index);\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.unary` without support for storing metadata.\n   *\n   * @private\n   * @param {Function} func The function to cap arguments for.\n   * @returns {Function} Returns the new capped function.\n   */\n  function baseUnary(func) {\n    return function(value) {\n      return func(value);\n    };\n  }\n\n  /**\n   * The base implementation of `_.values` and `_.valuesIn` which creates an\n   * array of `object` property values corresponding to the property names\n   * of `props`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Array} props The property names to get values for.\n   * @returns {Object} Returns the array of property values.\n   */\n  function baseValues(object, props) {\n    return arrayMap(props, function(key) {\n      return object[key];\n    });\n  }\n\n  /**\n   * Checks if a `cache` value for `key` exists.\n   *\n   * @private\n   * @param {Object} cache The cache to query.\n   * @param {string} key The key of the entry to check.\n   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\n   */\n  function cacheHas(cache, key) {\n    return cache.has(key);\n  }\n\n  /**\n   * Used by `_.trim` and `_.trimStart` to get the index of the first string symbol\n   * that is not found in the character symbols.\n   *\n   * @private\n   * @param {Array} strSymbols The string symbols to inspect.\n   * @param {Array} chrSymbols The character symbols to find.\n   * @returns {number} Returns the index of the first unmatched string symbol.\n   */\n  function charsStartIndex(strSymbols, chrSymbols) {\n    var index = -1,\n        length = strSymbols.length;\n\n    while (++index < length && baseIndexOf(chrSymbols, strSymbols[index], 0) > -1) {}\n    return index;\n  }\n\n  /**\n   * Used by `_.trim` and `_.trimEnd` to get the index of the last string symbol\n   * that is not found in the character symbols.\n   *\n   * @private\n   * @param {Array} strSymbols The string symbols to inspect.\n   * @param {Array} chrSymbols The character symbols to find.\n   * @returns {number} Returns the index of the last unmatched string symbol.\n   */\n  function charsEndIndex(strSymbols, chrSymbols) {\n    var index = strSymbols.length;\n\n    while (index-- && baseIndexOf(chrSymbols, strSymbols[index], 0) > -1) {}\n    return index;\n  }\n\n  /**\n   * Gets the number of `placeholder` occurrences in `array`.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {*} placeholder The placeholder to search for.\n   * @returns {number} Returns the placeholder count.\n   */\n  function countHolders(array, placeholder) {\n    var length = array.length,\n        result = 0;\n\n    while (length--) {\n      if (array[length] === placeholder) {\n        ++result;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Used by `_.escape` to convert characters to HTML entities.\n   *\n   * @private\n   * @param {string} chr The matched character to escape.\n   * @returns {string} Returns the escaped character.\n   */\n  var escapeHtmlChar = basePropertyOf(htmlEscapes);\n\n  /**\n   * Gets the value at `key` of `object`.\n   *\n   * @private\n   * @param {Object} [object] The object to query.\n   * @param {string} key The key of the property to get.\n   * @returns {*} Returns the property value.\n   */\n  function getValue(object, key) {\n    return object == null ? undefined : object[key];\n  }\n\n  /**\n   * Checks if `string` contains Unicode symbols.\n   *\n   * @private\n   * @param {string} string The string to inspect.\n   * @returns {boolean} Returns `true` if a symbol is found, else `false`.\n   */\n  function hasUnicode(string) {\n    return reHasUnicode.test(string);\n  }\n\n  /**\n   * Converts `iterator` to an array.\n   *\n   * @private\n   * @param {Object} iterator The iterator to convert.\n   * @returns {Array} Returns the converted array.\n   */\n  function iteratorToArray(iterator) {\n    var data,\n        result = [];\n\n    while (!(data = iterator.next()).done) {\n      result.push(data.value);\n    }\n    return result;\n  }\n\n  /**\n   * Converts `map` to its key-value pairs.\n   *\n   * @private\n   * @param {Object} map The map to convert.\n   * @returns {Array} Returns the key-value pairs.\n   */\n  function mapToArray(map) {\n    var index = -1,\n        result = Array(map.size);\n\n    map.forEach(function(value, key) {\n      result[++index] = [key, value];\n    });\n    return result;\n  }\n\n  /**\n   * Creates a unary function that invokes `func` with its argument transformed.\n   *\n   * @private\n   * @param {Function} func The function to wrap.\n   * @param {Function} transform The argument transform.\n   * @returns {Function} Returns the new function.\n   */\n  function overArg(func, transform) {\n    return function(arg) {\n      return func(transform(arg));\n    };\n  }\n\n  /**\n   * Replaces all `placeholder` elements in `array` with an internal placeholder\n   * and returns an array of their indexes.\n   *\n   * @private\n   * @param {Array} array The array to modify.\n   * @param {*} placeholder The placeholder to replace.\n   * @returns {Array} Returns the new array of placeholder indexes.\n   */\n  function replaceHolders(array, placeholder) {\n    var index = -1,\n        length = array.length,\n        resIndex = 0,\n        result = [];\n\n    while (++index < length) {\n      var value = array[index];\n      if (value === placeholder || value === PLACEHOLDER) {\n        array[index] = PLACEHOLDER;\n        result[resIndex++] = index;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Gets the value at `key`, unless `key` is \"__proto__\".\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {string} key The key of the property to get.\n   * @returns {*} Returns the property value.\n   */\n  function safeGet(object, key) {\n    return key == '__proto__'\n        ? undefined\n        : object[key];\n  }\n\n  /**\n   * Converts `set` to an array of its values.\n   *\n   * @private\n   * @param {Object} set The set to convert.\n   * @returns {Array} Returns the values.\n   */\n  function setToArray(set) {\n    var index = -1,\n        result = Array(set.size);\n\n    set.forEach(function(value) {\n      result[++index] = value;\n    });\n    return result;\n  }\n\n  /**\n   * A specialized version of `_.indexOf` which performs strict equality\n   * comparisons of values, i.e. `===`.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {*} value The value to search for.\n   * @param {number} fromIndex The index to search from.\n   * @returns {number} Returns the index of the matched value, else `-1`.\n   */\n  function strictIndexOf(array, value, fromIndex) {\n    var index = fromIndex - 1,\n        length = array.length;\n\n    while (++index < length) {\n      if (array[index] === value) {\n        return index;\n      }\n    }\n    return -1;\n  }\n\n  /**\n   * Gets the number of symbols in `string`.\n   *\n   * @private\n   * @param {string} string The string to inspect.\n   * @returns {number} Returns the string size.\n   */\n  function stringSize(string) {\n    return hasUnicode(string)\n        ? unicodeSize(string)\n        : asciiSize(string);\n  }\n\n  /**\n   * Converts `string` to an array.\n   *\n   * @private\n   * @param {string} string The string to convert.\n   * @returns {Array} Returns the converted array.\n   */\n  function stringToArray(string) {\n    return hasUnicode(string)\n        ? unicodeToArray(string)\n        : asciiToArray(string);\n  }\n\n  /**\n   * Gets the size of a Unicode `string`.\n   *\n   * @private\n   * @param {string} string The string inspect.\n   * @returns {number} Returns the string size.\n   */\n  function unicodeSize(string) {\n    var result = reUnicode.lastIndex = 0;\n    while (reUnicode.test(string)) {\n      ++result;\n    }\n    return result;\n  }\n\n  /**\n   * Converts a Unicode `string` to an array.\n   *\n   * @private\n   * @param {string} string The string to convert.\n   * @returns {Array} Returns the converted array.\n   */\n  function unicodeToArray(string) {\n    return string.match(reUnicode) || [];\n  }\n\n  /*--------------------------------------------------------------------------*/\n\n  /** Used for built-in method references. */\n  var arrayProto = Array.prototype,\n      funcProto = Function.prototype,\n      objectProto = Object.prototype;\n\n  /** Used to detect overreaching core-js shims. */\n  var coreJsData = root['__core-js_shared__'];\n\n  /** Used to resolve the decompiled source of functions. */\n  var funcToString = funcProto.toString;\n\n  /** Used to check objects for own properties. */\n  var hasOwnProperty = objectProto.hasOwnProperty;\n\n  /** Used to generate unique IDs. */\n  var idCounter = 0;\n\n  /** Used to detect methods masquerading as native. */\n  var maskSrcKey = (function() {\n    var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || '');\n    return uid ? ('Symbol(src)_1.' + uid) : '';\n  }());\n\n  /**\n   * Used to resolve the\n   * [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring)\n   * of values.\n   */\n  var nativeObjectToString = objectProto.toString;\n\n  /** Used to infer the `Object` constructor. */\n  var objectCtorString = funcToString.call(Object);\n\n  /** Used to restore the original `_` reference in `_.noConflict`. */\n  var oldDash = root._;\n\n  /** Used to detect if a method is native. */\n  var reIsNative = RegExp('^' +\n      funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\\\$&')\n          .replace(/hasOwnProperty|(function).*?(?=\\\\\\()| for .+?(?=\\\\\\])/g, '$1.*?') + '$'\n  );\n\n  /** Built-in value references. */\n  var Buffer = moduleExports ? root.Buffer : undefined,\n      Symbol = root.Symbol,\n      Uint8Array = root.Uint8Array,\n      allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined,\n      getPrototype = overArg(Object.getPrototypeOf, Object),\n      objectCreate = Object.create,\n      propertyIsEnumerable = objectProto.propertyIsEnumerable,\n      splice = arrayProto.splice,\n      spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined,\n      symIterator = Symbol ? Symbol.iterator : undefined,\n      symToStringTag = Symbol ? Symbol.toStringTag : undefined;\n\n  var defineProperty = (function() {\n    try {\n      var func = getNative(Object, 'defineProperty');\n      func({}, '', {});\n      return func;\n    } catch (e) {}\n  }());\n\n  /* Built-in method references for those with the same name as other `lodash` methods. */\n  var nativeCeil = Math.ceil,\n      nativeFloor = Math.floor,\n      nativeGetSymbols = Object.getOwnPropertySymbols,\n      nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined,\n      nativeIsFinite = root.isFinite,\n      nativeKeys = overArg(Object.keys, Object),\n      nativeMax = Math.max,\n      nativeMin = Math.min,\n      nativeNow = Date.now,\n      nativeRandom = Math.random,\n      nativeReverse = arrayProto.reverse;\n\n  /* Built-in method references that are verified to be native. */\n  var DataView = getNative(root, 'DataView'),\n      Map = getNative(root, 'Map'),\n      Promise = getNative(root, 'Promise'),\n      Set = getNative(root, 'Set'),\n      WeakMap = getNative(root, 'WeakMap'),\n      nativeCreate = getNative(Object, 'create');\n\n  /** Used to store function metadata. */\n  var metaMap = WeakMap && new WeakMap;\n\n  /** Used to lookup unminified function names. */\n  var realNames = {};\n\n  /** Used to detect maps, sets, and weakmaps. */\n  var dataViewCtorString = toSource(DataView),\n      mapCtorString = toSource(Map),\n      promiseCtorString = toSource(Promise),\n      setCtorString = toSource(Set),\n      weakMapCtorString = toSource(WeakMap);\n\n  /** Used to convert symbols to primitives and strings. */\n  var symbolProto = Symbol ? Symbol.prototype : undefined,\n      symbolValueOf = symbolProto ? symbolProto.valueOf : undefined,\n      symbolToString = symbolProto ? symbolProto.toString : undefined;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a `lodash` object which wraps `value` to enable implicit method\n   * chain sequences. Methods that operate on and return arrays, collections,\n   * and functions can be chained together. Methods that retrieve a single value\n   * or may return a primitive value will automatically end the chain sequence\n   * and return the unwrapped value. Otherwise, the value must be unwrapped\n   * with `_#value`.\n   *\n   * Explicit chain sequences, which must be unwrapped with `_#value`, may be\n   * enabled using `_.chain`.\n   *\n   * The execution of chained methods is lazy, that is, it's deferred until\n   * `_#value` is implicitly or explicitly called.\n   *\n   * Lazy evaluation allows several methods to support shortcut fusion.\n   * Shortcut fusion is an optimization to merge iteratee calls; this avoids\n   * the creation of intermediate arrays and can greatly reduce the number of\n   * iteratee executions. Sections of a chain sequence qualify for shortcut\n   * fusion if the section is applied to an array and iteratees accept only\n   * one argument. The heuristic for whether a section qualifies for shortcut\n   * fusion is subject to change.\n   *\n   * Chaining is supported in custom builds as long as the `_#value` method is\n   * directly or indirectly included in the build.\n   *\n   * In addition to lodash methods, wrappers have `Array` and `String` methods.\n   *\n   * The wrapper `Array` methods are:\n   * `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift`\n   *\n   * The wrapper `String` methods are:\n   * `replace` and `split`\n   *\n   * The wrapper methods that support shortcut fusion are:\n   * `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`,\n   * `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`,\n   * `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray`\n   *\n   * The chainable wrapper methods are:\n   * `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`,\n   * `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`,\n   * `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`,\n   * `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`,\n   * `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`,\n   * `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`,\n   * `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`,\n   * `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`,\n   * `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`,\n   * `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`,\n   * `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`,\n   * `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`,\n   * `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`,\n   * `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`,\n   * `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`,\n   * `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`,\n   * `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`,\n   * `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`,\n   * `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`,\n   * `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`,\n   * `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`,\n   * `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`,\n   * `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`,\n   * `zipObject`, `zipObjectDeep`, and `zipWith`\n   *\n   * The wrapper methods that are **not** chainable by default are:\n   * `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`,\n   * `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`,\n   * `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`,\n   * `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`,\n   * `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`,\n   * `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`,\n   * `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`,\n   * `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`,\n   * `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`,\n   * `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`,\n   * `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`,\n   * `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`,\n   * `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`,\n   * `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`,\n   * `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`,\n   * `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`,\n   * `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`,\n   * `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`,\n   * `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`,\n   * `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`,\n   * `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`,\n   * `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`,\n   * `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`,\n   * `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`,\n   * `upperFirst`, `value`, and `words`\n   *\n   * @name _\n   * @constructor\n   * @category Seq\n   * @param {*} value The value to wrap in a `lodash` instance.\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * function square(n) {\n   *   return n * n;\n   * }\n   *\n   * var wrapped = _([1, 2, 3]);\n   *\n   * // Returns an unwrapped value.\n   * wrapped.reduce(_.add);\n   * // => 6\n   *\n   * // Returns a wrapped value.\n   * var squares = wrapped.map(square);\n   *\n   * _.isArray(squares);\n   * // => false\n   *\n   * _.isArray(squares.value());\n   * // => true\n   */\n  function lodash(value) {\n    if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) {\n      if (value instanceof LodashWrapper) {\n        return value;\n      }\n      if (hasOwnProperty.call(value, '__wrapped__')) {\n        return wrapperClone(value);\n      }\n    }\n    return new LodashWrapper(value);\n  }\n\n  /**\n   * The base implementation of `_.create` without support for assigning\n   * properties to the created object.\n   *\n   * @private\n   * @param {Object} proto The object to inherit from.\n   * @returns {Object} Returns the new object.\n   */\n  var baseCreate = (function() {\n    function object() {}\n    return function(proto) {\n      if (!isObject(proto)) {\n        return {};\n      }\n      if (objectCreate) {\n        return objectCreate(proto);\n      }\n      object.prototype = proto;\n      var result = new object;\n      object.prototype = undefined;\n      return result;\n    };\n  }());\n\n  /**\n   * The function whose prototype chain sequence wrappers inherit from.\n   *\n   * @private\n   */\n  function baseLodash() {\n    // No operation performed.\n  }\n\n  /**\n   * The base constructor for creating `lodash` wrapper objects.\n   *\n   * @private\n   * @param {*} value The value to wrap.\n   * @param {boolean} [chainAll] Enable explicit method chain sequences.\n   */\n  function LodashWrapper(value, chainAll) {\n    this.__wrapped__ = value;\n    this.__actions__ = [];\n    this.__chain__ = !!chainAll;\n    this.__index__ = 0;\n    this.__values__ = undefined;\n  }\n\n  // Ensure wrappers are instances of `baseLodash`.\n  lodash.prototype = baseLodash.prototype;\n  lodash.prototype.constructor = lodash;\n\n  LodashWrapper.prototype = baseCreate(baseLodash.prototype);\n  LodashWrapper.prototype.constructor = LodashWrapper;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a lazy wrapper object which wraps `value` to enable lazy evaluation.\n   *\n   * @private\n   * @constructor\n   * @param {*} value The value to wrap.\n   */\n  function LazyWrapper(value) {\n    this.__wrapped__ = value;\n    this.__actions__ = [];\n    this.__dir__ = 1;\n    this.__filtered__ = false;\n    this.__iteratees__ = [];\n    this.__takeCount__ = MAX_ARRAY_LENGTH;\n    this.__views__ = [];\n  }\n\n  /**\n   * Creates a clone of the lazy wrapper object.\n   *\n   * @private\n   * @name clone\n   * @memberOf LazyWrapper\n   * @returns {Object} Returns the cloned `LazyWrapper` object.\n   */\n  function lazyClone() {\n    var result = new LazyWrapper(this.__wrapped__);\n    result.__actions__ = copyArray(this.__actions__);\n    result.__dir__ = this.__dir__;\n    result.__filtered__ = this.__filtered__;\n    result.__iteratees__ = copyArray(this.__iteratees__);\n    result.__takeCount__ = this.__takeCount__;\n    result.__views__ = copyArray(this.__views__);\n    return result;\n  }\n\n  /**\n   * Reverses the direction of lazy iteration.\n   *\n   * @private\n   * @name reverse\n   * @memberOf LazyWrapper\n   * @returns {Object} Returns the new reversed `LazyWrapper` object.\n   */\n  function lazyReverse() {\n    if (this.__filtered__) {\n      var result = new LazyWrapper(this);\n      result.__dir__ = -1;\n      result.__filtered__ = true;\n    } else {\n      result = this.clone();\n      result.__dir__ *= -1;\n    }\n    return result;\n  }\n\n  /**\n   * Extracts the unwrapped value from its lazy wrapper.\n   *\n   * @private\n   * @name value\n   * @memberOf LazyWrapper\n   * @returns {*} Returns the unwrapped value.\n   */\n  function lazyValue() {\n    var array = this.__wrapped__.value(),\n        dir = this.__dir__,\n        isArr = isArray(array),\n        isRight = dir < 0,\n        arrLength = isArr ? array.length : 0,\n        view = getView(0, arrLength, this.__views__),\n        start = view.start,\n        end = view.end,\n        length = end - start,\n        index = isRight ? end : (start - 1),\n        iteratees = this.__iteratees__,\n        iterLength = iteratees.length,\n        resIndex = 0,\n        takeCount = nativeMin(length, this.__takeCount__);\n\n    if (!isArr || (!isRight && arrLength == length && takeCount == length)) {\n      return baseWrapperValue(array, this.__actions__);\n    }\n    var result = [];\n\n    outer:\n        while (length-- && resIndex < takeCount) {\n          index += dir;\n\n          var iterIndex = -1,\n              value = array[index];\n\n          while (++iterIndex < iterLength) {\n            var data = iteratees[iterIndex],\n                iteratee = data.iteratee,\n                type = data.type,\n                computed = iteratee(value);\n\n            if (type == LAZY_MAP_FLAG) {\n              value = computed;\n            } else if (!computed) {\n              if (type == LAZY_FILTER_FLAG) {\n                continue outer;\n              } else {\n                break outer;\n              }\n            }\n          }\n          result[resIndex++] = value;\n        }\n    return result;\n  }\n\n  // Ensure `LazyWrapper` is an instance of `baseLodash`.\n  LazyWrapper.prototype = baseCreate(baseLodash.prototype);\n  LazyWrapper.prototype.constructor = LazyWrapper;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a hash object.\n   *\n   * @private\n   * @constructor\n   * @param {Array} [entries] The key-value pairs to cache.\n   */\n  function Hash(entries) {\n    var index = -1,\n        length = entries == null ? 0 : entries.length;\n\n    this.clear();\n    while (++index < length) {\n      var entry = entries[index];\n      this.set(entry[0], entry[1]);\n    }\n  }\n\n  /**\n   * Removes all key-value entries from the hash.\n   *\n   * @private\n   * @name clear\n   * @memberOf Hash\n   */\n  function hashClear() {\n    this.__data__ = nativeCreate ? nativeCreate(null) : {};\n    this.size = 0;\n  }\n\n  /**\n   * Removes `key` and its value from the hash.\n   *\n   * @private\n   * @name delete\n   * @memberOf Hash\n   * @param {Object} hash The hash to modify.\n   * @param {string} key The key of the value to remove.\n   * @returns {boolean} Returns `true` if the entry was removed, else `false`.\n   */\n  function hashDelete(key) {\n    var result = this.has(key) && delete this.__data__[key];\n    this.size -= result ? 1 : 0;\n    return result;\n  }\n\n  /**\n   * Gets the hash value for `key`.\n   *\n   * @private\n   * @name get\n   * @memberOf Hash\n   * @param {string} key The key of the value to get.\n   * @returns {*} Returns the entry value.\n   */\n  function hashGet(key) {\n    var data = this.__data__;\n    if (nativeCreate) {\n      var result = data[key];\n      return result === HASH_UNDEFINED ? undefined : result;\n    }\n    return hasOwnProperty.call(data, key) ? data[key] : undefined;\n  }\n\n  /**\n   * Checks if a hash value for `key` exists.\n   *\n   * @private\n   * @name has\n   * @memberOf Hash\n   * @param {string} key The key of the entry to check.\n   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\n   */\n  function hashHas(key) {\n    var data = this.__data__;\n    return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key);\n  }\n\n  /**\n   * Sets the hash `key` to `value`.\n   *\n   * @private\n   * @name set\n   * @memberOf Hash\n   * @param {string} key The key of the value to set.\n   * @param {*} value The value to set.\n   * @returns {Object} Returns the hash instance.\n   */\n  function hashSet(key, value) {\n    var data = this.__data__;\n    this.size += this.has(key) ? 0 : 1;\n    data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value;\n    return this;\n  }\n\n  // Add methods to `Hash`.\n  Hash.prototype.clear = hashClear;\n  Hash.prototype['delete'] = hashDelete;\n  Hash.prototype.get = hashGet;\n  Hash.prototype.has = hashHas;\n  Hash.prototype.set = hashSet;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates an list cache object.\n   *\n   * @private\n   * @constructor\n   * @param {Array} [entries] The key-value pairs to cache.\n   */\n  function ListCache(entries) {\n    var index = -1,\n        length = entries == null ? 0 : entries.length;\n\n    this.clear();\n    while (++index < length) {\n      var entry = entries[index];\n      this.set(entry[0], entry[1]);\n    }\n  }\n\n  /**\n   * Removes all key-value entries from the list cache.\n   *\n   * @private\n   * @name clear\n   * @memberOf ListCache\n   */\n  function listCacheClear() {\n    this.__data__ = [];\n    this.size = 0;\n  }\n\n  /**\n   * Removes `key` and its value from the list cache.\n   *\n   * @private\n   * @name delete\n   * @memberOf ListCache\n   * @param {string} key The key of the value to remove.\n   * @returns {boolean} Returns `true` if the entry was removed, else `false`.\n   */\n  function listCacheDelete(key) {\n    var data = this.__data__,\n        index = assocIndexOf(data, key);\n\n    if (index < 0) {\n      return false;\n    }\n    var lastIndex = data.length - 1;\n    if (index == lastIndex) {\n      data.pop();\n    } else {\n      splice.call(data, index, 1);\n    }\n    --this.size;\n    return true;\n  }\n\n  /**\n   * Gets the list cache value for `key`.\n   *\n   * @private\n   * @name get\n   * @memberOf ListCache\n   * @param {string} key The key of the value to get.\n   * @returns {*} Returns the entry value.\n   */\n  function listCacheGet(key) {\n    var data = this.__data__,\n        index = assocIndexOf(data, key);\n\n    return index < 0 ? undefined : data[index][1];\n  }\n\n  /**\n   * Checks if a list cache value for `key` exists.\n   *\n   * @private\n   * @name has\n   * @memberOf ListCache\n   * @param {string} key The key of the entry to check.\n   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\n   */\n  function listCacheHas(key) {\n    return assocIndexOf(this.__data__, key) > -1;\n  }\n\n  /**\n   * Sets the list cache `key` to `value`.\n   *\n   * @private\n   * @name set\n   * @memberOf ListCache\n   * @param {string} key The key of the value to set.\n   * @param {*} value The value to set.\n   * @returns {Object} Returns the list cache instance.\n   */\n  function listCacheSet(key, value) {\n    var data = this.__data__,\n        index = assocIndexOf(data, key);\n\n    if (index < 0) {\n      ++this.size;\n      data.push([key, value]);\n    } else {\n      data[index][1] = value;\n    }\n    return this;\n  }\n\n  // Add methods to `ListCache`.\n  ListCache.prototype.clear = listCacheClear;\n  ListCache.prototype['delete'] = listCacheDelete;\n  ListCache.prototype.get = listCacheGet;\n  ListCache.prototype.has = listCacheHas;\n  ListCache.prototype.set = listCacheSet;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a map cache object to store key-value pairs.\n   *\n   * @private\n   * @constructor\n   * @param {Array} [entries] The key-value pairs to cache.\n   */\n  function MapCache(entries) {\n    var index = -1,\n        length = entries == null ? 0 : entries.length;\n\n    this.clear();\n    while (++index < length) {\n      var entry = entries[index];\n      this.set(entry[0], entry[1]);\n    }\n  }\n\n  /**\n   * Removes all key-value entries from the map.\n   *\n   * @private\n   * @name clear\n   * @memberOf MapCache\n   */\n  function mapCacheClear() {\n    this.size = 0;\n    this.__data__ = {\n      'hash': new Hash,\n      'map': new (Map || ListCache),\n      'string': new Hash\n    };\n  }\n\n  /**\n   * Removes `key` and its value from the map.\n   *\n   * @private\n   * @name delete\n   * @memberOf MapCache\n   * @param {string} key The key of the value to remove.\n   * @returns {boolean} Returns `true` if the entry was removed, else `false`.\n   */\n  function mapCacheDelete(key) {\n    var result = getMapData(this, key)['delete'](key);\n    this.size -= result ? 1 : 0;\n    return result;\n  }\n\n  /**\n   * Gets the map value for `key`.\n   *\n   * @private\n   * @name get\n   * @memberOf MapCache\n   * @param {string} key The key of the value to get.\n   * @returns {*} Returns the entry value.\n   */\n  function mapCacheGet(key) {\n    return getMapData(this, key).get(key);\n  }\n\n  /**\n   * Checks if a map value for `key` exists.\n   *\n   * @private\n   * @name has\n   * @memberOf MapCache\n   * @param {string} key The key of the entry to check.\n   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\n   */\n  function mapCacheHas(key) {\n    return getMapData(this, key).has(key);\n  }\n\n  /**\n   * Sets the map `key` to `value`.\n   *\n   * @private\n   * @name set\n   * @memberOf MapCache\n   * @param {string} key The key of the value to set.\n   * @param {*} value The value to set.\n   * @returns {Object} Returns the map cache instance.\n   */\n  function mapCacheSet(key, value) {\n    var data = getMapData(this, key),\n        size = data.size;\n\n    data.set(key, value);\n    this.size += data.size == size ? 0 : 1;\n    return this;\n  }\n\n  // Add methods to `MapCache`.\n  MapCache.prototype.clear = mapCacheClear;\n  MapCache.prototype['delete'] = mapCacheDelete;\n  MapCache.prototype.get = mapCacheGet;\n  MapCache.prototype.has = mapCacheHas;\n  MapCache.prototype.set = mapCacheSet;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   *\n   * Creates an array cache object to store unique values.\n   *\n   * @private\n   * @constructor\n   * @param {Array} [values] The values to cache.\n   */\n  function SetCache(values) {\n    var index = -1,\n        length = values == null ? 0 : values.length;\n\n    this.__data__ = new MapCache;\n    while (++index < length) {\n      this.add(values[index]);\n    }\n  }\n\n  /**\n   * Adds `value` to the array cache.\n   *\n   * @private\n   * @name add\n   * @memberOf SetCache\n   * @alias push\n   * @param {*} value The value to cache.\n   * @returns {Object} Returns the cache instance.\n   */\n  function setCacheAdd(value) {\n    this.__data__.set(value, HASH_UNDEFINED);\n    return this;\n  }\n\n  /**\n   * Checks if `value` is in the array cache.\n   *\n   * @private\n   * @name has\n   * @memberOf SetCache\n   * @param {*} value The value to search for.\n   * @returns {number} Returns `true` if `value` is found, else `false`.\n   */\n  function setCacheHas(value) {\n    return this.__data__.has(value);\n  }\n\n  // Add methods to `SetCache`.\n  SetCache.prototype.add = SetCache.prototype.push = setCacheAdd;\n  SetCache.prototype.has = setCacheHas;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a stack cache object to store key-value pairs.\n   *\n   * @private\n   * @constructor\n   * @param {Array} [entries] The key-value pairs to cache.\n   */\n  function Stack(entries) {\n    var data = this.__data__ = new ListCache(entries);\n    this.size = data.size;\n  }\n\n  /**\n   * Removes all key-value entries from the stack.\n   *\n   * @private\n   * @name clear\n   * @memberOf Stack\n   */\n  function stackClear() {\n    this.__data__ = new ListCache;\n    this.size = 0;\n  }\n\n  /**\n   * Removes `key` and its value from the stack.\n   *\n   * @private\n   * @name delete\n   * @memberOf Stack\n   * @param {string} key The key of the value to remove.\n   * @returns {boolean} Returns `true` if the entry was removed, else `false`.\n   */\n  function stackDelete(key) {\n    var data = this.__data__,\n        result = data['delete'](key);\n\n    this.size = data.size;\n    return result;\n  }\n\n  /**\n   * Gets the stack value for `key`.\n   *\n   * @private\n   * @name get\n   * @memberOf Stack\n   * @param {string} key The key of the value to get.\n   * @returns {*} Returns the entry value.\n   */\n  function stackGet(key) {\n    return this.__data__.get(key);\n  }\n\n  /**\n   * Checks if a stack value for `key` exists.\n   *\n   * @private\n   * @name has\n   * @memberOf Stack\n   * @param {string} key The key of the entry to check.\n   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.\n   */\n  function stackHas(key) {\n    return this.__data__.has(key);\n  }\n\n  /**\n   * Sets the stack `key` to `value`.\n   *\n   * @private\n   * @name set\n   * @memberOf Stack\n   * @param {string} key The key of the value to set.\n   * @param {*} value The value to set.\n   * @returns {Object} Returns the stack cache instance.\n   */\n  function stackSet(key, value) {\n    var data = this.__data__;\n    if (data instanceof ListCache) {\n      var pairs = data.__data__;\n      if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) {\n        pairs.push([key, value]);\n        this.size = ++data.size;\n        return this;\n      }\n      data = this.__data__ = new MapCache(pairs);\n    }\n    data.set(key, value);\n    this.size = data.size;\n    return this;\n  }\n\n  // Add methods to `Stack`.\n  Stack.prototype.clear = stackClear;\n  Stack.prototype['delete'] = stackDelete;\n  Stack.prototype.get = stackGet;\n  Stack.prototype.has = stackHas;\n  Stack.prototype.set = stackSet;\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates an array of the enumerable property names of the array-like `value`.\n   *\n   * @private\n   * @param {*} value The value to query.\n   * @param {boolean} inherited Specify returning inherited property names.\n   * @returns {Array} Returns the array of property names.\n   */\n  function arrayLikeKeys(value, inherited) {\n    var isArr = isArray(value),\n        isArg = !isArr && isArguments(value),\n        isBuff = !isArr && !isArg && isBuffer(value),\n        isType = !isArr && !isArg && !isBuff && isTypedArray(value),\n        skipIndexes = isArr || isArg || isBuff || isType,\n        result = skipIndexes ? baseTimes(value.length, String) : [],\n        length = result.length;\n\n    for (var key in value) {\n      if ((inherited || hasOwnProperty.call(value, key)) &&\n          !(skipIndexes && (\n              // Safari 9 has enumerable `arguments.length` in strict mode.\n              key == 'length' ||\n              // Node.js 0.10 has enumerable non-index properties on buffers.\n              (isBuff && (key == 'offset' || key == 'parent')) ||\n              // PhantomJS 2 has enumerable non-index properties on typed arrays.\n              (isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) ||\n              // Skip index properties.\n              isIndex(key, length)\n          ))) {\n        result.push(key);\n      }\n    }\n    return result;\n  }\n\n  /**\n   * This function is like `assignValue` except that it doesn't assign\n   * `undefined` values.\n   *\n   * @private\n   * @param {Object} object The object to modify.\n   * @param {string} key The key of the property to assign.\n   * @param {*} value The value to assign.\n   */\n  function assignMergeValue(object, key, value) {\n    if ((value !== undefined && !eq(object[key], value)) ||\n        (value === undefined && !(key in object))) {\n      baseAssignValue(object, key, value);\n    }\n  }\n\n  /**\n   * Assigns `value` to `key` of `object` if the existing value is not equivalent\n   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons.\n   *\n   * @private\n   * @param {Object} object The object to modify.\n   * @param {string} key The key of the property to assign.\n   * @param {*} value The value to assign.\n   */\n  function assignValue(object, key, value) {\n    var objValue = object[key];\n    if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) ||\n        (value === undefined && !(key in object))) {\n      baseAssignValue(object, key, value);\n    }\n  }\n\n  /**\n   * Gets the index at which the `key` is found in `array` of key-value pairs.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {*} key The key to search for.\n   * @returns {number} Returns the index of the matched value, else `-1`.\n   */\n  function assocIndexOf(array, key) {\n    var length = array.length;\n    while (length--) {\n      if (eq(array[length][0], key)) {\n        return length;\n      }\n    }\n    return -1;\n  }\n\n  /**\n   * Aggregates elements of `collection` on `accumulator` with keys transformed\n   * by `iteratee` and values set by `setter`.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} setter The function to set `accumulator` values.\n   * @param {Function} iteratee The iteratee to transform keys.\n   * @param {Object} accumulator The initial aggregated object.\n   * @returns {Function} Returns `accumulator`.\n   */\n  function baseAggregator(collection, setter, iteratee, accumulator) {\n    baseEach(collection, function(value, key, collection) {\n      setter(accumulator, value, iteratee(value), collection);\n    });\n    return accumulator;\n  }\n\n  /**\n   * The base implementation of `_.assign` without support for multiple sources\n   * or `customizer` functions.\n   *\n   * @private\n   * @param {Object} object The destination object.\n   * @param {Object} source The source object.\n   * @returns {Object} Returns `object`.\n   */\n  function baseAssign(object, source) {\n    return object && copyObject(source, keys(source), object);\n  }\n\n  /**\n   * The base implementation of `_.assignIn` without support for multiple sources\n   * or `customizer` functions.\n   *\n   * @private\n   * @param {Object} object The destination object.\n   * @param {Object} source The source object.\n   * @returns {Object} Returns `object`.\n   */\n  function baseAssignIn(object, source) {\n    return object && copyObject(source, keysIn(source), object);\n  }\n\n  /**\n   * The base implementation of `assignValue` and `assignMergeValue` without\n   * value checks.\n   *\n   * @private\n   * @param {Object} object The object to modify.\n   * @param {string} key The key of the property to assign.\n   * @param {*} value The value to assign.\n   */\n  function baseAssignValue(object, key, value) {\n    if (key == '__proto__' && defineProperty) {\n      defineProperty(object, key, {\n        'configurable': true,\n        'enumerable': true,\n        'value': value,\n        'writable': true\n      });\n    } else {\n      object[key] = value;\n    }\n  }\n\n  /**\n   * The base implementation of `_.at` without support for individual paths.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {string[]} paths The property paths to pick.\n   * @returns {Array} Returns the picked elements.\n   */\n  function baseAt(object, paths) {\n    var index = -1,\n        length = paths.length,\n        result = Array(length),\n        skip = object == null;\n\n    while (++index < length) {\n      result[index] = skip ? undefined : get(object, paths[index]);\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.clamp` which doesn't coerce arguments.\n   *\n   * @private\n   * @param {number} number The number to clamp.\n   * @param {number} [lower] The lower bound.\n   * @param {number} upper The upper bound.\n   * @returns {number} Returns the clamped number.\n   */\n  function baseClamp(number, lower, upper) {\n    if (number === number) {\n      if (upper !== undefined) {\n        number = number <= upper ? number : upper;\n      }\n      if (lower !== undefined) {\n        number = number >= lower ? number : lower;\n      }\n    }\n    return number;\n  }\n\n  /**\n   * The base implementation of `_.clone` and `_.cloneDeep` which tracks\n   * traversed objects.\n   *\n   * @private\n   * @param {*} value The value to clone.\n   * @param {boolean} bitmask The bitmask flags.\n   *  1 - Deep clone\n   *  2 - Flatten inherited properties\n   *  4 - Clone symbols\n   * @param {Function} [customizer] The function to customize cloning.\n   * @param {string} [key] The key of `value`.\n   * @param {Object} [object] The parent object of `value`.\n   * @param {Object} [stack] Tracks traversed objects and their clone counterparts.\n   * @returns {*} Returns the cloned value.\n   */\n  function baseClone(value, bitmask, customizer, key, object, stack) {\n    var result,\n        isDeep = bitmask & CLONE_DEEP_FLAG,\n        isFlat = bitmask & CLONE_FLAT_FLAG,\n        isFull = bitmask & CLONE_SYMBOLS_FLAG;\n\n    if (customizer) {\n      result = object ? customizer(value, key, object, stack) : customizer(value);\n    }\n    if (result !== undefined) {\n      return result;\n    }\n    if (!isObject(value)) {\n      return value;\n    }\n    var isArr = isArray(value);\n    if (isArr) {\n      result = initCloneArray(value);\n      if (!isDeep) {\n        return copyArray(value, result);\n      }\n    } else {\n      var tag = getTag(value),\n          isFunc = tag == funcTag || tag == genTag;\n\n      if (isBuffer(value)) {\n        return cloneBuffer(value, isDeep);\n      }\n      if (tag == objectTag || tag == argsTag || (isFunc && !object)) {\n        result = (isFlat || isFunc) ? {} : initCloneObject(value);\n        if (!isDeep) {\n          return isFlat\n              ? copySymbolsIn(value, baseAssignIn(result, value))\n              : copySymbols(value, baseAssign(result, value));\n        }\n      } else {\n        if (!cloneableTags[tag]) {\n          return object ? value : {};\n        }\n        result = initCloneByTag(value, tag, isDeep);\n      }\n    }\n    // Check for circular references and return its corresponding clone.\n    stack || (stack = new Stack);\n    var stacked = stack.get(value);\n    if (stacked) {\n      return stacked;\n    }\n    stack.set(value, result);\n\n    if (isSet(value)) {\n      value.forEach(function(subValue) {\n        result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack));\n      });\n\n      return result;\n    }\n\n    if (isMap(value)) {\n      value.forEach(function(subValue, key) {\n        result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack));\n      });\n\n      return result;\n    }\n\n    var keysFunc = isFull\n        ? (isFlat ? getAllKeysIn : getAllKeys)\n        : (isFlat ? keysIn : keys);\n\n    var props = isArr ? undefined : keysFunc(value);\n    arrayEach(props || value, function(subValue, key) {\n      if (props) {\n        key = subValue;\n        subValue = value[key];\n      }\n      // Recursively populate clone (susceptible to call stack limits).\n      assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack));\n    });\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.delay` and `_.defer` which accepts `args`\n   * to provide to `func`.\n   *\n   * @private\n   * @param {Function} func The function to delay.\n   * @param {number} wait The number of milliseconds to delay invocation.\n   * @param {Array} args The arguments to provide to `func`.\n   * @returns {number|Object} Returns the timer id or timeout object.\n   */\n  function baseDelay(func, wait, args) {\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    return setTimeout(function() { func.apply(undefined, args); }, wait);\n  }\n\n  /**\n   * The base implementation of methods like `_.difference` without support\n   * for excluding multiple arrays or iteratee shorthands.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {Array} values The values to exclude.\n   * @param {Function} [iteratee] The iteratee invoked per element.\n   * @param {Function} [comparator] The comparator invoked per element.\n   * @returns {Array} Returns the new array of filtered values.\n   */\n  function baseDifference(array, values, iteratee, comparator) {\n    var index = -1,\n        includes = arrayIncludes,\n        isCommon = true,\n        length = array.length,\n        result = [],\n        valuesLength = values.length;\n\n    if (!length) {\n      return result;\n    }\n    if (iteratee) {\n      values = arrayMap(values, baseUnary(iteratee));\n    }\n    if (comparator) {\n      includes = arrayIncludesWith;\n      isCommon = false;\n    }\n    else if (values.length >= LARGE_ARRAY_SIZE) {\n      includes = cacheHas;\n      isCommon = false;\n      values = new SetCache(values);\n    }\n    outer:\n        while (++index < length) {\n          var value = array[index],\n              computed = iteratee == null ? value : iteratee(value);\n\n          value = (comparator || value !== 0) ? value : 0;\n          if (isCommon && computed === computed) {\n            var valuesIndex = valuesLength;\n            while (valuesIndex--) {\n              if (values[valuesIndex] === computed) {\n                continue outer;\n              }\n            }\n            result.push(value);\n          }\n          else if (!includes(values, computed, comparator)) {\n            result.push(value);\n          }\n        }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.forEach` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Array|Object} Returns `collection`.\n   */\n  var baseEach = createBaseEach(baseForOwn);\n\n  /**\n   * The base implementation of `_.every` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {boolean} Returns `true` if all elements pass the predicate check,\n   *  else `false`\n   */\n  function baseEvery(collection, predicate) {\n    var result = true;\n    baseEach(collection, function(value, index, collection) {\n      result = !!predicate(value, index, collection);\n      return result;\n    });\n    return result;\n  }\n\n  /**\n   * The base implementation of methods like `_.max` and `_.min` which accepts a\n   * `comparator` to determine the extremum value.\n   *\n   * @private\n   * @param {Array} array The array to iterate over.\n   * @param {Function} iteratee The iteratee invoked per iteration.\n   * @param {Function} comparator The comparator used to compare values.\n   * @returns {*} Returns the extremum value.\n   */\n  function baseExtremum(array, iteratee, comparator) {\n    var index = -1,\n        length = array.length;\n\n    while (++index < length) {\n      var value = array[index],\n          current = iteratee(value);\n\n      if (current != null && (computed === undefined\n              ? (current === current && !isSymbol(current))\n              : comparator(current, computed)\n      )) {\n        var computed = current,\n            result = value;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.filter` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {Array} Returns the new filtered array.\n   */\n  function baseFilter(collection, predicate) {\n    var result = [];\n    baseEach(collection, function(value, index, collection) {\n      if (predicate(value, index, collection)) {\n        result.push(value);\n      }\n    });\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.flatten` with support for restricting flattening.\n   *\n   * @private\n   * @param {Array} array The array to flatten.\n   * @param {number} depth The maximum recursion depth.\n   * @param {boolean} [predicate=isFlattenable] The function invoked per iteration.\n   * @param {boolean} [isStrict] Restrict to values that pass `predicate` checks.\n   * @param {Array} [result=[]] The initial result value.\n   * @returns {Array} Returns the new flattened array.\n   */\n  function baseFlatten(array, depth, predicate, isStrict, result) {\n    var index = -1,\n        length = array.length;\n\n    predicate || (predicate = isFlattenable);\n    result || (result = []);\n\n    while (++index < length) {\n      var value = array[index];\n      if (depth > 0 && predicate(value)) {\n        if (depth > 1) {\n          // Recursively flatten arrays (susceptible to call stack limits).\n          baseFlatten(value, depth - 1, predicate, isStrict, result);\n        } else {\n          arrayPush(result, value);\n        }\n      } else if (!isStrict) {\n        result[result.length] = value;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `baseForOwn` which iterates over `object`\n   * properties returned by `keysFunc` and invokes `iteratee` for each property.\n   * Iteratee functions may exit iteration early by explicitly returning `false`.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @param {Function} keysFunc The function to get the keys of `object`.\n   * @returns {Object} Returns `object`.\n   */\n  var baseFor = createBaseFor();\n\n  /**\n   * This function is like `baseFor` except that it iterates over properties\n   * in the opposite order.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @param {Function} keysFunc The function to get the keys of `object`.\n   * @returns {Object} Returns `object`.\n   */\n  var baseForRight = createBaseFor(true);\n\n  /**\n   * The base implementation of `_.forOwn` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Object} Returns `object`.\n   */\n  function baseForOwn(object, iteratee) {\n    return object && baseFor(object, iteratee, keys);\n  }\n\n  /**\n   * The base implementation of `_.forOwnRight` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Object} Returns `object`.\n   */\n  function baseForOwnRight(object, iteratee) {\n    return object && baseForRight(object, iteratee, keys);\n  }\n\n  /**\n   * The base implementation of `_.functions` which creates an array of\n   * `object` function property names filtered from `props`.\n   *\n   * @private\n   * @param {Object} object The object to inspect.\n   * @param {Array} props The property names to filter.\n   * @returns {Array} Returns the function names.\n   */\n  function baseFunctions(object, props) {\n    return arrayFilter(props, function(key) {\n      return isFunction(object[key]);\n    });\n  }\n\n  /**\n   * The base implementation of `_.get` without support for default values.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path of the property to get.\n   * @returns {*} Returns the resolved value.\n   */\n  function baseGet(object, path) {\n    path = castPath(path, object);\n\n    var index = 0,\n        length = path.length;\n\n    while (object != null && index < length) {\n      object = object[toKey(path[index++])];\n    }\n    return (index && index == length) ? object : undefined;\n  }\n\n  /**\n   * The base implementation of `getAllKeys` and `getAllKeysIn` which uses\n   * `keysFunc` and `symbolsFunc` to get the enumerable property names and\n   * symbols of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Function} keysFunc The function to get the keys of `object`.\n   * @param {Function} symbolsFunc The function to get the symbols of `object`.\n   * @returns {Array} Returns the array of property names and symbols.\n   */\n  function baseGetAllKeys(object, keysFunc, symbolsFunc) {\n    var result = keysFunc(object);\n    return isArray(object) ? result : arrayPush(result, symbolsFunc(object));\n  }\n\n  /**\n   * The base implementation of `getTag` without fallbacks for buggy environments.\n   *\n   * @private\n   * @param {*} value The value to query.\n   * @returns {string} Returns the `toStringTag`.\n   */\n  function baseGetTag(value) {\n    if (value == null) {\n      return value === undefined ? undefinedTag : nullTag;\n    }\n    return (symToStringTag && symToStringTag in Object(value))\n        ? getRawTag(value)\n        : objectToString(value);\n  }\n\n  /**\n   * The base implementation of `_.gt` which doesn't coerce arguments.\n   *\n   * @private\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @returns {boolean} Returns `true` if `value` is greater than `other`,\n   *  else `false`.\n   */\n  function baseGt(value, other) {\n    return value > other;\n  }\n\n  /**\n   * The base implementation of `_.has` without support for deep paths.\n   *\n   * @private\n   * @param {Object} [object] The object to query.\n   * @param {Array|string} key The key to check.\n   * @returns {boolean} Returns `true` if `key` exists, else `false`.\n   */\n  function baseHas(object, key) {\n    return object != null && hasOwnProperty.call(object, key);\n  }\n\n  /**\n   * The base implementation of `_.hasIn` without support for deep paths.\n   *\n   * @private\n   * @param {Object} [object] The object to query.\n   * @param {Array|string} key The key to check.\n   * @returns {boolean} Returns `true` if `key` exists, else `false`.\n   */\n  function baseHasIn(object, key) {\n    return object != null && key in Object(object);\n  }\n\n  /**\n   * The base implementation of methods like `_.intersection`, without support\n   * for iteratee shorthands, that accepts an array of arrays to inspect.\n   *\n   * @private\n   * @param {Array} arrays The arrays to inspect.\n   * @param {Function} [iteratee] The iteratee invoked per element.\n   * @param {Function} [comparator] The comparator invoked per element.\n   * @returns {Array} Returns the new array of shared values.\n   */\n  function baseIntersection(arrays, iteratee, comparator) {\n    var includes = comparator ? arrayIncludesWith : arrayIncludes,\n        length = arrays[0].length,\n        othLength = arrays.length,\n        othIndex = othLength,\n        caches = Array(othLength),\n        maxLength = Infinity,\n        result = [];\n\n    while (othIndex--) {\n      var array = arrays[othIndex];\n      if (othIndex && iteratee) {\n        array = arrayMap(array, baseUnary(iteratee));\n      }\n      maxLength = nativeMin(array.length, maxLength);\n      caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120))\n          ? new SetCache(othIndex && array)\n          : undefined;\n    }\n    array = arrays[0];\n\n    var index = -1,\n        seen = caches[0];\n\n    outer:\n        while (++index < length && result.length < maxLength) {\n          var value = array[index],\n              computed = iteratee ? iteratee(value) : value;\n\n          value = (comparator || value !== 0) ? value : 0;\n          if (!(seen\n                  ? cacheHas(seen, computed)\n                  : includes(result, computed, comparator)\n          )) {\n            othIndex = othLength;\n            while (--othIndex) {\n              var cache = caches[othIndex];\n              if (!(cache\n                  ? cacheHas(cache, computed)\n                  : includes(arrays[othIndex], computed, comparator))\n              ) {\n                continue outer;\n              }\n            }\n            if (seen) {\n              seen.push(computed);\n            }\n            result.push(value);\n          }\n        }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.invert` and `_.invertBy` which inverts\n   * `object` with values transformed by `iteratee` and set by `setter`.\n   *\n   * @private\n   * @param {Object} object The object to iterate over.\n   * @param {Function} setter The function to set `accumulator` values.\n   * @param {Function} iteratee The iteratee to transform values.\n   * @param {Object} accumulator The initial inverted object.\n   * @returns {Function} Returns `accumulator`.\n   */\n  function baseInverter(object, setter, iteratee, accumulator) {\n    baseForOwn(object, function(value, key, object) {\n      setter(accumulator, iteratee(value), key, object);\n    });\n    return accumulator;\n  }\n\n  /**\n   * The base implementation of `_.invoke` without support for individual\n   * method arguments.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path of the method to invoke.\n   * @param {Array} args The arguments to invoke the method with.\n   * @returns {*} Returns the result of the invoked method.\n   */\n  function baseInvoke(object, path, args) {\n    path = castPath(path, object);\n    object = parent(object, path);\n    var func = object == null ? object : object[toKey(last(path))];\n    return func == null ? undefined : apply(func, object, args);\n  }\n\n  /**\n   * The base implementation of `_.isArguments`.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is an `arguments` object,\n   */\n  function baseIsArguments(value) {\n    return isObjectLike(value) && baseGetTag(value) == argsTag;\n  }\n\n  /**\n   * The base implementation of `_.isDate` without Node.js optimizations.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.\n   */\n  function baseIsDate(value) {\n    return isObjectLike(value) && baseGetTag(value) == dateTag;\n  }\n\n  /**\n   * The base implementation of `_.isEqual` which supports partial comparisons\n   * and tracks traversed objects.\n   *\n   * @private\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @param {boolean} bitmask The bitmask flags.\n   *  1 - Unordered comparison\n   *  2 - Partial comparison\n   * @param {Function} [customizer] The function to customize comparisons.\n   * @param {Object} [stack] Tracks traversed `value` and `other` objects.\n   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\n   */\n  function baseIsEqual(value, other, bitmask, customizer, stack) {\n    if (value === other) {\n      return true;\n    }\n    if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) {\n      return value !== value && other !== other;\n    }\n    return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack);\n  }\n\n  /**\n   * A specialized version of `baseIsEqual` for arrays and objects which performs\n   * deep comparisons and tracks traversed objects enabling objects with circular\n   * references to be compared.\n   *\n   * @private\n   * @param {Object} object The object to compare.\n   * @param {Object} other The other object to compare.\n   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\n   * @param {Function} customizer The function to customize comparisons.\n   * @param {Function} equalFunc The function to determine equivalents of values.\n   * @param {Object} [stack] Tracks traversed `object` and `other` objects.\n   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\n   */\n  function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) {\n    var objIsArr = isArray(object),\n        othIsArr = isArray(other),\n        objTag = objIsArr ? arrayTag : getTag(object),\n        othTag = othIsArr ? arrayTag : getTag(other);\n\n    objTag = objTag == argsTag ? objectTag : objTag;\n    othTag = othTag == argsTag ? objectTag : othTag;\n\n    var objIsObj = objTag == objectTag,\n        othIsObj = othTag == objectTag,\n        isSameTag = objTag == othTag;\n\n    if (isSameTag && isBuffer(object)) {\n      if (!isBuffer(other)) {\n        return false;\n      }\n      objIsArr = true;\n      objIsObj = false;\n    }\n    if (isSameTag && !objIsObj) {\n      stack || (stack = new Stack);\n      return (objIsArr || isTypedArray(object))\n          ? equalArrays(object, other, bitmask, customizer, equalFunc, stack)\n          : equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack);\n    }\n    if (!(bitmask & COMPARE_PARTIAL_FLAG)) {\n      var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'),\n          othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__');\n\n      if (objIsWrapped || othIsWrapped) {\n        var objUnwrapped = objIsWrapped ? object.value() : object,\n            othUnwrapped = othIsWrapped ? other.value() : other;\n\n        stack || (stack = new Stack);\n        return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack);\n      }\n    }\n    if (!isSameTag) {\n      return false;\n    }\n    stack || (stack = new Stack);\n    return equalObjects(object, other, bitmask, customizer, equalFunc, stack);\n  }\n\n  /**\n   * The base implementation of `_.isMap` without Node.js optimizations.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a map, else `false`.\n   */\n  function baseIsMap(value) {\n    return isObjectLike(value) && getTag(value) == mapTag;\n  }\n\n  /**\n   * The base implementation of `_.isMatch` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Object} object The object to inspect.\n   * @param {Object} source The object of property values to match.\n   * @param {Array} matchData The property names, values, and compare flags to match.\n   * @param {Function} [customizer] The function to customize comparisons.\n   * @returns {boolean} Returns `true` if `object` is a match, else `false`.\n   */\n  function baseIsMatch(object, source, matchData, customizer) {\n    var index = matchData.length,\n        length = index,\n        noCustomizer = !customizer;\n\n    if (object == null) {\n      return !length;\n    }\n    object = Object(object);\n    while (index--) {\n      var data = matchData[index];\n      if ((noCustomizer && data[2])\n          ? data[1] !== object[data[0]]\n          : !(data[0] in object)\n      ) {\n        return false;\n      }\n    }\n    while (++index < length) {\n      data = matchData[index];\n      var key = data[0],\n          objValue = object[key],\n          srcValue = data[1];\n\n      if (noCustomizer && data[2]) {\n        if (objValue === undefined && !(key in object)) {\n          return false;\n        }\n      } else {\n        var stack = new Stack;\n        if (customizer) {\n          var result = customizer(objValue, srcValue, key, object, source, stack);\n        }\n        if (!(result === undefined\n                ? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack)\n                : result\n        )) {\n          return false;\n        }\n      }\n    }\n    return true;\n  }\n\n  /**\n   * The base implementation of `_.isNative` without bad shim checks.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a native function,\n   *  else `false`.\n   */\n  function baseIsNative(value) {\n    if (!isObject(value) || isMasked(value)) {\n      return false;\n    }\n    var pattern = isFunction(value) ? reIsNative : reIsHostCtor;\n    return pattern.test(toSource(value));\n  }\n\n  /**\n   * The base implementation of `_.isRegExp` without Node.js optimizations.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.\n   */\n  function baseIsRegExp(value) {\n    return isObjectLike(value) && baseGetTag(value) == regexpTag;\n  }\n\n  /**\n   * The base implementation of `_.isSet` without Node.js optimizations.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a set, else `false`.\n   */\n  function baseIsSet(value) {\n    return isObjectLike(value) && getTag(value) == setTag;\n  }\n\n  /**\n   * The base implementation of `_.isTypedArray` without Node.js optimizations.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.\n   */\n  function baseIsTypedArray(value) {\n    return isObjectLike(value) &&\n        isLength(value.length) && !!typedArrayTags[baseGetTag(value)];\n  }\n\n  /**\n   * The base implementation of `_.iteratee`.\n   *\n   * @private\n   * @param {*} [value=_.identity] The value to convert to an iteratee.\n   * @returns {Function} Returns the iteratee.\n   */\n  function baseIteratee(value) {\n    // Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9.\n    // See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details.\n    if (typeof value == 'function') {\n      return value;\n    }\n    if (value == null) {\n      return identity;\n    }\n    if (typeof value == 'object') {\n      return isArray(value)\n          ? baseMatchesProperty(value[0], value[1])\n          : baseMatches(value);\n    }\n    return property(value);\n  }\n\n  /**\n   * The base implementation of `_.keys` which doesn't treat sparse arrays as dense.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names.\n   */\n  function baseKeys(object) {\n    if (!isPrototype(object)) {\n      return nativeKeys(object);\n    }\n    var result = [];\n    for (var key in Object(object)) {\n      if (hasOwnProperty.call(object, key) && key != 'constructor') {\n        result.push(key);\n      }\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names.\n   */\n  function baseKeysIn(object) {\n    if (!isObject(object)) {\n      return nativeKeysIn(object);\n    }\n    var isProto = isPrototype(object),\n        result = [];\n\n    for (var key in object) {\n      if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) {\n        result.push(key);\n      }\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.lt` which doesn't coerce arguments.\n   *\n   * @private\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @returns {boolean} Returns `true` if `value` is less than `other`,\n   *  else `false`.\n   */\n  function baseLt(value, other) {\n    return value < other;\n  }\n\n  /**\n   * The base implementation of `_.map` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} iteratee The function invoked per iteration.\n   * @returns {Array} Returns the new mapped array.\n   */\n  function baseMap(collection, iteratee) {\n    var index = -1,\n        result = isArrayLike(collection) ? Array(collection.length) : [];\n\n    baseEach(collection, function(value, key, collection) {\n      result[++index] = iteratee(value, key, collection);\n    });\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.matches` which doesn't clone `source`.\n   *\n   * @private\n   * @param {Object} source The object of property values to match.\n   * @returns {Function} Returns the new spec function.\n   */\n  function baseMatches(source) {\n    var matchData = getMatchData(source);\n    if (matchData.length == 1 && matchData[0][2]) {\n      return matchesStrictComparable(matchData[0][0], matchData[0][1]);\n    }\n    return function(object) {\n      return object === source || baseIsMatch(object, source, matchData);\n    };\n  }\n\n  /**\n   * The base implementation of `_.matchesProperty` which doesn't clone `srcValue`.\n   *\n   * @private\n   * @param {string} path The path of the property to get.\n   * @param {*} srcValue The value to match.\n   * @returns {Function} Returns the new spec function.\n   */\n  function baseMatchesProperty(path, srcValue) {\n    if (isKey(path) && isStrictComparable(srcValue)) {\n      return matchesStrictComparable(toKey(path), srcValue);\n    }\n    return function(object) {\n      var objValue = get(object, path);\n      return (objValue === undefined && objValue === srcValue)\n          ? hasIn(object, path)\n          : baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG);\n    };\n  }\n\n  /**\n   * The base implementation of `_.merge` without support for multiple sources.\n   *\n   * @private\n   * @param {Object} object The destination object.\n   * @param {Object} source The source object.\n   * @param {number} srcIndex The index of `source`.\n   * @param {Function} [customizer] The function to customize merged values.\n   * @param {Object} [stack] Tracks traversed source values and their merged\n   *  counterparts.\n   */\n  function baseMerge(object, source, srcIndex, customizer, stack) {\n    if (object === source) {\n      return;\n    }\n    baseFor(source, function(srcValue, key) {\n      if (isObject(srcValue)) {\n        stack || (stack = new Stack);\n        baseMergeDeep(object, source, key, srcIndex, baseMerge, customizer, stack);\n      }\n      else {\n        var newValue = customizer\n            ? customizer(safeGet(object, key), srcValue, (key + ''), object, source, stack)\n            : undefined;\n\n        if (newValue === undefined) {\n          newValue = srcValue;\n        }\n        assignMergeValue(object, key, newValue);\n      }\n    }, keysIn);\n  }\n\n  /**\n   * A specialized version of `baseMerge` for arrays and objects which performs\n   * deep merges and tracks traversed objects enabling objects with circular\n   * references to be merged.\n   *\n   * @private\n   * @param {Object} object The destination object.\n   * @param {Object} source The source object.\n   * @param {string} key The key of the value to merge.\n   * @param {number} srcIndex The index of `source`.\n   * @param {Function} mergeFunc The function to merge values.\n   * @param {Function} [customizer] The function to customize assigned values.\n   * @param {Object} [stack] Tracks traversed source values and their merged\n   *  counterparts.\n   */\n  function baseMergeDeep(object, source, key, srcIndex, mergeFunc, customizer, stack) {\n    var objValue = safeGet(object, key),\n        srcValue = safeGet(source, key),\n        stacked = stack.get(srcValue);\n\n    if (stacked) {\n      assignMergeValue(object, key, stacked);\n      return;\n    }\n    var newValue = customizer\n        ? customizer(objValue, srcValue, (key + ''), object, source, stack)\n        : undefined;\n\n    var isCommon = newValue === undefined;\n\n    if (isCommon) {\n      var isArr = isArray(srcValue),\n          isBuff = !isArr && isBuffer(srcValue),\n          isTyped = !isArr && !isBuff && isTypedArray(srcValue);\n\n      newValue = srcValue;\n      if (isArr || isBuff || isTyped) {\n        if (isArray(objValue)) {\n          newValue = objValue;\n        }\n        else if (isArrayLikeObject(objValue)) {\n          newValue = copyArray(objValue);\n        }\n        else if (isBuff) {\n          isCommon = false;\n          newValue = cloneBuffer(srcValue, true);\n        }\n        else if (isTyped) {\n          isCommon = false;\n          newValue = cloneTypedArray(srcValue, true);\n        }\n        else {\n          newValue = [];\n        }\n      }\n      else if (isPlainObject(srcValue) || isArguments(srcValue)) {\n        newValue = objValue;\n        if (isArguments(objValue)) {\n          newValue = toPlainObject(objValue);\n        }\n        else if (!isObject(objValue) || (srcIndex && isFunction(objValue))) {\n          newValue = initCloneObject(srcValue);\n        }\n      }\n      else {\n        isCommon = false;\n      }\n    }\n    if (isCommon) {\n      // Recursively merge objects and arrays (susceptible to call stack limits).\n      stack.set(srcValue, newValue);\n      mergeFunc(newValue, srcValue, srcIndex, customizer, stack);\n      stack['delete'](srcValue);\n    }\n    assignMergeValue(object, key, newValue);\n  }\n\n  /**\n   * The base implementation of `_.orderBy` without param guards.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by.\n   * @param {string[]} orders The sort orders of `iteratees`.\n   * @returns {Array} Returns the new sorted array.\n   */\n  function baseOrderBy(collection, iteratees, orders) {\n    var index = -1;\n    iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee));\n\n    var result = baseMap(collection, function(value, key, collection) {\n      var criteria = arrayMap(iteratees, function(iteratee) {\n        return iteratee(value);\n      });\n      return { 'criteria': criteria, 'index': ++index, 'value': value };\n    });\n\n    return baseSortBy(result, function(object, other) {\n      return compareMultiple(object, other, orders);\n    });\n  }\n\n  /**\n   * The base implementation of `_.pick` without support for individual\n   * property identifiers.\n   *\n   * @private\n   * @param {Object} object The source object.\n   * @param {string[]} paths The property paths to pick.\n   * @returns {Object} Returns the new object.\n   */\n  function basePick(object, paths) {\n    return basePickBy(object, paths, function(value, path) {\n      return hasIn(object, path);\n    });\n  }\n\n  /**\n   * The base implementation of  `_.pickBy` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Object} object The source object.\n   * @param {string[]} paths The property paths to pick.\n   * @param {Function} predicate The function invoked per property.\n   * @returns {Object} Returns the new object.\n   */\n  function basePickBy(object, paths, predicate) {\n    var index = -1,\n        length = paths.length,\n        result = {};\n\n    while (++index < length) {\n      var path = paths[index],\n          value = baseGet(object, path);\n\n      if (predicate(value, path)) {\n        baseSet(result, castPath(path, object), value);\n      }\n    }\n    return result;\n  }\n\n  /**\n   * A specialized version of `baseProperty` which supports deep paths.\n   *\n   * @private\n   * @param {Array|string} path The path of the property to get.\n   * @returns {Function} Returns the new accessor function.\n   */\n  function basePropertyDeep(path) {\n    return function(object) {\n      return baseGet(object, path);\n    };\n  }\n\n  /**\n   * The base implementation of `_.random` without support for returning\n   * floating-point numbers.\n   *\n   * @private\n   * @param {number} lower The lower bound.\n   * @param {number} upper The upper bound.\n   * @returns {number} Returns the random number.\n   */\n  function baseRandom(lower, upper) {\n    return lower + nativeFloor(nativeRandom() * (upper - lower + 1));\n  }\n\n  /**\n   * The base implementation of `_.range` and `_.rangeRight` which doesn't\n   * coerce arguments.\n   *\n   * @private\n   * @param {number} start The start of the range.\n   * @param {number} end The end of the range.\n   * @param {number} step The value to increment or decrement by.\n   * @param {boolean} [fromRight] Specify iterating from right to left.\n   * @returns {Array} Returns the range of numbers.\n   */\n  function baseRange(start, end, step, fromRight) {\n    var index = -1,\n        length = nativeMax(nativeCeil((end - start) / (step || 1)), 0),\n        result = Array(length);\n\n    while (length--) {\n      result[fromRight ? length : ++index] = start;\n      start += step;\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.rest` which doesn't validate or coerce arguments.\n   *\n   * @private\n   * @param {Function} func The function to apply a rest parameter to.\n   * @param {number} [start=func.length-1] The start position of the rest parameter.\n   * @returns {Function} Returns the new function.\n   */\n  function baseRest(func, start) {\n    return setToString(overRest(func, start, identity), func + '');\n  }\n\n  /**\n   * The base implementation of `_.set`.\n   *\n   * @private\n   * @param {Object} object The object to modify.\n   * @param {Array|string} path The path of the property to set.\n   * @param {*} value The value to set.\n   * @param {Function} [customizer] The function to customize path creation.\n   * @returns {Object} Returns `object`.\n   */\n  function baseSet(object, path, value, customizer) {\n    if (!isObject(object)) {\n      return object;\n    }\n    path = castPath(path, object);\n\n    var index = -1,\n        length = path.length,\n        lastIndex = length - 1,\n        nested = object;\n\n    while (nested != null && ++index < length) {\n      var key = toKey(path[index]),\n          newValue = value;\n\n      if (index != lastIndex) {\n        var objValue = nested[key];\n        newValue = customizer ? customizer(objValue, key, nested) : undefined;\n        if (newValue === undefined) {\n          newValue = isObject(objValue)\n              ? objValue\n              : (isIndex(path[index + 1]) ? [] : {});\n        }\n      }\n      assignValue(nested, key, newValue);\n      nested = nested[key];\n    }\n    return object;\n  }\n\n  /**\n   * The base implementation of `setData` without support for hot loop shorting.\n   *\n   * @private\n   * @param {Function} func The function to associate metadata with.\n   * @param {*} data The metadata.\n   * @returns {Function} Returns `func`.\n   */\n  var baseSetData = !metaMap ? identity : function(func, data) {\n    metaMap.set(func, data);\n    return func;\n  };\n\n  /**\n   * The base implementation of `setToString` without support for hot loop shorting.\n   *\n   * @private\n   * @param {Function} func The function to modify.\n   * @param {Function} string The `toString` result.\n   * @returns {Function} Returns `func`.\n   */\n  var baseSetToString = !defineProperty ? identity : function(func, string) {\n    return defineProperty(func, 'toString', {\n      'configurable': true,\n      'enumerable': false,\n      'value': constant(string),\n      'writable': true\n    });\n  };\n\n  /**\n   * The base implementation of `_.slice` without an iteratee call guard.\n   *\n   * @private\n   * @param {Array} array The array to slice.\n   * @param {number} [start=0] The start position.\n   * @param {number} [end=array.length] The end position.\n   * @returns {Array} Returns the slice of `array`.\n   */\n  function baseSlice(array, start, end) {\n    var index = -1,\n        length = array.length;\n\n    if (start < 0) {\n      start = -start > length ? 0 : (length + start);\n    }\n    end = end > length ? length : end;\n    if (end < 0) {\n      end += length;\n    }\n    length = start > end ? 0 : ((end - start) >>> 0);\n    start >>>= 0;\n\n    var result = Array(length);\n    while (++index < length) {\n      result[index] = array[index + start];\n    }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.some` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} predicate The function invoked per iteration.\n   * @returns {boolean} Returns `true` if any element passes the predicate check,\n   *  else `false`.\n   */\n  function baseSome(collection, predicate) {\n    var result;\n\n    baseEach(collection, function(value, index, collection) {\n      result = predicate(value, index, collection);\n      return !result;\n    });\n    return !!result;\n  }\n\n  /**\n   * The base implementation of `_.toString` which doesn't convert nullish\n   * values to empty strings.\n   *\n   * @private\n   * @param {*} value The value to process.\n   * @returns {string} Returns the string.\n   */\n  function baseToString(value) {\n    // Exit early for strings to avoid a performance hit in some environments.\n    if (typeof value == 'string') {\n      return value;\n    }\n    if (isArray(value)) {\n      // Recursively convert values (susceptible to call stack limits).\n      return arrayMap(value, baseToString) + '';\n    }\n    if (isSymbol(value)) {\n      return symbolToString ? symbolToString.call(value) : '';\n    }\n    var result = (value + '');\n    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;\n  }\n\n  /**\n   * The base implementation of `_.uniqBy` without support for iteratee shorthands.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {Function} [iteratee] The iteratee invoked per element.\n   * @param {Function} [comparator] The comparator invoked per element.\n   * @returns {Array} Returns the new duplicate free array.\n   */\n  function baseUniq(array, iteratee, comparator) {\n    var index = -1,\n        includes = arrayIncludes,\n        length = array.length,\n        isCommon = true,\n        result = [],\n        seen = result;\n\n    if (comparator) {\n      isCommon = false;\n      includes = arrayIncludesWith;\n    }\n    else if (length >= LARGE_ARRAY_SIZE) {\n      var set = iteratee ? null : createSet(array);\n      if (set) {\n        return setToArray(set);\n      }\n      isCommon = false;\n      includes = cacheHas;\n      seen = new SetCache;\n    }\n    else {\n      seen = iteratee ? [] : result;\n    }\n    outer:\n        while (++index < length) {\n          var value = array[index],\n              computed = iteratee ? iteratee(value) : value;\n\n          value = (comparator || value !== 0) ? value : 0;\n          if (isCommon && computed === computed) {\n            var seenIndex = seen.length;\n            while (seenIndex--) {\n              if (seen[seenIndex] === computed) {\n                continue outer;\n              }\n            }\n            if (iteratee) {\n              seen.push(computed);\n            }\n            result.push(value);\n          }\n          else if (!includes(seen, computed, comparator)) {\n            if (seen !== result) {\n              seen.push(computed);\n            }\n            result.push(value);\n          }\n        }\n    return result;\n  }\n\n  /**\n   * The base implementation of `_.unset`.\n   *\n   * @private\n   * @param {Object} object The object to modify.\n   * @param {Array|string} path The property path to unset.\n   * @returns {boolean} Returns `true` if the property is deleted, else `false`.\n   */\n  function baseUnset(object, path) {\n    path = castPath(path, object);\n    object = parent(object, path);\n    return object == null || delete object[toKey(last(path))];\n  }\n\n  /**\n   * The base implementation of `wrapperValue` which returns the result of\n   * performing a sequence of actions on the unwrapped `value`, where each\n   * successive action is supplied the return value of the previous.\n   *\n   * @private\n   * @param {*} value The unwrapped value.\n   * @param {Array} actions Actions to perform to resolve the unwrapped value.\n   * @returns {*} Returns the resolved value.\n   */\n  function baseWrapperValue(value, actions) {\n    var result = value;\n    if (result instanceof LazyWrapper) {\n      result = result.value();\n    }\n    return arrayReduce(actions, function(result, action) {\n      return action.func.apply(action.thisArg, arrayPush([result], action.args));\n    }, result);\n  }\n\n  /**\n   * This base implementation of `_.zipObject` which assigns values using `assignFunc`.\n   *\n   * @private\n   * @param {Array} props The property identifiers.\n   * @param {Array} values The property values.\n   * @param {Function} assignFunc The function to assign values.\n   * @returns {Object} Returns the new object.\n   */\n  function baseZipObject(props, values, assignFunc) {\n    var index = -1,\n        length = props.length,\n        valsLength = values.length,\n        result = {};\n\n    while (++index < length) {\n      var value = index < valsLength ? values[index] : undefined;\n      assignFunc(result, props[index], value);\n    }\n    return result;\n  }\n\n  /**\n   * Casts `value` to an empty array if it's not an array like object.\n   *\n   * @private\n   * @param {*} value The value to inspect.\n   * @returns {Array|Object} Returns the cast array-like object.\n   */\n  function castArrayLikeObject(value) {\n    return isArrayLikeObject(value) ? value : [];\n  }\n\n  /**\n   * Casts `value` to a path array if it's not one.\n   *\n   * @private\n   * @param {*} value The value to inspect.\n   * @param {Object} [object] The object to query keys on.\n   * @returns {Array} Returns the cast property path array.\n   */\n  function castPath(value, object) {\n    if (isArray(value)) {\n      return value;\n    }\n    return isKey(value, object) ? [value] : stringToPath(toString(value));\n  }\n\n  /**\n   * Casts `array` to a slice if it's needed.\n   *\n   * @private\n   * @param {Array} array The array to inspect.\n   * @param {number} start The start position.\n   * @param {number} [end=array.length] The end position.\n   * @returns {Array} Returns the cast slice.\n   */\n  function castSlice(array, start, end) {\n    var length = array.length;\n    end = end === undefined ? length : end;\n    return (!start && end >= length) ? array : baseSlice(array, start, end);\n  }\n\n  /**\n   * Creates a clone of  `buffer`.\n   *\n   * @private\n   * @param {Buffer} buffer The buffer to clone.\n   * @param {boolean} [isDeep] Specify a deep clone.\n   * @returns {Buffer} Returns the cloned buffer.\n   */\n  function cloneBuffer(buffer, isDeep) {\n    if (isDeep) {\n      return buffer.slice();\n    }\n    var length = buffer.length,\n        result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length);\n\n    buffer.copy(result);\n    return result;\n  }\n\n  /**\n   * Creates a clone of `arrayBuffer`.\n   *\n   * @private\n   * @param {ArrayBuffer} arrayBuffer The array buffer to clone.\n   * @returns {ArrayBuffer} Returns the cloned array buffer.\n   */\n  function cloneArrayBuffer(arrayBuffer) {\n    var result = new arrayBuffer.constructor(arrayBuffer.byteLength);\n    new Uint8Array(result).set(new Uint8Array(arrayBuffer));\n    return result;\n  }\n\n  /**\n   * Creates a clone of `dataView`.\n   *\n   * @private\n   * @param {Object} dataView The data view to clone.\n   * @param {boolean} [isDeep] Specify a deep clone.\n   * @returns {Object} Returns the cloned data view.\n   */\n  function cloneDataView(dataView, isDeep) {\n    var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer;\n    return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength);\n  }\n\n  /**\n   * Creates a clone of `regexp`.\n   *\n   * @private\n   * @param {Object} regexp The regexp to clone.\n   * @returns {Object} Returns the cloned regexp.\n   */\n  function cloneRegExp(regexp) {\n    var result = new regexp.constructor(regexp.source, reFlags.exec(regexp));\n    result.lastIndex = regexp.lastIndex;\n    return result;\n  }\n\n  /**\n   * Creates a clone of the `symbol` object.\n   *\n   * @private\n   * @param {Object} symbol The symbol object to clone.\n   * @returns {Object} Returns the cloned symbol object.\n   */\n  function cloneSymbol(symbol) {\n    return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {};\n  }\n\n  /**\n   * Creates a clone of `typedArray`.\n   *\n   * @private\n   * @param {Object} typedArray The typed array to clone.\n   * @param {boolean} [isDeep] Specify a deep clone.\n   * @returns {Object} Returns the cloned typed array.\n   */\n  function cloneTypedArray(typedArray, isDeep) {\n    var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer;\n    return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length);\n  }\n\n  /**\n   * Compares values to sort them in ascending order.\n   *\n   * @private\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @returns {number} Returns the sort order indicator for `value`.\n   */\n  function compareAscending(value, other) {\n    if (value !== other) {\n      var valIsDefined = value !== undefined,\n          valIsNull = value === null,\n          valIsReflexive = value === value,\n          valIsSymbol = isSymbol(value);\n\n      var othIsDefined = other !== undefined,\n          othIsNull = other === null,\n          othIsReflexive = other === other,\n          othIsSymbol = isSymbol(other);\n\n      if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) ||\n          (valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) ||\n          (valIsNull && othIsDefined && othIsReflexive) ||\n          (!valIsDefined && othIsReflexive) ||\n          !valIsReflexive) {\n        return 1;\n      }\n      if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) ||\n          (othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) ||\n          (othIsNull && valIsDefined && valIsReflexive) ||\n          (!othIsDefined && valIsReflexive) ||\n          !othIsReflexive) {\n        return -1;\n      }\n    }\n    return 0;\n  }\n\n  /**\n   * Used by `_.orderBy` to compare multiple properties of a value to another\n   * and stable sort them.\n   *\n   * If `orders` is unspecified, all values are sorted in ascending order. Otherwise,\n   * specify an order of \"desc\" for descending or \"asc\" for ascending sort order\n   * of corresponding values.\n   *\n   * @private\n   * @param {Object} object The object to compare.\n   * @param {Object} other The other object to compare.\n   * @param {boolean[]|string[]} orders The order to sort by for each property.\n   * @returns {number} Returns the sort order indicator for `object`.\n   */\n  function compareMultiple(object, other, orders) {\n    var index = -1,\n        objCriteria = object.criteria,\n        othCriteria = other.criteria,\n        length = objCriteria.length,\n        ordersLength = orders.length;\n\n    while (++index < length) {\n      var result = compareAscending(objCriteria[index], othCriteria[index]);\n      if (result) {\n        if (index >= ordersLength) {\n          return result;\n        }\n        var order = orders[index];\n        return result * (order == 'desc' ? -1 : 1);\n      }\n    }\n    // Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications\n    // that causes it, under certain circumstances, to provide the same value for\n    // `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247\n    // for more details.\n    //\n    // This also ensures a stable sort in V8 and other engines.\n    // See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details.\n    return object.index - other.index;\n  }\n\n  /**\n   * Creates an array that is the composition of partially applied arguments,\n   * placeholders, and provided arguments into a single array of arguments.\n   *\n   * @private\n   * @param {Array} args The provided arguments.\n   * @param {Array} partials The arguments to prepend to those provided.\n   * @param {Array} holders The `partials` placeholder indexes.\n   * @params {boolean} [isCurried] Specify composing for a curried function.\n   * @returns {Array} Returns the new array of composed arguments.\n   */\n  function composeArgs(args, partials, holders, isCurried) {\n    var argsIndex = -1,\n        argsLength = args.length,\n        holdersLength = holders.length,\n        leftIndex = -1,\n        leftLength = partials.length,\n        rangeLength = nativeMax(argsLength - holdersLength, 0),\n        result = Array(leftLength + rangeLength),\n        isUncurried = !isCurried;\n\n    while (++leftIndex < leftLength) {\n      result[leftIndex] = partials[leftIndex];\n    }\n    while (++argsIndex < holdersLength) {\n      if (isUncurried || argsIndex < argsLength) {\n        result[holders[argsIndex]] = args[argsIndex];\n      }\n    }\n    while (rangeLength--) {\n      result[leftIndex++] = args[argsIndex++];\n    }\n    return result;\n  }\n\n  /**\n   * This function is like `composeArgs` except that the arguments composition\n   * is tailored for `_.partialRight`.\n   *\n   * @private\n   * @param {Array} args The provided arguments.\n   * @param {Array} partials The arguments to append to those provided.\n   * @param {Array} holders The `partials` placeholder indexes.\n   * @params {boolean} [isCurried] Specify composing for a curried function.\n   * @returns {Array} Returns the new array of composed arguments.\n   */\n  function composeArgsRight(args, partials, holders, isCurried) {\n    var argsIndex = -1,\n        argsLength = args.length,\n        holdersIndex = -1,\n        holdersLength = holders.length,\n        rightIndex = -1,\n        rightLength = partials.length,\n        rangeLength = nativeMax(argsLength - holdersLength, 0),\n        result = Array(rangeLength + rightLength),\n        isUncurried = !isCurried;\n\n    while (++argsIndex < rangeLength) {\n      result[argsIndex] = args[argsIndex];\n    }\n    var offset = argsIndex;\n    while (++rightIndex < rightLength) {\n      result[offset + rightIndex] = partials[rightIndex];\n    }\n    while (++holdersIndex < holdersLength) {\n      if (isUncurried || argsIndex < argsLength) {\n        result[offset + holders[holdersIndex]] = args[argsIndex++];\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Copies the values of `source` to `array`.\n   *\n   * @private\n   * @param {Array} source The array to copy values from.\n   * @param {Array} [array=[]] The array to copy values to.\n   * @returns {Array} Returns `array`.\n   */\n  function copyArray(source, array) {\n    var index = -1,\n        length = source.length;\n\n    array || (array = Array(length));\n    while (++index < length) {\n      array[index] = source[index];\n    }\n    return array;\n  }\n\n  /**\n   * Copies properties of `source` to `object`.\n   *\n   * @private\n   * @param {Object} source The object to copy properties from.\n   * @param {Array} props The property identifiers to copy.\n   * @param {Object} [object={}] The object to copy properties to.\n   * @param {Function} [customizer] The function to customize copied values.\n   * @returns {Object} Returns `object`.\n   */\n  function copyObject(source, props, object, customizer) {\n    var isNew = !object;\n    object || (object = {});\n\n    var index = -1,\n        length = props.length;\n\n    while (++index < length) {\n      var key = props[index];\n\n      var newValue = customizer\n          ? customizer(object[key], source[key], key, object, source)\n          : undefined;\n\n      if (newValue === undefined) {\n        newValue = source[key];\n      }\n      if (isNew) {\n        baseAssignValue(object, key, newValue);\n      } else {\n        assignValue(object, key, newValue);\n      }\n    }\n    return object;\n  }\n\n  /**\n   * Copies own symbols of `source` to `object`.\n   *\n   * @private\n   * @param {Object} source The object to copy symbols from.\n   * @param {Object} [object={}] The object to copy symbols to.\n   * @returns {Object} Returns `object`.\n   */\n  function copySymbols(source, object) {\n    return copyObject(source, getSymbols(source), object);\n  }\n\n  /**\n   * Copies own and inherited symbols of `source` to `object`.\n   *\n   * @private\n   * @param {Object} source The object to copy symbols from.\n   * @param {Object} [object={}] The object to copy symbols to.\n   * @returns {Object} Returns `object`.\n   */\n  function copySymbolsIn(source, object) {\n    return copyObject(source, getSymbolsIn(source), object);\n  }\n\n  /**\n   * Creates a function like `_.groupBy`.\n   *\n   * @private\n   * @param {Function} setter The function to set accumulator values.\n   * @param {Function} [initializer] The accumulator object initializer.\n   * @returns {Function} Returns the new aggregator function.\n   */\n  function createAggregator(setter, initializer) {\n    return function(collection, iteratee) {\n      var func = isArray(collection) ? arrayAggregator : baseAggregator,\n          accumulator = initializer ? initializer() : {};\n\n      return func(collection, setter, baseIteratee(iteratee, 2), accumulator);\n    };\n  }\n\n  /**\n   * Creates a function like `_.assign`.\n   *\n   * @private\n   * @param {Function} assigner The function to assign values.\n   * @returns {Function} Returns the new assigner function.\n   */\n  function createAssigner(assigner) {\n    return baseRest(function(object, sources) {\n      var index = -1,\n          length = sources.length,\n          customizer = length > 1 ? sources[length - 1] : undefined,\n          guard = length > 2 ? sources[2] : undefined;\n\n      customizer = (assigner.length > 3 && typeof customizer == 'function')\n          ? (length--, customizer)\n          : undefined;\n\n      if (guard && isIterateeCall(sources[0], sources[1], guard)) {\n        customizer = length < 3 ? undefined : customizer;\n        length = 1;\n      }\n      object = Object(object);\n      while (++index < length) {\n        var source = sources[index];\n        if (source) {\n          assigner(object, source, index, customizer);\n        }\n      }\n      return object;\n    });\n  }\n\n  /**\n   * Creates a `baseEach` or `baseEachRight` function.\n   *\n   * @private\n   * @param {Function} eachFunc The function to iterate over a collection.\n   * @param {boolean} [fromRight] Specify iterating from right to left.\n   * @returns {Function} Returns the new base function.\n   */\n  function createBaseEach(eachFunc, fromRight) {\n    return function(collection, iteratee) {\n      if (collection == null) {\n        return collection;\n      }\n      if (!isArrayLike(collection)) {\n        return eachFunc(collection, iteratee);\n      }\n      var length = collection.length,\n          index = fromRight ? length : -1,\n          iterable = Object(collection);\n\n      while ((fromRight ? index-- : ++index < length)) {\n        if (iteratee(iterable[index], index, iterable) === false) {\n          break;\n        }\n      }\n      return collection;\n    };\n  }\n\n  /**\n   * Creates a base function for methods like `_.forIn` and `_.forOwn`.\n   *\n   * @private\n   * @param {boolean} [fromRight] Specify iterating from right to left.\n   * @returns {Function} Returns the new base function.\n   */\n  function createBaseFor(fromRight) {\n    return function(object, iteratee, keysFunc) {\n      var index = -1,\n          iterable = Object(object),\n          props = keysFunc(object),\n          length = props.length;\n\n      while (length--) {\n        var key = props[fromRight ? length : ++index];\n        if (iteratee(iterable[key], key, iterable) === false) {\n          break;\n        }\n      }\n      return object;\n    };\n  }\n\n  /**\n   * Creates a function that wraps `func` to invoke it with the optional `this`\n   * binding of `thisArg`.\n   *\n   * @private\n   * @param {Function} func The function to wrap.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @param {*} [thisArg] The `this` binding of `func`.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createBind(func, bitmask, thisArg) {\n    var isBind = bitmask & WRAP_BIND_FLAG,\n        Ctor = createCtor(func);\n\n    function wrapper() {\n      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\n      return fn.apply(isBind ? thisArg : this, arguments);\n    }\n    return wrapper;\n  }\n\n  /**\n   * Creates a function that produces an instance of `Ctor` regardless of\n   * whether it was invoked as part of a `new` expression or by `call` or `apply`.\n   *\n   * @private\n   * @param {Function} Ctor The constructor to wrap.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createCtor(Ctor) {\n    return function() {\n      // Use a `switch` statement to work with class constructors. See\n      // http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist\n      // for more details.\n      var args = arguments;\n      switch (args.length) {\n        case 0: return new Ctor;\n        case 1: return new Ctor(args[0]);\n        case 2: return new Ctor(args[0], args[1]);\n        case 3: return new Ctor(args[0], args[1], args[2]);\n        case 4: return new Ctor(args[0], args[1], args[2], args[3]);\n        case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]);\n        case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]);\n        case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);\n      }\n      var thisBinding = baseCreate(Ctor.prototype),\n          result = Ctor.apply(thisBinding, args);\n\n      // Mimic the constructor's `return` behavior.\n      // See https://es5.github.io/#x13.2.2 for more details.\n      return isObject(result) ? result : thisBinding;\n    };\n  }\n\n  /**\n   * Creates a function that wraps `func` to enable currying.\n   *\n   * @private\n   * @param {Function} func The function to wrap.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @param {number} arity The arity of `func`.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createCurry(func, bitmask, arity) {\n    var Ctor = createCtor(func);\n\n    function wrapper() {\n      var length = arguments.length,\n          args = Array(length),\n          index = length,\n          placeholder = getHolder(wrapper);\n\n      while (index--) {\n        args[index] = arguments[index];\n      }\n      var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder)\n          ? []\n          : replaceHolders(args, placeholder);\n\n      length -= holders.length;\n      if (length < arity) {\n        return createRecurry(\n            func, bitmask, createHybrid, wrapper.placeholder, undefined,\n            args, holders, undefined, undefined, arity - length);\n      }\n      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\n      return apply(fn, this, args);\n    }\n    return wrapper;\n  }\n\n  /**\n   * Creates a `_.find` or `_.findLast` function.\n   *\n   * @private\n   * @param {Function} findIndexFunc The function to find the collection index.\n   * @returns {Function} Returns the new find function.\n   */\n  function createFind(findIndexFunc) {\n    return function(collection, predicate, fromIndex) {\n      var iterable = Object(collection);\n      if (!isArrayLike(collection)) {\n        var iteratee = baseIteratee(predicate, 3);\n        collection = keys(collection);\n        predicate = function(key) { return iteratee(iterable[key], key, iterable); };\n      }\n      var index = findIndexFunc(collection, predicate, fromIndex);\n      return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined;\n    };\n  }\n\n  /**\n   * Creates a function that wraps `func` to invoke it with optional `this`\n   * binding of `thisArg`, partial application, and currying.\n   *\n   * @private\n   * @param {Function|string} func The function or method name to wrap.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @param {*} [thisArg] The `this` binding of `func`.\n   * @param {Array} [partials] The arguments to prepend to those provided to\n   *  the new function.\n   * @param {Array} [holders] The `partials` placeholder indexes.\n   * @param {Array} [partialsRight] The arguments to append to those provided\n   *  to the new function.\n   * @param {Array} [holdersRight] The `partialsRight` placeholder indexes.\n   * @param {Array} [argPos] The argument positions of the new function.\n   * @param {number} [ary] The arity cap of `func`.\n   * @param {number} [arity] The arity of `func`.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) {\n    var isAry = bitmask & WRAP_ARY_FLAG,\n        isBind = bitmask & WRAP_BIND_FLAG,\n        isBindKey = bitmask & WRAP_BIND_KEY_FLAG,\n        isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG),\n        isFlip = bitmask & WRAP_FLIP_FLAG,\n        Ctor = isBindKey ? undefined : createCtor(func);\n\n    function wrapper() {\n      var length = arguments.length,\n          args = Array(length),\n          index = length;\n\n      while (index--) {\n        args[index] = arguments[index];\n      }\n      if (isCurried) {\n        var placeholder = getHolder(wrapper),\n            holdersCount = countHolders(args, placeholder);\n      }\n      if (partials) {\n        args = composeArgs(args, partials, holders, isCurried);\n      }\n      if (partialsRight) {\n        args = composeArgsRight(args, partialsRight, holdersRight, isCurried);\n      }\n      length -= holdersCount;\n      if (isCurried && length < arity) {\n        var newHolders = replaceHolders(args, placeholder);\n        return createRecurry(\n            func, bitmask, createHybrid, wrapper.placeholder, thisArg,\n            args, newHolders, argPos, ary, arity - length\n        );\n      }\n      var thisBinding = isBind ? thisArg : this,\n          fn = isBindKey ? thisBinding[func] : func;\n\n      length = args.length;\n      if (argPos) {\n        args = reorder(args, argPos);\n      } else if (isFlip && length > 1) {\n        args.reverse();\n      }\n      if (isAry && ary < length) {\n        args.length = ary;\n      }\n      if (this && this !== root && this instanceof wrapper) {\n        fn = Ctor || createCtor(fn);\n      }\n      return fn.apply(thisBinding, args);\n    }\n    return wrapper;\n  }\n\n  /**\n   * Creates a function like `_.invertBy`.\n   *\n   * @private\n   * @param {Function} setter The function to set accumulator values.\n   * @param {Function} toIteratee The function to resolve iteratees.\n   * @returns {Function} Returns the new inverter function.\n   */\n  function createInverter(setter, toIteratee) {\n    return function(object, iteratee) {\n      return baseInverter(object, setter, toIteratee(iteratee), {});\n    };\n  }\n\n  /**\n   * Creates a function that wraps `func` to invoke it with the `this` binding\n   * of `thisArg` and `partials` prepended to the arguments it receives.\n   *\n   * @private\n   * @param {Function} func The function to wrap.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @param {*} thisArg The `this` binding of `func`.\n   * @param {Array} partials The arguments to prepend to those provided to\n   *  the new function.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createPartial(func, bitmask, thisArg, partials) {\n    var isBind = bitmask & WRAP_BIND_FLAG,\n        Ctor = createCtor(func);\n\n    function wrapper() {\n      var argsIndex = -1,\n          argsLength = arguments.length,\n          leftIndex = -1,\n          leftLength = partials.length,\n          args = Array(leftLength + argsLength),\n          fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;\n\n      while (++leftIndex < leftLength) {\n        args[leftIndex] = partials[leftIndex];\n      }\n      while (argsLength--) {\n        args[leftIndex++] = arguments[++argsIndex];\n      }\n      return apply(fn, isBind ? thisArg : this, args);\n    }\n    return wrapper;\n  }\n\n  /**\n   * Creates a `_.range` or `_.rangeRight` function.\n   *\n   * @private\n   * @param {boolean} [fromRight] Specify iterating from right to left.\n   * @returns {Function} Returns the new range function.\n   */\n  function createRange(fromRight) {\n    return function(start, end, step) {\n      if (step && typeof step != 'number' && isIterateeCall(start, end, step)) {\n        end = step = undefined;\n      }\n      // Ensure the sign of `-0` is preserved.\n      start = toFinite(start);\n      if (end === undefined) {\n        end = start;\n        start = 0;\n      } else {\n        end = toFinite(end);\n      }\n      step = step === undefined ? (start < end ? 1 : -1) : toFinite(step);\n      return baseRange(start, end, step, fromRight);\n    };\n  }\n\n  /**\n   * Creates a function that wraps `func` to continue currying.\n   *\n   * @private\n   * @param {Function} func The function to wrap.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @param {Function} wrapFunc The function to create the `func` wrapper.\n   * @param {*} placeholder The placeholder value.\n   * @param {*} [thisArg] The `this` binding of `func`.\n   * @param {Array} [partials] The arguments to prepend to those provided to\n   *  the new function.\n   * @param {Array} [holders] The `partials` placeholder indexes.\n   * @param {Array} [argPos] The argument positions of the new function.\n   * @param {number} [ary] The arity cap of `func`.\n   * @param {number} [arity] The arity of `func`.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) {\n    var isCurry = bitmask & WRAP_CURRY_FLAG,\n        newHolders = isCurry ? holders : undefined,\n        newHoldersRight = isCurry ? undefined : holders,\n        newPartials = isCurry ? partials : undefined,\n        newPartialsRight = isCurry ? undefined : partials;\n\n    bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG);\n    bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG);\n\n    if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) {\n      bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG);\n    }\n    var newData = [\n      func, bitmask, thisArg, newPartials, newHolders, newPartialsRight,\n      newHoldersRight, argPos, ary, arity\n    ];\n\n    var result = wrapFunc.apply(undefined, newData);\n    if (isLaziable(func)) {\n      setData(result, newData);\n    }\n    result.placeholder = placeholder;\n    return setWrapToString(result, func, bitmask);\n  }\n\n  /**\n   * Creates a set object of `values`.\n   *\n   * @private\n   * @param {Array} values The values to add to the set.\n   * @returns {Object} Returns the new set.\n   */\n  var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) {\n    return new Set(values);\n  };\n\n  /**\n   * Creates a function that either curries or invokes `func` with optional\n   * `this` binding and partially applied arguments.\n   *\n   * @private\n   * @param {Function|string} func The function or method name to wrap.\n   * @param {number} bitmask The bitmask flags.\n   *    1 - `_.bind`\n   *    2 - `_.bindKey`\n   *    4 - `_.curry` or `_.curryRight` of a bound function\n   *    8 - `_.curry`\n   *   16 - `_.curryRight`\n   *   32 - `_.partial`\n   *   64 - `_.partialRight`\n   *  128 - `_.rearg`\n   *  256 - `_.ary`\n   *  512 - `_.flip`\n   * @param {*} [thisArg] The `this` binding of `func`.\n   * @param {Array} [partials] The arguments to be partially applied.\n   * @param {Array} [holders] The `partials` placeholder indexes.\n   * @param {Array} [argPos] The argument positions of the new function.\n   * @param {number} [ary] The arity cap of `func`.\n   * @param {number} [arity] The arity of `func`.\n   * @returns {Function} Returns the new wrapped function.\n   */\n  function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) {\n    var isBindKey = bitmask & WRAP_BIND_KEY_FLAG;\n    if (!isBindKey && typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    var length = partials ? partials.length : 0;\n    if (!length) {\n      bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG);\n      partials = holders = undefined;\n    }\n    ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0);\n    arity = arity === undefined ? arity : toInteger(arity);\n    length -= holders ? holders.length : 0;\n\n    if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) {\n      var partialsRight = partials,\n          holdersRight = holders;\n\n      partials = holders = undefined;\n    }\n    var data = isBindKey ? undefined : getData(func);\n\n    var newData = [\n      func, bitmask, thisArg, partials, holders, partialsRight, holdersRight,\n      argPos, ary, arity\n    ];\n\n    if (data) {\n      mergeData(newData, data);\n    }\n    func = newData[0];\n    bitmask = newData[1];\n    thisArg = newData[2];\n    partials = newData[3];\n    holders = newData[4];\n    arity = newData[9] = newData[9] === undefined\n        ? (isBindKey ? 0 : func.length)\n        : nativeMax(newData[9] - length, 0);\n\n    if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) {\n      bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG);\n    }\n    if (!bitmask || bitmask == WRAP_BIND_FLAG) {\n      var result = createBind(func, bitmask, thisArg);\n    } else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) {\n      result = createCurry(func, bitmask, arity);\n    } else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) {\n      result = createPartial(func, bitmask, thisArg, partials);\n    } else {\n      result = createHybrid.apply(undefined, newData);\n    }\n    var setter = data ? baseSetData : setData;\n    return setWrapToString(setter(result, newData), func, bitmask);\n  }\n\n  /**\n   * Used by `_.defaultsDeep` to customize its `_.merge` use to merge source\n   * objects into destination objects that are passed thru.\n   *\n   * @private\n   * @param {*} objValue The destination value.\n   * @param {*} srcValue The source value.\n   * @param {string} key The key of the property to merge.\n   * @param {Object} object The parent object of `objValue`.\n   * @param {Object} source The parent object of `srcValue`.\n   * @param {Object} [stack] Tracks traversed source values and their merged\n   *  counterparts.\n   * @returns {*} Returns the value to assign.\n   */\n  function customDefaultsMerge(objValue, srcValue, key, object, source, stack) {\n    if (isObject(objValue) && isObject(srcValue)) {\n      // Recursively merge objects and arrays (susceptible to call stack limits).\n      stack.set(srcValue, objValue);\n      baseMerge(objValue, srcValue, undefined, customDefaultsMerge, stack);\n      stack['delete'](srcValue);\n    }\n    return objValue;\n  }\n\n  /**\n   * Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain\n   * objects.\n   *\n   * @private\n   * @param {*} value The value to inspect.\n   * @param {string} key The key of the property to inspect.\n   * @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`.\n   */\n  function customOmitClone(value) {\n    return isPlainObject(value) ? undefined : value;\n  }\n\n  /**\n   * A specialized version of `baseIsEqualDeep` for arrays with support for\n   * partial deep comparisons.\n   *\n   * @private\n   * @param {Array} array The array to compare.\n   * @param {Array} other The other array to compare.\n   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\n   * @param {Function} customizer The function to customize comparisons.\n   * @param {Function} equalFunc The function to determine equivalents of values.\n   * @param {Object} stack Tracks traversed `array` and `other` objects.\n   * @returns {boolean} Returns `true` if the arrays are equivalent, else `false`.\n   */\n  function equalArrays(array, other, bitmask, customizer, equalFunc, stack) {\n    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,\n        arrLength = array.length,\n        othLength = other.length;\n\n    if (arrLength != othLength && !(isPartial && othLength > arrLength)) {\n      return false;\n    }\n    // Assume cyclic values are equal.\n    var stacked = stack.get(array);\n    if (stacked && stack.get(other)) {\n      return stacked == other;\n    }\n    var index = -1,\n        result = true,\n        seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined;\n\n    stack.set(array, other);\n    stack.set(other, array);\n\n    // Ignore non-index properties.\n    while (++index < arrLength) {\n      var arrValue = array[index],\n          othValue = other[index];\n\n      if (customizer) {\n        var compared = isPartial\n            ? customizer(othValue, arrValue, index, other, array, stack)\n            : customizer(arrValue, othValue, index, array, other, stack);\n      }\n      if (compared !== undefined) {\n        if (compared) {\n          continue;\n        }\n        result = false;\n        break;\n      }\n      // Recursively compare arrays (susceptible to call stack limits).\n      if (seen) {\n        if (!arraySome(other, function(othValue, othIndex) {\n          if (!cacheHas(seen, othIndex) &&\n              (arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) {\n            return seen.push(othIndex);\n          }\n        })) {\n          result = false;\n          break;\n        }\n      } else if (!(\n          arrValue === othValue ||\n          equalFunc(arrValue, othValue, bitmask, customizer, stack)\n      )) {\n        result = false;\n        break;\n      }\n    }\n    stack['delete'](array);\n    stack['delete'](other);\n    return result;\n  }\n\n  /**\n   * A specialized version of `baseIsEqualDeep` for comparing objects of\n   * the same `toStringTag`.\n   *\n   * **Note:** This function only supports comparing values with tags of\n   * `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`.\n   *\n   * @private\n   * @param {Object} object The object to compare.\n   * @param {Object} other The other object to compare.\n   * @param {string} tag The `toStringTag` of the objects to compare.\n   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\n   * @param {Function} customizer The function to customize comparisons.\n   * @param {Function} equalFunc The function to determine equivalents of values.\n   * @param {Object} stack Tracks traversed `object` and `other` objects.\n   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\n   */\n  function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) {\n    switch (tag) {\n      case dataViewTag:\n        if ((object.byteLength != other.byteLength) ||\n            (object.byteOffset != other.byteOffset)) {\n          return false;\n        }\n        object = object.buffer;\n        other = other.buffer;\n\n      case arrayBufferTag:\n        if ((object.byteLength != other.byteLength) ||\n            !equalFunc(new Uint8Array(object), new Uint8Array(other))) {\n          return false;\n        }\n        return true;\n\n      case boolTag:\n      case dateTag:\n      case numberTag:\n        // Coerce booleans to `1` or `0` and dates to milliseconds.\n        // Invalid dates are coerced to `NaN`.\n        return eq(+object, +other);\n\n      case errorTag:\n        return object.name == other.name && object.message == other.message;\n\n      case regexpTag:\n      case stringTag:\n        // Coerce regexes to strings and treat strings, primitives and objects,\n        // as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring\n        // for more details.\n        return object == (other + '');\n\n      case mapTag:\n        var convert = mapToArray;\n\n      case setTag:\n        var isPartial = bitmask & COMPARE_PARTIAL_FLAG;\n        convert || (convert = setToArray);\n\n        if (object.size != other.size && !isPartial) {\n          return false;\n        }\n        // Assume cyclic values are equal.\n        var stacked = stack.get(object);\n        if (stacked) {\n          return stacked == other;\n        }\n        bitmask |= COMPARE_UNORDERED_FLAG;\n\n        // Recursively compare objects (susceptible to call stack limits).\n        stack.set(object, other);\n        var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack);\n        stack['delete'](object);\n        return result;\n\n      case symbolTag:\n        if (symbolValueOf) {\n          return symbolValueOf.call(object) == symbolValueOf.call(other);\n        }\n    }\n    return false;\n  }\n\n  /**\n   * A specialized version of `baseIsEqualDeep` for objects with support for\n   * partial deep comparisons.\n   *\n   * @private\n   * @param {Object} object The object to compare.\n   * @param {Object} other The other object to compare.\n   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.\n   * @param {Function} customizer The function to customize comparisons.\n   * @param {Function} equalFunc The function to determine equivalents of values.\n   * @param {Object} stack Tracks traversed `object` and `other` objects.\n   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.\n   */\n  function equalObjects(object, other, bitmask, customizer, equalFunc, stack) {\n    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,\n        objProps = getAllKeys(object),\n        objLength = objProps.length,\n        othProps = getAllKeys(other),\n        othLength = othProps.length;\n\n    if (objLength != othLength && !isPartial) {\n      return false;\n    }\n    var index = objLength;\n    while (index--) {\n      var key = objProps[index];\n      if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) {\n        return false;\n      }\n    }\n    // Assume cyclic values are equal.\n    var stacked = stack.get(object);\n    if (stacked && stack.get(other)) {\n      return stacked == other;\n    }\n    var result = true;\n    stack.set(object, other);\n    stack.set(other, object);\n\n    var skipCtor = isPartial;\n    while (++index < objLength) {\n      key = objProps[index];\n      var objValue = object[key],\n          othValue = other[key];\n\n      if (customizer) {\n        var compared = isPartial\n            ? customizer(othValue, objValue, key, other, object, stack)\n            : customizer(objValue, othValue, key, object, other, stack);\n      }\n      // Recursively compare objects (susceptible to call stack limits).\n      if (!(compared === undefined\n              ? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack))\n              : compared\n      )) {\n        result = false;\n        break;\n      }\n      skipCtor || (skipCtor = key == 'constructor');\n    }\n    if (result && !skipCtor) {\n      var objCtor = object.constructor,\n          othCtor = other.constructor;\n\n      // Non `Object` object instances with different constructors are not equal.\n      if (objCtor != othCtor &&\n          ('constructor' in object && 'constructor' in other) &&\n          !(typeof objCtor == 'function' && objCtor instanceof objCtor &&\n              typeof othCtor == 'function' && othCtor instanceof othCtor)) {\n        result = false;\n      }\n    }\n    stack['delete'](object);\n    stack['delete'](other);\n    return result;\n  }\n\n  /**\n   * A specialized version of `baseRest` which flattens the rest array.\n   *\n   * @private\n   * @param {Function} func The function to apply a rest parameter to.\n   * @returns {Function} Returns the new function.\n   */\n  function flatRest(func) {\n    return setToString(overRest(func, undefined, flatten), func + '');\n  }\n\n  /**\n   * Creates an array of own enumerable property names and symbols of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names and symbols.\n   */\n  function getAllKeys(object) {\n    return baseGetAllKeys(object, keys, getSymbols);\n  }\n\n  /**\n   * Creates an array of own and inherited enumerable property names and\n   * symbols of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names and symbols.\n   */\n  function getAllKeysIn(object) {\n    return baseGetAllKeys(object, keysIn, getSymbolsIn);\n  }\n\n  /**\n   * Gets metadata for `func`.\n   *\n   * @private\n   * @param {Function} func The function to query.\n   * @returns {*} Returns the metadata for `func`.\n   */\n  var getData = !metaMap ? noop : function(func) {\n    return metaMap.get(func);\n  };\n\n  /**\n   * Gets the name of `func`.\n   *\n   * @private\n   * @param {Function} func The function to query.\n   * @returns {string} Returns the function name.\n   */\n  function getFuncName(func) {\n    var result = (func.name + ''),\n        array = realNames[result],\n        length = hasOwnProperty.call(realNames, result) ? array.length : 0;\n\n    while (length--) {\n      var data = array[length],\n          otherFunc = data.func;\n      if (otherFunc == null || otherFunc == func) {\n        return data.name;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Gets the argument placeholder value for `func`.\n   *\n   * @private\n   * @param {Function} func The function to inspect.\n   * @returns {*} Returns the placeholder value.\n   */\n  function getHolder(func) {\n    var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func;\n    return object.placeholder;\n  }\n\n  /**\n   * Gets the data for `map`.\n   *\n   * @private\n   * @param {Object} map The map to query.\n   * @param {string} key The reference key.\n   * @returns {*} Returns the map data.\n   */\n  function getMapData(map, key) {\n    var data = map.__data__;\n    return isKeyable(key)\n        ? data[typeof key == 'string' ? 'string' : 'hash']\n        : data.map;\n  }\n\n  /**\n   * Gets the property names, values, and compare flags of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the match data of `object`.\n   */\n  function getMatchData(object) {\n    var result = keys(object),\n        length = result.length;\n\n    while (length--) {\n      var key = result[length],\n          value = object[key];\n\n      result[length] = [key, value, isStrictComparable(value)];\n    }\n    return result;\n  }\n\n  /**\n   * Gets the native function at `key` of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {string} key The key of the method to get.\n   * @returns {*} Returns the function if it's native, else `undefined`.\n   */\n  function getNative(object, key) {\n    var value = getValue(object, key);\n    return baseIsNative(value) ? value : undefined;\n  }\n\n  /**\n   * A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values.\n   *\n   * @private\n   * @param {*} value The value to query.\n   * @returns {string} Returns the raw `toStringTag`.\n   */\n  function getRawTag(value) {\n    var isOwn = hasOwnProperty.call(value, symToStringTag),\n        tag = value[symToStringTag];\n\n    try {\n      value[symToStringTag] = undefined;\n      var unmasked = true;\n    } catch (e) {}\n\n    var result = nativeObjectToString.call(value);\n    if (unmasked) {\n      if (isOwn) {\n        value[symToStringTag] = tag;\n      } else {\n        delete value[symToStringTag];\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Creates an array of the own enumerable symbols of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of symbols.\n   */\n  var getSymbols = !nativeGetSymbols ? stubArray : function(object) {\n    if (object == null) {\n      return [];\n    }\n    object = Object(object);\n    return arrayFilter(nativeGetSymbols(object), function(symbol) {\n      return propertyIsEnumerable.call(object, symbol);\n    });\n  };\n\n  /**\n   * Creates an array of the own and inherited enumerable symbols of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of symbols.\n   */\n  var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) {\n    var result = [];\n    while (object) {\n      arrayPush(result, getSymbols(object));\n      object = getPrototype(object);\n    }\n    return result;\n  };\n\n  /**\n   * Gets the `toStringTag` of `value`.\n   *\n   * @private\n   * @param {*} value The value to query.\n   * @returns {string} Returns the `toStringTag`.\n   */\n  var getTag = baseGetTag;\n\n  // Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6.\n  if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) ||\n      (Map && getTag(new Map) != mapTag) ||\n      (Promise && getTag(Promise.resolve()) != promiseTag) ||\n      (Set && getTag(new Set) != setTag) ||\n      (WeakMap && getTag(new WeakMap) != weakMapTag)) {\n    getTag = function(value) {\n      var result = baseGetTag(value),\n          Ctor = result == objectTag ? value.constructor : undefined,\n          ctorString = Ctor ? toSource(Ctor) : '';\n\n      if (ctorString) {\n        switch (ctorString) {\n          case dataViewCtorString: return dataViewTag;\n          case mapCtorString: return mapTag;\n          case promiseCtorString: return promiseTag;\n          case setCtorString: return setTag;\n          case weakMapCtorString: return weakMapTag;\n        }\n      }\n      return result;\n    };\n  }\n\n  /**\n   * Gets the view, applying any `transforms` to the `start` and `end` positions.\n   *\n   * @private\n   * @param {number} start The start of the view.\n   * @param {number} end The end of the view.\n   * @param {Array} transforms The transformations to apply to the view.\n   * @returns {Object} Returns an object containing the `start` and `end`\n   *  positions of the view.\n   */\n  function getView(start, end, transforms) {\n    var index = -1,\n        length = transforms.length;\n\n    while (++index < length) {\n      var data = transforms[index],\n          size = data.size;\n\n      switch (data.type) {\n        case 'drop':      start += size; break;\n        case 'dropRight': end -= size; break;\n        case 'take':      end = nativeMin(end, start + size); break;\n        case 'takeRight': start = nativeMax(start, end - size); break;\n      }\n    }\n    return { 'start': start, 'end': end };\n  }\n\n  /**\n   * Extracts wrapper details from the `source` body comment.\n   *\n   * @private\n   * @param {string} source The source to inspect.\n   * @returns {Array} Returns the wrapper details.\n   */\n  function getWrapDetails(source) {\n    var match = source.match(reWrapDetails);\n    return match ? match[1].split(reSplitDetails) : [];\n  }\n\n  /**\n   * Checks if `path` exists on `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path to check.\n   * @param {Function} hasFunc The function to check properties.\n   * @returns {boolean} Returns `true` if `path` exists, else `false`.\n   */\n  function hasPath(object, path, hasFunc) {\n    path = castPath(path, object);\n\n    var index = -1,\n        length = path.length,\n        result = false;\n\n    while (++index < length) {\n      var key = toKey(path[index]);\n      if (!(result = object != null && hasFunc(object, key))) {\n        break;\n      }\n      object = object[key];\n    }\n    if (result || ++index != length) {\n      return result;\n    }\n    length = object == null ? 0 : object.length;\n    return !!length && isLength(length) && isIndex(key, length) &&\n        (isArray(object) || isArguments(object));\n  }\n\n  /**\n   * Initializes an array clone.\n   *\n   * @private\n   * @param {Array} array The array to clone.\n   * @returns {Array} Returns the initialized clone.\n   */\n  function initCloneArray(array) {\n    var length = array.length,\n        result = new array.constructor(length);\n\n    // Add properties assigned by `RegExp#exec`.\n    if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) {\n      result.index = array.index;\n      result.input = array.input;\n    }\n    return result;\n  }\n\n  /**\n   * Initializes an object clone.\n   *\n   * @private\n   * @param {Object} object The object to clone.\n   * @returns {Object} Returns the initialized clone.\n   */\n  function initCloneObject(object) {\n    return (typeof object.constructor == 'function' && !isPrototype(object))\n        ? baseCreate(getPrototype(object))\n        : {};\n  }\n\n  /**\n   * Initializes an object clone based on its `toStringTag`.\n   *\n   * **Note:** This function only supports cloning values with tags of\n   * `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`.\n   *\n   * @private\n   * @param {Object} object The object to clone.\n   * @param {string} tag The `toStringTag` of the object to clone.\n   * @param {boolean} [isDeep] Specify a deep clone.\n   * @returns {Object} Returns the initialized clone.\n   */\n  function initCloneByTag(object, tag, isDeep) {\n    var Ctor = object.constructor;\n    switch (tag) {\n      case arrayBufferTag:\n        return cloneArrayBuffer(object);\n\n      case boolTag:\n      case dateTag:\n        return new Ctor(+object);\n\n      case dataViewTag:\n        return cloneDataView(object, isDeep);\n\n      case float32Tag: case float64Tag:\n      case int8Tag: case int16Tag: case int32Tag:\n      case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag:\n        return cloneTypedArray(object, isDeep);\n\n      case mapTag:\n        return new Ctor;\n\n      case numberTag:\n      case stringTag:\n        return new Ctor(object);\n\n      case regexpTag:\n        return cloneRegExp(object);\n\n      case setTag:\n        return new Ctor;\n\n      case symbolTag:\n        return cloneSymbol(object);\n    }\n  }\n\n  /**\n   * Inserts wrapper `details` in a comment at the top of the `source` body.\n   *\n   * @private\n   * @param {string} source The source to modify.\n   * @returns {Array} details The details to insert.\n   * @returns {string} Returns the modified source.\n   */\n  function insertWrapDetails(source, details) {\n    var length = details.length;\n    if (!length) {\n      return source;\n    }\n    var lastIndex = length - 1;\n    details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex];\n    details = details.join(length > 2 ? ', ' : ' ');\n    return source.replace(reWrapComment, '{\\n/* [wrapped with ' + details + '] */\\n');\n  }\n\n  /**\n   * Checks if `value` is a flattenable `arguments` object or array.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is flattenable, else `false`.\n   */\n  function isFlattenable(value) {\n    return isArray(value) || isArguments(value) ||\n        !!(spreadableSymbol && value && value[spreadableSymbol]);\n  }\n\n  /**\n   * Checks if `value` is a valid array-like index.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index.\n   * @returns {boolean} Returns `true` if `value` is a valid index, else `false`.\n   */\n  function isIndex(value, length) {\n    var type = typeof value;\n    length = length == null ? MAX_SAFE_INTEGER : length;\n\n    return !!length &&\n        (type == 'number' ||\n            (type != 'symbol' && reIsUint.test(value))) &&\n        (value > -1 && value % 1 == 0 && value < length);\n  }\n\n  /**\n   * Checks if the given arguments are from an iteratee call.\n   *\n   * @private\n   * @param {*} value The potential iteratee value argument.\n   * @param {*} index The potential iteratee index or key argument.\n   * @param {*} object The potential iteratee object argument.\n   * @returns {boolean} Returns `true` if the arguments are from an iteratee call,\n   *  else `false`.\n   */\n  function isIterateeCall(value, index, object) {\n    if (!isObject(object)) {\n      return false;\n    }\n    var type = typeof index;\n    if (type == 'number'\n        ? (isArrayLike(object) && isIndex(index, object.length))\n        : (type == 'string' && index in object)\n    ) {\n      return eq(object[index], value);\n    }\n    return false;\n  }\n\n  /**\n   * Checks if `value` is a property name and not a property path.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @param {Object} [object] The object to query keys on.\n   * @returns {boolean} Returns `true` if `value` is a property name, else `false`.\n   */\n  function isKey(value, object) {\n    if (isArray(value)) {\n      return false;\n    }\n    var type = typeof value;\n    if (type == 'number' || type == 'symbol' || type == 'boolean' ||\n        value == null || isSymbol(value)) {\n      return true;\n    }\n    return reIsPlainProp.test(value) || !reIsDeepProp.test(value) ||\n        (object != null && value in Object(object));\n  }\n\n  /**\n   * Checks if `value` is suitable for use as unique object key.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is suitable, else `false`.\n   */\n  function isKeyable(value) {\n    var type = typeof value;\n    return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean')\n        ? (value !== '__proto__')\n        : (value === null);\n  }\n\n  /**\n   * Checks if `func` has a lazy counterpart.\n   *\n   * @private\n   * @param {Function} func The function to check.\n   * @returns {boolean} Returns `true` if `func` has a lazy counterpart,\n   *  else `false`.\n   */\n  function isLaziable(func) {\n    var funcName = getFuncName(func),\n        other = lodash[funcName];\n\n    if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) {\n      return false;\n    }\n    if (func === other) {\n      return true;\n    }\n    var data = getData(other);\n    return !!data && func === data[0];\n  }\n\n  /**\n   * Checks if `func` has its source masked.\n   *\n   * @private\n   * @param {Function} func The function to check.\n   * @returns {boolean} Returns `true` if `func` is masked, else `false`.\n   */\n  function isMasked(func) {\n    return !!maskSrcKey && (maskSrcKey in func);\n  }\n\n  /**\n   * Checks if `value` is likely a prototype object.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a prototype, else `false`.\n   */\n  function isPrototype(value) {\n    var Ctor = value && value.constructor,\n        proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto;\n\n    return value === proto;\n  }\n\n  /**\n   * Checks if `value` is suitable for strict equality comparisons, i.e. `===`.\n   *\n   * @private\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` if suitable for strict\n   *  equality comparisons, else `false`.\n   */\n  function isStrictComparable(value) {\n    return value === value && !isObject(value);\n  }\n\n  /**\n   * A specialized version of `matchesProperty` for source values suitable\n   * for strict equality comparisons, i.e. `===`.\n   *\n   * @private\n   * @param {string} key The key of the property to get.\n   * @param {*} srcValue The value to match.\n   * @returns {Function} Returns the new spec function.\n   */\n  function matchesStrictComparable(key, srcValue) {\n    return function(object) {\n      if (object == null) {\n        return false;\n      }\n      return object[key] === srcValue &&\n          (srcValue !== undefined || (key in Object(object)));\n    };\n  }\n\n  /**\n   * A specialized version of `_.memoize` which clears the memoized function's\n   * cache when it exceeds `MAX_MEMOIZE_SIZE`.\n   *\n   * @private\n   * @param {Function} func The function to have its output memoized.\n   * @returns {Function} Returns the new memoized function.\n   */\n  function memoizeCapped(func) {\n    var result = memoize(func, function(key) {\n      if (cache.size === MAX_MEMOIZE_SIZE) {\n        cache.clear();\n      }\n      return key;\n    });\n\n    var cache = result.cache;\n    return result;\n  }\n\n  /**\n   * Merges the function metadata of `source` into `data`.\n   *\n   * Merging metadata reduces the number of wrappers used to invoke a function.\n   * This is possible because methods like `_.bind`, `_.curry`, and `_.partial`\n   * may be applied regardless of execution order. Methods like `_.ary` and\n   * `_.rearg` modify function arguments, making the order in which they are\n   * executed important, preventing the merging of metadata. However, we make\n   * an exception for a safe combined case where curried functions have `_.ary`\n   * and or `_.rearg` applied.\n   *\n   * @private\n   * @param {Array} data The destination metadata.\n   * @param {Array} source The source metadata.\n   * @returns {Array} Returns `data`.\n   */\n  function mergeData(data, source) {\n    var bitmask = data[1],\n        srcBitmask = source[1],\n        newBitmask = bitmask | srcBitmask,\n        isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG);\n\n    var isCombo =\n        ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) ||\n        ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) ||\n        ((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG));\n\n    // Exit early if metadata can't be merged.\n    if (!(isCommon || isCombo)) {\n      return data;\n    }\n    // Use source `thisArg` if available.\n    if (srcBitmask & WRAP_BIND_FLAG) {\n      data[2] = source[2];\n      // Set when currying a bound function.\n      newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG;\n    }\n    // Compose partial arguments.\n    var value = source[3];\n    if (value) {\n      var partials = data[3];\n      data[3] = partials ? composeArgs(partials, value, source[4]) : value;\n      data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4];\n    }\n    // Compose partial right arguments.\n    value = source[5];\n    if (value) {\n      partials = data[5];\n      data[5] = partials ? composeArgsRight(partials, value, source[6]) : value;\n      data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6];\n    }\n    // Use source `argPos` if available.\n    value = source[7];\n    if (value) {\n      data[7] = value;\n    }\n    // Use source `ary` if it's smaller.\n    if (srcBitmask & WRAP_ARY_FLAG) {\n      data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]);\n    }\n    // Use source `arity` if one is not provided.\n    if (data[9] == null) {\n      data[9] = source[9];\n    }\n    // Use source `func` and merge bitmasks.\n    data[0] = source[0];\n    data[1] = newBitmask;\n\n    return data;\n  }\n\n  /**\n   * This function is like\n   * [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)\n   * except that it includes inherited enumerable properties.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names.\n   */\n  function nativeKeysIn(object) {\n    var result = [];\n    if (object != null) {\n      for (var key in Object(object)) {\n        result.push(key);\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Converts `value` to a string using `Object.prototype.toString`.\n   *\n   * @private\n   * @param {*} value The value to convert.\n   * @returns {string} Returns the converted string.\n   */\n  function objectToString(value) {\n    return nativeObjectToString.call(value);\n  }\n\n  /**\n   * A specialized version of `baseRest` which transforms the rest array.\n   *\n   * @private\n   * @param {Function} func The function to apply a rest parameter to.\n   * @param {number} [start=func.length-1] The start position of the rest parameter.\n   * @param {Function} transform The rest array transform.\n   * @returns {Function} Returns the new function.\n   */\n  function overRest(func, start, transform) {\n    start = nativeMax(start === undefined ? (func.length - 1) : start, 0);\n    return function() {\n      var args = arguments,\n          index = -1,\n          length = nativeMax(args.length - start, 0),\n          array = Array(length);\n\n      while (++index < length) {\n        array[index] = args[start + index];\n      }\n      index = -1;\n      var otherArgs = Array(start + 1);\n      while (++index < start) {\n        otherArgs[index] = args[index];\n      }\n      otherArgs[start] = transform(array);\n      return apply(func, this, otherArgs);\n    };\n  }\n\n  /**\n   * Gets the parent value at `path` of `object`.\n   *\n   * @private\n   * @param {Object} object The object to query.\n   * @param {Array} path The path to get the parent value of.\n   * @returns {*} Returns the parent value.\n   */\n  function parent(object, path) {\n    return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1));\n  }\n\n  /**\n   * Reorder `array` according to the specified indexes where the element at\n   * the first index is assigned as the first element, the element at\n   * the second index is assigned as the second element, and so on.\n   *\n   * @private\n   * @param {Array} array The array to reorder.\n   * @param {Array} indexes The arranged array indexes.\n   * @returns {Array} Returns `array`.\n   */\n  function reorder(array, indexes) {\n    var arrLength = array.length,\n        length = nativeMin(indexes.length, arrLength),\n        oldArray = copyArray(array);\n\n    while (length--) {\n      var index = indexes[length];\n      array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined;\n    }\n    return array;\n  }\n\n  /**\n   * Sets metadata for `func`.\n   *\n   * **Note:** If this function becomes hot, i.e. is invoked a lot in a short\n   * period of time, it will trip its breaker and transition to an identity\n   * function to avoid garbage collection pauses in V8. See\n   * [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070)\n   * for more details.\n   *\n   * @private\n   * @param {Function} func The function to associate metadata with.\n   * @param {*} data The metadata.\n   * @returns {Function} Returns `func`.\n   */\n  var setData = shortOut(baseSetData);\n\n  /**\n   * Sets the `toString` method of `func` to return `string`.\n   *\n   * @private\n   * @param {Function} func The function to modify.\n   * @param {Function} string The `toString` result.\n   * @returns {Function} Returns `func`.\n   */\n  var setToString = shortOut(baseSetToString);\n\n  /**\n   * Sets the `toString` method of `wrapper` to mimic the source of `reference`\n   * with wrapper details in a comment at the top of the source body.\n   *\n   * @private\n   * @param {Function} wrapper The function to modify.\n   * @param {Function} reference The reference function.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @returns {Function} Returns `wrapper`.\n   */\n  function setWrapToString(wrapper, reference, bitmask) {\n    var source = (reference + '');\n    return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask)));\n  }\n\n  /**\n   * Creates a function that'll short out and invoke `identity` instead\n   * of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN`\n   * milliseconds.\n   *\n   * @private\n   * @param {Function} func The function to restrict.\n   * @returns {Function} Returns the new shortable function.\n   */\n  function shortOut(func) {\n    var count = 0,\n        lastCalled = 0;\n\n    return function() {\n      var stamp = nativeNow(),\n          remaining = HOT_SPAN - (stamp - lastCalled);\n\n      lastCalled = stamp;\n      if (remaining > 0) {\n        if (++count >= HOT_COUNT) {\n          return arguments[0];\n        }\n      } else {\n        count = 0;\n      }\n      return func.apply(undefined, arguments);\n    };\n  }\n\n  /**\n   * Converts `string` to a property path array.\n   *\n   * @private\n   * @param {string} string The string to convert.\n   * @returns {Array} Returns the property path array.\n   */\n  var stringToPath = memoizeCapped(function(string) {\n    var result = [];\n    if (string.charCodeAt(0) === 46 /* . */) {\n      result.push('');\n    }\n    string.replace(rePropName, function(match, number, quote, subString) {\n      result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match));\n    });\n    return result;\n  });\n\n  /**\n   * Converts `value` to a string key if it's not a string or symbol.\n   *\n   * @private\n   * @param {*} value The value to inspect.\n   * @returns {string|symbol} Returns the key.\n   */\n  function toKey(value) {\n    if (typeof value == 'string' || isSymbol(value)) {\n      return value;\n    }\n    var result = (value + '');\n    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;\n  }\n\n  /**\n   * Converts `func` to its source code.\n   *\n   * @private\n   * @param {Function} func The function to convert.\n   * @returns {string} Returns the source code.\n   */\n  function toSource(func) {\n    if (func != null) {\n      try {\n        return funcToString.call(func);\n      } catch (e) {}\n      try {\n        return (func + '');\n      } catch (e) {}\n    }\n    return '';\n  }\n\n  /**\n   * Updates wrapper `details` based on `bitmask` flags.\n   *\n   * @private\n   * @returns {Array} details The details to modify.\n   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.\n   * @returns {Array} Returns `details`.\n   */\n  function updateWrapDetails(details, bitmask) {\n    arrayEach(wrapFlags, function(pair) {\n      var value = '_.' + pair[0];\n      if ((bitmask & pair[1]) && !arrayIncludes(details, value)) {\n        details.push(value);\n      }\n    });\n    return details.sort();\n  }\n\n  /**\n   * Creates a clone of `wrapper`.\n   *\n   * @private\n   * @param {Object} wrapper The wrapper to clone.\n   * @returns {Object} Returns the cloned wrapper.\n   */\n  function wrapperClone(wrapper) {\n    if (wrapper instanceof LazyWrapper) {\n      return wrapper.clone();\n    }\n    var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__);\n    result.__actions__ = copyArray(wrapper.__actions__);\n    result.__index__  = wrapper.__index__;\n    result.__values__ = wrapper.__values__;\n    return result;\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates an array with all falsey values removed. The values `false`, `null`,\n   * `0`, `\"\"`, `undefined`, and `NaN` are falsey.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to compact.\n   * @returns {Array} Returns the new array of filtered values.\n   * @example\n   *\n   * _.compact([0, 1, false, 2, '', 3]);\n   * // => [1, 2, 3]\n   */\n  function compact(array) {\n    var index = -1,\n        length = array == null ? 0 : array.length,\n        resIndex = 0,\n        result = [];\n\n    while (++index < length) {\n      var value = array[index];\n      if (value) {\n        result[resIndex++] = value;\n      }\n    }\n    return result;\n  }\n\n  /**\n   * Creates a new array concatenating `array` with any additional arrays\n   * and/or values.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Array\n   * @param {Array} array The array to concatenate.\n   * @param {...*} [values] The values to concatenate.\n   * @returns {Array} Returns the new concatenated array.\n   * @example\n   *\n   * var array = [1];\n   * var other = _.concat(array, 2, [3], [[4]]);\n   *\n   * console.log(other);\n   * // => [1, 2, 3, [4]]\n   *\n   * console.log(array);\n   * // => [1]\n   */\n  function concat() {\n    var length = arguments.length;\n    if (!length) {\n      return [];\n    }\n    var args = Array(length - 1),\n        array = arguments[0],\n        index = length;\n\n    while (index--) {\n      args[index - 1] = arguments[index];\n    }\n    return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1));\n  }\n\n  /**\n   * Creates an array of `array` values not included in the other given arrays\n   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons. The order and references of result values are\n   * determined by the first array.\n   *\n   * **Note:** Unlike `_.pullAll`, this method returns a new array.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {...Array} [values] The values to exclude.\n   * @returns {Array} Returns the new array of filtered values.\n   * @see _.without, _.xor\n   * @example\n   *\n   * _.difference([2, 1], [2, 3]);\n   * // => [1]\n   */\n  var difference = baseRest(function(array, values) {\n    return isArrayLikeObject(array)\n        ? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true))\n        : [];\n  });\n\n  /**\n   * Creates a slice of `array` with `n` elements dropped from the beginning.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.5.0\n   * @category Array\n   * @param {Array} array The array to query.\n   * @param {number} [n=1] The number of elements to drop.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {Array} Returns the slice of `array`.\n   * @example\n   *\n   * _.drop([1, 2, 3]);\n   * // => [2, 3]\n   *\n   * _.drop([1, 2, 3], 2);\n   * // => [3]\n   *\n   * _.drop([1, 2, 3], 5);\n   * // => []\n   *\n   * _.drop([1, 2, 3], 0);\n   * // => [1, 2, 3]\n   */\n  function drop(array, n, guard) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return [];\n    }\n    n = (guard || n === undefined) ? 1 : toInteger(n);\n    return baseSlice(array, n < 0 ? 0 : n, length);\n  }\n\n  /**\n   * This method is like `_.find` except that it returns the index of the first\n   * element `predicate` returns truthy for instead of the element itself.\n   *\n   * @static\n   * @memberOf _\n   * @since 1.1.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @param {number} [fromIndex=0] The index to search from.\n   * @returns {number} Returns the index of the found element, else `-1`.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney',  'active': false },\n   *   { 'user': 'fred',    'active': false },\n   *   { 'user': 'pebbles', 'active': true }\n   * ];\n   *\n   * _.findIndex(users, function(o) { return o.user == 'barney'; });\n   * // => 0\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.findIndex(users, { 'user': 'fred', 'active': false });\n   * // => 1\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.findIndex(users, ['active', false]);\n   * // => 0\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.findIndex(users, 'active');\n   * // => 2\n   */\n  function findIndex(array, predicate, fromIndex) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return -1;\n    }\n    var index = fromIndex == null ? 0 : toInteger(fromIndex);\n    if (index < 0) {\n      index = nativeMax(length + index, 0);\n    }\n    return baseFindIndex(array, baseIteratee(predicate, 3), index);\n  }\n\n  /**\n   * This method is like `_.findIndex` except that it iterates over elements\n   * of `collection` from right to left.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.0.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @param {number} [fromIndex=array.length-1] The index to search from.\n   * @returns {number} Returns the index of the found element, else `-1`.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney',  'active': true },\n   *   { 'user': 'fred',    'active': false },\n   *   { 'user': 'pebbles', 'active': false }\n   * ];\n   *\n   * _.findLastIndex(users, function(o) { return o.user == 'pebbles'; });\n   * // => 2\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.findLastIndex(users, { 'user': 'barney', 'active': true });\n   * // => 0\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.findLastIndex(users, ['active', false]);\n   * // => 2\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.findLastIndex(users, 'active');\n   * // => 0\n   */\n  function findLastIndex(array, predicate, fromIndex) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return -1;\n    }\n    var index = length - 1;\n    if (fromIndex !== undefined) {\n      index = toInteger(fromIndex);\n      index = fromIndex < 0\n          ? nativeMax(length + index, 0)\n          : nativeMin(index, length - 1);\n    }\n    return baseFindIndex(array, baseIteratee(predicate, 3), index, true);\n  }\n\n  /**\n   * Flattens `array` a single level deep.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to flatten.\n   * @returns {Array} Returns the new flattened array.\n   * @example\n   *\n   * _.flatten([1, [2, [3, [4]], 5]]);\n   * // => [1, 2, [3, [4]], 5]\n   */\n  function flatten(array) {\n    var length = array == null ? 0 : array.length;\n    return length ? baseFlatten(array, 1) : [];\n  }\n\n  /**\n   * Recursively flattens `array`.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Array\n   * @param {Array} array The array to flatten.\n   * @returns {Array} Returns the new flattened array.\n   * @example\n   *\n   * _.flattenDeep([1, [2, [3, [4]], 5]]);\n   * // => [1, 2, 3, 4, 5]\n   */\n  function flattenDeep(array) {\n    var length = array == null ? 0 : array.length;\n    return length ? baseFlatten(array, INFINITY) : [];\n  }\n\n  /**\n   * Gets the first element of `array`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @alias first\n   * @category Array\n   * @param {Array} array The array to query.\n   * @returns {*} Returns the first element of `array`.\n   * @example\n   *\n   * _.head([1, 2, 3]);\n   * // => 1\n   *\n   * _.head([]);\n   * // => undefined\n   */\n  function head(array) {\n    return (array && array.length) ? array[0] : undefined;\n  }\n\n  /**\n   * Gets the index at which the first occurrence of `value` is found in `array`\n   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons. If `fromIndex` is negative, it's used as the\n   * offset from the end of `array`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {*} value The value to search for.\n   * @param {number} [fromIndex=0] The index to search from.\n   * @returns {number} Returns the index of the matched value, else `-1`.\n   * @example\n   *\n   * _.indexOf([1, 2, 1, 2], 2);\n   * // => 1\n   *\n   * // Search from the `fromIndex`.\n   * _.indexOf([1, 2, 1, 2], 2, 2);\n   * // => 3\n   */\n  function indexOf(array, value, fromIndex) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return -1;\n    }\n    var index = fromIndex == null ? 0 : toInteger(fromIndex);\n    if (index < 0) {\n      index = nativeMax(length + index, 0);\n    }\n    return baseIndexOf(array, value, index);\n  }\n\n  /**\n   * Gets all but the last element of `array`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to query.\n   * @returns {Array} Returns the slice of `array`.\n   * @example\n   *\n   * _.initial([1, 2, 3]);\n   * // => [1, 2]\n   */\n  function initial(array) {\n    var length = array == null ? 0 : array.length;\n    return length ? baseSlice(array, 0, -1) : [];\n  }\n\n  /**\n   * Creates an array of unique values that are included in all given arrays\n   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons. The order and references of result values are\n   * determined by the first array.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {...Array} [arrays] The arrays to inspect.\n   * @returns {Array} Returns the new array of intersecting values.\n   * @example\n   *\n   * _.intersection([2, 1], [2, 3]);\n   * // => [2]\n   */\n  var intersection = baseRest(function(arrays) {\n    var mapped = arrayMap(arrays, castArrayLikeObject);\n    return (mapped.length && mapped[0] === arrays[0])\n        ? baseIntersection(mapped)\n        : [];\n  });\n\n  /**\n   * Gets the last element of `array`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to query.\n   * @returns {*} Returns the last element of `array`.\n   * @example\n   *\n   * _.last([1, 2, 3]);\n   * // => 3\n   */\n  function last(array) {\n    var length = array == null ? 0 : array.length;\n    return length ? array[length - 1] : undefined;\n  }\n\n  /**\n   * Reverses `array` so that the first element becomes the last, the second\n   * element becomes the second to last, and so on.\n   *\n   * **Note:** This method mutates `array` and is based on\n   * [`Array#reverse`](https://mdn.io/Array/reverse).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Array\n   * @param {Array} array The array to modify.\n   * @returns {Array} Returns `array`.\n   * @example\n   *\n   * var array = [1, 2, 3];\n   *\n   * _.reverse(array);\n   * // => [3, 2, 1]\n   *\n   * console.log(array);\n   * // => [3, 2, 1]\n   */\n  function reverse(array) {\n    return array == null ? array : nativeReverse.call(array);\n  }\n\n  /**\n   * Creates a slice of `array` from `start` up to, but not including, `end`.\n   *\n   * **Note:** This method is used instead of\n   * [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are\n   * returned.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Array\n   * @param {Array} array The array to slice.\n   * @param {number} [start=0] The start position.\n   * @param {number} [end=array.length] The end position.\n   * @returns {Array} Returns the slice of `array`.\n   */\n  function slice(array, start, end) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return [];\n    }\n    if (end && typeof end != 'number' && isIterateeCall(array, start, end)) {\n      start = 0;\n      end = length;\n    }\n    else {\n      start = start == null ? 0 : toInteger(start);\n      end = end === undefined ? length : toInteger(end);\n    }\n    return baseSlice(array, start, end);\n  }\n\n  /**\n   * Creates a slice of `array` with `n` elements taken from the beginning.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to query.\n   * @param {number} [n=1] The number of elements to take.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {Array} Returns the slice of `array`.\n   * @example\n   *\n   * _.take([1, 2, 3]);\n   * // => [1]\n   *\n   * _.take([1, 2, 3], 2);\n   * // => [1, 2]\n   *\n   * _.take([1, 2, 3], 5);\n   * // => [1, 2, 3]\n   *\n   * _.take([1, 2, 3], 0);\n   * // => []\n   */\n  function take(array, n, guard) {\n    if (!(array && array.length)) {\n      return [];\n    }\n    n = (guard || n === undefined) ? 1 : toInteger(n);\n    return baseSlice(array, 0, n < 0 ? 0 : n);\n  }\n\n  /**\n   * Creates a slice of `array` with `n` elements taken from the end.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Array\n   * @param {Array} array The array to query.\n   * @param {number} [n=1] The number of elements to take.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {Array} Returns the slice of `array`.\n   * @example\n   *\n   * _.takeRight([1, 2, 3]);\n   * // => [3]\n   *\n   * _.takeRight([1, 2, 3], 2);\n   * // => [2, 3]\n   *\n   * _.takeRight([1, 2, 3], 5);\n   * // => [1, 2, 3]\n   *\n   * _.takeRight([1, 2, 3], 0);\n   * // => []\n   */\n  function takeRight(array, n, guard) {\n    var length = array == null ? 0 : array.length;\n    if (!length) {\n      return [];\n    }\n    n = (guard || n === undefined) ? 1 : toInteger(n);\n    n = length - n;\n    return baseSlice(array, n < 0 ? 0 : n, length);\n  }\n\n  /**\n   * Creates an array of unique values, in order, from all given arrays using\n   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {...Array} [arrays] The arrays to inspect.\n   * @returns {Array} Returns the new array of combined values.\n   * @example\n   *\n   * _.union([2], [1, 2]);\n   * // => [2, 1]\n   */\n  var union = baseRest(function(arrays) {\n    return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true));\n  });\n\n  /**\n   * Creates a duplicate-free version of an array, using\n   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons, in which only the first occurrence of each element\n   * is kept. The order of result values is determined by the order they occur\n   * in the array.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @returns {Array} Returns the new duplicate free array.\n   * @example\n   *\n   * _.uniq([2, 1, 2]);\n   * // => [2, 1]\n   */\n  function uniq(array) {\n    return (array && array.length) ? baseUniq(array) : [];\n  }\n\n  /**\n   * This method is like `_.uniq` except that it accepts `iteratee` which is\n   * invoked for each element in `array` to generate the criterion by which\n   * uniqueness is computed. The order of result values is determined by the\n   * order they occur in the array. The iteratee is invoked with one argument:\n   * (value).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.\n   * @returns {Array} Returns the new duplicate free array.\n   * @example\n   *\n   * _.uniqBy([2.1, 1.2, 2.3], Math.floor);\n   * // => [2.1, 1.2]\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x');\n   * // => [{ 'x': 1 }, { 'x': 2 }]\n   */\n  function uniqBy(array, iteratee) {\n    return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : [];\n  }\n\n  /**\n   * This method is like `_.zip` except that it accepts an array of grouped\n   * elements and creates an array regrouping the elements to their pre-zip\n   * configuration.\n   *\n   * @static\n   * @memberOf _\n   * @since 1.2.0\n   * @category Array\n   * @param {Array} array The array of grouped elements to process.\n   * @returns {Array} Returns the new array of regrouped elements.\n   * @example\n   *\n   * var zipped = _.zip(['a', 'b'], [1, 2], [true, false]);\n   * // => [['a', 1, true], ['b', 2, false]]\n   *\n   * _.unzip(zipped);\n   * // => [['a', 'b'], [1, 2], [true, false]]\n   */\n  function unzip(array) {\n    if (!(array && array.length)) {\n      return [];\n    }\n    var length = 0;\n    array = arrayFilter(array, function(group) {\n      if (isArrayLikeObject(group)) {\n        length = nativeMax(group.length, length);\n        return true;\n      }\n    });\n    return baseTimes(length, function(index) {\n      return arrayMap(array, baseProperty(index));\n    });\n  }\n\n  /**\n   * Creates an array excluding all given values using\n   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * for equality comparisons.\n   *\n   * **Note:** Unlike `_.pull`, this method returns a new array.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {Array} array The array to inspect.\n   * @param {...*} [values] The values to exclude.\n   * @returns {Array} Returns the new array of filtered values.\n   * @see _.difference, _.xor\n   * @example\n   *\n   * _.without([2, 1, 2, 3], 1, 2);\n   * // => [3]\n   */\n  var without = baseRest(function(array, values) {\n    return isArrayLikeObject(array)\n        ? baseDifference(array, values)\n        : [];\n  });\n\n  /**\n   * Creates an array of grouped elements, the first of which contains the\n   * first elements of the given arrays, the second of which contains the\n   * second elements of the given arrays, and so on.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Array\n   * @param {...Array} [arrays] The arrays to process.\n   * @returns {Array} Returns the new array of grouped elements.\n   * @example\n   *\n   * _.zip(['a', 'b'], [1, 2], [true, false]);\n   * // => [['a', 1, true], ['b', 2, false]]\n   */\n  var zip = baseRest(unzip);\n\n  /**\n   * This method is like `_.fromPairs` except that it accepts two arrays,\n   * one of property identifiers and one of corresponding values.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.4.0\n   * @category Array\n   * @param {Array} [props=[]] The property identifiers.\n   * @param {Array} [values=[]] The property values.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * _.zipObject(['a', 'b'], [1, 2]);\n   * // => { 'a': 1, 'b': 2 }\n   */\n  function zipObject(props, values) {\n    return baseZipObject(props || [], values || [], assignValue);\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a `lodash` wrapper instance that wraps `value` with explicit method\n   * chain sequences enabled. The result of such sequences must be unwrapped\n   * with `_#value`.\n   *\n   * @static\n   * @memberOf _\n   * @since 1.3.0\n   * @category Seq\n   * @param {*} value The value to wrap.\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney',  'age': 36 },\n   *   { 'user': 'fred',    'age': 40 },\n   *   { 'user': 'pebbles', 'age': 1 }\n   * ];\n   *\n   * var youngest = _\n   *   .chain(users)\n   *   .sortBy('age')\n   *   .map(function(o) {\n   *     return o.user + ' is ' + o.age;\n   *   })\n   *   .head()\n   *   .value();\n   * // => 'pebbles is 1'\n   */\n  function chain(value) {\n    var result = lodash(value);\n    result.__chain__ = true;\n    return result;\n  }\n\n  /**\n   * This method invokes `interceptor` and returns `value`. The interceptor\n   * is invoked with one argument; (value). The purpose of this method is to\n   * \"tap into\" a method chain sequence in order to modify intermediate results.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Seq\n   * @param {*} value The value to provide to `interceptor`.\n   * @param {Function} interceptor The function to invoke.\n   * @returns {*} Returns `value`.\n   * @example\n   *\n   * _([1, 2, 3])\n   *  .tap(function(array) {\n   *    // Mutate input array.\n   *    array.pop();\n   *  })\n   *  .reverse()\n   *  .value();\n   * // => [2, 1]\n   */\n  function tap(value, interceptor) {\n    interceptor(value);\n    return value;\n  }\n\n  /**\n   * This method is like `_.tap` except that it returns the result of `interceptor`.\n   * The purpose of this method is to \"pass thru\" values replacing intermediate\n   * results in a method chain sequence.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Seq\n   * @param {*} value The value to provide to `interceptor`.\n   * @param {Function} interceptor The function to invoke.\n   * @returns {*} Returns the result of `interceptor`.\n   * @example\n   *\n   * _('  abc  ')\n   *  .chain()\n   *  .trim()\n   *  .thru(function(value) {\n   *    return [value];\n   *  })\n   *  .value();\n   * // => ['abc']\n   */\n  function thru(value, interceptor) {\n    return interceptor(value);\n  }\n\n  /**\n   * This method is the wrapper version of `_.at`.\n   *\n   * @name at\n   * @memberOf _\n   * @since 1.0.0\n   * @category Seq\n   * @param {...(string|string[])} [paths] The property paths to pick.\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * var object = { 'a': [{ 'b': { 'c': 3 } }, 4] };\n   *\n   * _(object).at(['a[0].b.c', 'a[1]']).value();\n   * // => [3, 4]\n   */\n  var wrapperAt = flatRest(function(paths) {\n    var length = paths.length,\n        start = length ? paths[0] : 0,\n        value = this.__wrapped__,\n        interceptor = function(object) { return baseAt(object, paths); };\n\n    if (length > 1 || this.__actions__.length ||\n        !(value instanceof LazyWrapper) || !isIndex(start)) {\n      return this.thru(interceptor);\n    }\n    value = value.slice(start, +start + (length ? 1 : 0));\n    value.__actions__.push({\n      'func': thru,\n      'args': [interceptor],\n      'thisArg': undefined\n    });\n    return new LodashWrapper(value, this.__chain__).thru(function(array) {\n      if (length && !array.length) {\n        array.push(undefined);\n      }\n      return array;\n    });\n  });\n\n  /**\n   * Creates a `lodash` wrapper instance with explicit method chain sequences enabled.\n   *\n   * @name chain\n   * @memberOf _\n   * @since 0.1.0\n   * @category Seq\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney', 'age': 36 },\n   *   { 'user': 'fred',   'age': 40 }\n   * ];\n   *\n   * // A sequence without explicit chaining.\n   * _(users).head();\n   * // => { 'user': 'barney', 'age': 36 }\n   *\n   * // A sequence with explicit chaining.\n   * _(users)\n   *   .chain()\n   *   .head()\n   *   .pick('user')\n   *   .value();\n   * // => { 'user': 'barney' }\n   */\n  function wrapperChain() {\n    return chain(this);\n  }\n\n  /**\n   * Executes the chain sequence and returns the wrapped result.\n   *\n   * @name commit\n   * @memberOf _\n   * @since 3.2.0\n   * @category Seq\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * var array = [1, 2];\n   * var wrapped = _(array).push(3);\n   *\n   * console.log(array);\n   * // => [1, 2]\n   *\n   * wrapped = wrapped.commit();\n   * console.log(array);\n   * // => [1, 2, 3]\n   *\n   * wrapped.last();\n   * // => 3\n   *\n   * console.log(array);\n   * // => [1, 2, 3]\n   */\n  function wrapperCommit() {\n    return new LodashWrapper(this.value(), this.__chain__);\n  }\n\n  /**\n   * Gets the next value on a wrapped object following the\n   * [iterator protocol](https://mdn.io/iteration_protocols#iterator).\n   *\n   * @name next\n   * @memberOf _\n   * @since 4.0.0\n   * @category Seq\n   * @returns {Object} Returns the next iterator value.\n   * @example\n   *\n   * var wrapped = _([1, 2]);\n   *\n   * wrapped.next();\n   * // => { 'done': false, 'value': 1 }\n   *\n   * wrapped.next();\n   * // => { 'done': false, 'value': 2 }\n   *\n   * wrapped.next();\n   * // => { 'done': true, 'value': undefined }\n   */\n  function wrapperNext() {\n    if (this.__values__ === undefined) {\n      this.__values__ = toArray(this.value());\n    }\n    var done = this.__index__ >= this.__values__.length,\n        value = done ? undefined : this.__values__[this.__index__++];\n\n    return { 'done': done, 'value': value };\n  }\n\n  /**\n   * Enables the wrapper to be iterable.\n   *\n   * @name Symbol.iterator\n   * @memberOf _\n   * @since 4.0.0\n   * @category Seq\n   * @returns {Object} Returns the wrapper object.\n   * @example\n   *\n   * var wrapped = _([1, 2]);\n   *\n   * wrapped[Symbol.iterator]() === wrapped;\n   * // => true\n   *\n   * Array.from(wrapped);\n   * // => [1, 2]\n   */\n  function wrapperToIterator() {\n    return this;\n  }\n\n  /**\n   * Creates a clone of the chain sequence planting `value` as the wrapped value.\n   *\n   * @name plant\n   * @memberOf _\n   * @since 3.2.0\n   * @category Seq\n   * @param {*} value The value to plant.\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * function square(n) {\n   *   return n * n;\n   * }\n   *\n   * var wrapped = _([1, 2]).map(square);\n   * var other = wrapped.plant([3, 4]);\n   *\n   * other.value();\n   * // => [9, 16]\n   *\n   * wrapped.value();\n   * // => [1, 4]\n   */\n  function wrapperPlant(value) {\n    var result,\n        parent = this;\n\n    while (parent instanceof baseLodash) {\n      var clone = wrapperClone(parent);\n      clone.__index__ = 0;\n      clone.__values__ = undefined;\n      if (result) {\n        previous.__wrapped__ = clone;\n      } else {\n        result = clone;\n      }\n      var previous = clone;\n      parent = parent.__wrapped__;\n    }\n    previous.__wrapped__ = value;\n    return result;\n  }\n\n  /**\n   * This method is the wrapper version of `_.reverse`.\n   *\n   * **Note:** This method mutates the wrapped array.\n   *\n   * @name reverse\n   * @memberOf _\n   * @since 0.1.0\n   * @category Seq\n   * @returns {Object} Returns the new `lodash` wrapper instance.\n   * @example\n   *\n   * var array = [1, 2, 3];\n   *\n   * _(array).reverse().value()\n   * // => [3, 2, 1]\n   *\n   * console.log(array);\n   * // => [3, 2, 1]\n   */\n  function wrapperReverse() {\n    var value = this.__wrapped__;\n    if (value instanceof LazyWrapper) {\n      var wrapped = value;\n      if (this.__actions__.length) {\n        wrapped = new LazyWrapper(this);\n      }\n      wrapped = wrapped.reverse();\n      wrapped.__actions__.push({\n        'func': thru,\n        'args': [reverse],\n        'thisArg': undefined\n      });\n      return new LodashWrapper(wrapped, this.__chain__);\n    }\n    return this.thru(reverse);\n  }\n\n  /**\n   * Executes the chain sequence to resolve the unwrapped value.\n   *\n   * @name value\n   * @memberOf _\n   * @since 0.1.0\n   * @alias toJSON, valueOf\n   * @category Seq\n   * @returns {*} Returns the resolved unwrapped value.\n   * @example\n   *\n   * _([1, 2, 3]).value();\n   * // => [1, 2, 3]\n   */\n  function wrapperValue() {\n    return baseWrapperValue(this.__wrapped__, this.__actions__);\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates an object composed of keys generated from the results of running\n   * each element of `collection` thru `iteratee`. The corresponding value of\n   * each key is the number of times the key was returned by `iteratee`. The\n   * iteratee is invoked with one argument: (value).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.5.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [iteratee=_.identity] The iteratee to transform keys.\n   * @returns {Object} Returns the composed aggregate object.\n   * @example\n   *\n   * _.countBy([6.1, 4.2, 6.3], Math.floor);\n   * // => { '4': 1, '6': 2 }\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.countBy(['one', 'two', 'three'], 'length');\n   * // => { '3': 2, '5': 1 }\n   */\n  var countBy = createAggregator(function(result, value, key) {\n    if (hasOwnProperty.call(result, key)) {\n      ++result[key];\n    } else {\n      baseAssignValue(result, key, 1);\n    }\n  });\n\n  /**\n   * Checks if `predicate` returns truthy for **all** elements of `collection`.\n   * Iteration is stopped once `predicate` returns falsey. The predicate is\n   * invoked with three arguments: (value, index|key, collection).\n   *\n   * **Note:** This method returns `true` for\n   * [empty collections](https://en.wikipedia.org/wiki/Empty_set) because\n   * [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of\n   * elements of empty collections.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {boolean} Returns `true` if all elements pass the predicate check,\n   *  else `false`.\n   * @example\n   *\n   * _.every([true, 1, null, 'yes'], Boolean);\n   * // => false\n   *\n   * var users = [\n   *   { 'user': 'barney', 'age': 36, 'active': false },\n   *   { 'user': 'fred',   'age': 40, 'active': false }\n   * ];\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.every(users, { 'user': 'barney', 'active': false });\n   * // => false\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.every(users, ['active', false]);\n   * // => true\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.every(users, 'active');\n   * // => false\n   */\n  function every(collection, predicate, guard) {\n    var func = isArray(collection) ? arrayEvery : baseEvery;\n    if (guard && isIterateeCall(collection, predicate, guard)) {\n      predicate = undefined;\n    }\n    return func(collection, baseIteratee(predicate, 3));\n  }\n\n  /**\n   * Iterates over elements of `collection`, returning an array of all elements\n   * `predicate` returns truthy for. The predicate is invoked with three\n   * arguments: (value, index|key, collection).\n   *\n   * **Note:** Unlike `_.remove`, this method returns a new array.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @returns {Array} Returns the new filtered array.\n   * @see _.reject\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney', 'age': 36, 'active': true },\n   *   { 'user': 'fred',   'age': 40, 'active': false }\n   * ];\n   *\n   * _.filter(users, function(o) { return !o.active; });\n   * // => objects for ['fred']\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.filter(users, { 'age': 36, 'active': true });\n   * // => objects for ['barney']\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.filter(users, ['active', false]);\n   * // => objects for ['fred']\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.filter(users, 'active');\n   * // => objects for ['barney']\n   */\n  function filter(collection, predicate) {\n    var func = isArray(collection) ? arrayFilter : baseFilter;\n    return func(collection, baseIteratee(predicate, 3));\n  }\n\n  /**\n   * Iterates over elements of `collection`, returning the first element\n   * `predicate` returns truthy for. The predicate is invoked with three\n   * arguments: (value, index|key, collection).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to inspect.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @param {number} [fromIndex=0] The index to search from.\n   * @returns {*} Returns the matched element, else `undefined`.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney',  'age': 36, 'active': true },\n   *   { 'user': 'fred',    'age': 40, 'active': false },\n   *   { 'user': 'pebbles', 'age': 1,  'active': true }\n   * ];\n   *\n   * _.find(users, function(o) { return o.age < 40; });\n   * // => object for 'barney'\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.find(users, { 'age': 1, 'active': true });\n   * // => object for 'pebbles'\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.find(users, ['active', false]);\n   * // => object for 'fred'\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.find(users, 'active');\n   * // => object for 'barney'\n   */\n  var find = createFind(findIndex);\n\n  /**\n   * Iterates over elements of `collection` and invokes `iteratee` for each element.\n   * The iteratee is invoked with three arguments: (value, index|key, collection).\n   * Iteratee functions may exit iteration early by explicitly returning `false`.\n   *\n   * **Note:** As with other \"Collections\" methods, objects with a \"length\"\n   * property are iterated like arrays. To avoid this behavior use `_.forIn`\n   * or `_.forOwn` for object iteration.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @alias each\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [iteratee=_.identity] The function invoked per iteration.\n   * @returns {Array|Object} Returns `collection`.\n   * @see _.forEachRight\n   * @example\n   *\n   * _.forEach([1, 2], function(value) {\n   *   console.log(value);\n   * });\n   * // => Logs `1` then `2`.\n   *\n   * _.forEach({ 'a': 1, 'b': 2 }, function(value, key) {\n   *   console.log(key);\n   * });\n   * // => Logs 'a' then 'b' (iteration order is not guaranteed).\n   */\n  function forEach(collection, iteratee) {\n    var func = isArray(collection) ? arrayEach : baseEach;\n    return func(collection, baseIteratee(iteratee, 3));\n  }\n\n  /**\n   * Creates an object composed of keys generated from the results of running\n   * each element of `collection` thru `iteratee`. The order of grouped values\n   * is determined by the order they occur in `collection`. The corresponding\n   * value of each key is an array of elements responsible for generating the\n   * key. The iteratee is invoked with one argument: (value).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [iteratee=_.identity] The iteratee to transform keys.\n   * @returns {Object} Returns the composed aggregate object.\n   * @example\n   *\n   * _.groupBy([6.1, 4.2, 6.3], Math.floor);\n   * // => { '4': [4.2], '6': [6.1, 6.3] }\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.groupBy(['one', 'two', 'three'], 'length');\n   * // => { '3': ['one', 'two'], '5': ['three'] }\n   */\n  var groupBy = createAggregator(function(result, value, key) {\n    if (hasOwnProperty.call(result, key)) {\n      result[key].push(value);\n    } else {\n      baseAssignValue(result, key, [value]);\n    }\n  });\n\n  /**\n   * Creates an array of values by running each element in `collection` thru\n   * `iteratee`. The iteratee is invoked with three arguments:\n   * (value, index|key, collection).\n   *\n   * Many lodash methods are guarded to work as iteratees for methods like\n   * `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`.\n   *\n   * The guarded methods are:\n   * `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`,\n   * `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`,\n   * `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`,\n   * `template`, `trim`, `trimEnd`, `trimStart`, and `words`\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [iteratee=_.identity] The function invoked per iteration.\n   * @returns {Array} Returns the new mapped array.\n   * @example\n   *\n   * function square(n) {\n   *   return n * n;\n   * }\n   *\n   * _.map([4, 8], square);\n   * // => [16, 64]\n   *\n   * _.map({ 'a': 4, 'b': 8 }, square);\n   * // => [16, 64] (iteration order is not guaranteed)\n   *\n   * var users = [\n   *   { 'user': 'barney' },\n   *   { 'user': 'fred' }\n   * ];\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.map(users, 'user');\n   * // => ['barney', 'fred']\n   */\n  function map(collection, iteratee) {\n    var func = isArray(collection) ? arrayMap : baseMap;\n    return func(collection, baseIteratee(iteratee, 3));\n  }\n\n  /**\n   * Reduces `collection` to a value which is the accumulated result of running\n   * each element in `collection` thru `iteratee`, where each successive\n   * invocation is supplied the return value of the previous. If `accumulator`\n   * is not given, the first element of `collection` is used as the initial\n   * value. The iteratee is invoked with four arguments:\n   * (accumulator, value, index|key, collection).\n   *\n   * Many lodash methods are guarded to work as iteratees for methods like\n   * `_.reduce`, `_.reduceRight`, and `_.transform`.\n   *\n   * The guarded methods are:\n   * `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`,\n   * and `sortBy`\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [iteratee=_.identity] The function invoked per iteration.\n   * @param {*} [accumulator] The initial value.\n   * @returns {*} Returns the accumulated value.\n   * @see _.reduceRight\n   * @example\n   *\n   * _.reduce([1, 2], function(sum, n) {\n   *   return sum + n;\n   * }, 0);\n   * // => 3\n   *\n   * _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) {\n   *   (result[value] || (result[value] = [])).push(key);\n   *   return result;\n   * }, {});\n   * // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed)\n   */\n  function reduce(collection, iteratee, accumulator) {\n    var func = isArray(collection) ? arrayReduce : baseReduce,\n        initAccum = arguments.length < 3;\n\n    return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach);\n  }\n\n  /**\n   * The opposite of `_.filter`; this method returns the elements of `collection`\n   * that `predicate` does **not** return truthy for.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @returns {Array} Returns the new filtered array.\n   * @see _.filter\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney', 'age': 36, 'active': false },\n   *   { 'user': 'fred',   'age': 40, 'active': true }\n   * ];\n   *\n   * _.reject(users, function(o) { return !o.active; });\n   * // => objects for ['fred']\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.reject(users, { 'age': 40, 'active': true });\n   * // => objects for ['barney']\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.reject(users, ['active', false]);\n   * // => objects for ['fred']\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.reject(users, 'active');\n   * // => objects for ['barney']\n   */\n  function reject(collection, predicate) {\n    var func = isArray(collection) ? arrayFilter : baseFilter;\n    return func(collection, negate(baseIteratee(predicate, 3)));\n  }\n\n  /**\n   * Gets the size of `collection` by returning its length for array-like\n   * values or the number of own enumerable string keyed properties for objects.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object|string} collection The collection to inspect.\n   * @returns {number} Returns the collection size.\n   * @example\n   *\n   * _.size([1, 2, 3]);\n   * // => 3\n   *\n   * _.size({ 'a': 1, 'b': 2 });\n   * // => 2\n   *\n   * _.size('pebbles');\n   * // => 7\n   */\n  function size(collection) {\n    if (collection == null) {\n      return 0;\n    }\n    if (isArrayLike(collection)) {\n      return isString(collection) ? stringSize(collection) : collection.length;\n    }\n    var tag = getTag(collection);\n    if (tag == mapTag || tag == setTag) {\n      return collection.size;\n    }\n    return baseKeys(collection).length;\n  }\n\n  /**\n   * Checks if `predicate` returns truthy for **any** element of `collection`.\n   * Iteration is stopped once `predicate` returns truthy. The predicate is\n   * invoked with three arguments: (value, index|key, collection).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {boolean} Returns `true` if any element passes the predicate check,\n   *  else `false`.\n   * @example\n   *\n   * _.some([null, 0, 'yes', false], Boolean);\n   * // => true\n   *\n   * var users = [\n   *   { 'user': 'barney', 'active': true },\n   *   { 'user': 'fred',   'active': false }\n   * ];\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.some(users, { 'user': 'barney', 'active': false });\n   * // => false\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.some(users, ['active', false]);\n   * // => true\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.some(users, 'active');\n   * // => true\n   */\n  function some(collection, predicate, guard) {\n    var func = isArray(collection) ? arraySome : baseSome;\n    if (guard && isIterateeCall(collection, predicate, guard)) {\n      predicate = undefined;\n    }\n    return func(collection, baseIteratee(predicate, 3));\n  }\n\n  /**\n   * Creates an array of elements, sorted in ascending order by the results of\n   * running each element in a collection thru each iteratee. This method\n   * performs a stable sort, that is, it preserves the original sort order of\n   * equal elements. The iteratees are invoked with one argument: (value).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Collection\n   * @param {Array|Object} collection The collection to iterate over.\n   * @param {...(Function|Function[])} [iteratees=[_.identity]]\n   *  The iteratees to sort by.\n   * @returns {Array} Returns the new sorted array.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'fred',   'age': 48 },\n   *   { 'user': 'barney', 'age': 36 },\n   *   { 'user': 'fred',   'age': 40 },\n   *   { 'user': 'barney', 'age': 34 }\n   * ];\n   *\n   * _.sortBy(users, [function(o) { return o.user; }]);\n   * // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]]\n   *\n   * _.sortBy(users, ['user', 'age']);\n   * // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]]\n   */\n  var sortBy = baseRest(function(collection, iteratees) {\n    if (collection == null) {\n      return [];\n    }\n    var length = iteratees.length;\n    if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) {\n      iteratees = [];\n    } else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) {\n      iteratees = [iteratees[0]];\n    }\n    return baseOrderBy(collection, baseFlatten(iteratees, 1), []);\n  });\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Gets the timestamp of the number of milliseconds that have elapsed since\n   * the Unix epoch (1 January 1970 00:00:00 UTC).\n   *\n   * @static\n   * @memberOf _\n   * @since 2.4.0\n   * @category Date\n   * @returns {number} Returns the timestamp.\n   * @example\n   *\n   * _.defer(function(stamp) {\n   *   console.log(_.now() - stamp);\n   * }, _.now());\n   * // => Logs the number of milliseconds it took for the deferred invocation.\n   */\n  var now = function() {\n    return root.Date.now();\n  };\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * The opposite of `_.before`; this method creates a function that invokes\n   * `func` once it's called `n` or more times.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {number} n The number of calls before `func` is invoked.\n   * @param {Function} func The function to restrict.\n   * @returns {Function} Returns the new restricted function.\n   * @example\n   *\n   * var saves = ['profile', 'settings'];\n   *\n   * var done = _.after(saves.length, function() {\n   *   console.log('done saving!');\n   * });\n   *\n   * _.forEach(saves, function(type) {\n   *   asyncSave({ 'type': type, 'complete': done });\n   * });\n   * // => Logs 'done saving!' after the two async saves have completed.\n   */\n  function after(n, func) {\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    n = toInteger(n);\n    return function() {\n      if (--n < 1) {\n        return func.apply(this, arguments);\n      }\n    };\n  }\n\n  /**\n   * Creates a function that invokes `func`, with the `this` binding and arguments\n   * of the created function, while it's called less than `n` times. Subsequent\n   * calls to the created function return the result of the last `func` invocation.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Function\n   * @param {number} n The number of calls at which `func` is no longer invoked.\n   * @param {Function} func The function to restrict.\n   * @returns {Function} Returns the new restricted function.\n   * @example\n   *\n   * jQuery(element).on('click', _.before(5, addContactToList));\n   * // => Allows adding up to 4 contacts to the list.\n   */\n  function before(n, func) {\n    var result;\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    n = toInteger(n);\n    return function() {\n      if (--n > 0) {\n        result = func.apply(this, arguments);\n      }\n      if (n <= 1) {\n        func = undefined;\n      }\n      return result;\n    };\n  }\n\n  /**\n   * Creates a function that invokes `func` with the `this` binding of `thisArg`\n   * and `partials` prepended to the arguments it receives.\n   *\n   * The `_.bind.placeholder` value, which defaults to `_` in monolithic builds,\n   * may be used as a placeholder for partially applied arguments.\n   *\n   * **Note:** Unlike native `Function#bind`, this method doesn't set the \"length\"\n   * property of bound functions.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to bind.\n   * @param {*} thisArg The `this` binding of `func`.\n   * @param {...*} [partials] The arguments to be partially applied.\n   * @returns {Function} Returns the new bound function.\n   * @example\n   *\n   * function greet(greeting, punctuation) {\n   *   return greeting + ' ' + this.user + punctuation;\n   * }\n   *\n   * var object = { 'user': 'fred' };\n   *\n   * var bound = _.bind(greet, object, 'hi');\n   * bound('!');\n   * // => 'hi fred!'\n   *\n   * // Bound with placeholders.\n   * var bound = _.bind(greet, object, _, '!');\n   * bound('hi');\n   * // => 'hi fred!'\n   */\n  var bind = baseRest(function(func, thisArg, partials) {\n    var bitmask = WRAP_BIND_FLAG;\n    if (partials.length) {\n      var holders = replaceHolders(partials, getHolder(bind));\n      bitmask |= WRAP_PARTIAL_FLAG;\n    }\n    return createWrap(func, bitmask, thisArg, partials, holders);\n  });\n\n  /**\n   * Creates a debounced function that delays invoking `func` until after `wait`\n   * milliseconds have elapsed since the last time the debounced function was\n   * invoked. The debounced function comes with a `cancel` method to cancel\n   * delayed `func` invocations and a `flush` method to immediately invoke them.\n   * Provide `options` to indicate whether `func` should be invoked on the\n   * leading and/or trailing edge of the `wait` timeout. The `func` is invoked\n   * with the last arguments provided to the debounced function. Subsequent\n   * calls to the debounced function return the result of the last `func`\n   * invocation.\n   *\n   * **Note:** If `leading` and `trailing` options are `true`, `func` is\n   * invoked on the trailing edge of the timeout only if the debounced function\n   * is invoked more than once during the `wait` timeout.\n   *\n   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred\n   * until to the next tick, similar to `setTimeout` with a timeout of `0`.\n   *\n   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)\n   * for details over the differences between `_.debounce` and `_.throttle`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to debounce.\n   * @param {number} [wait=0] The number of milliseconds to delay.\n   * @param {Object} [options={}] The options object.\n   * @param {boolean} [options.leading=false]\n   *  Specify invoking on the leading edge of the timeout.\n   * @param {number} [options.maxWait]\n   *  The maximum time `func` is allowed to be delayed before it's invoked.\n   * @param {boolean} [options.trailing=true]\n   *  Specify invoking on the trailing edge of the timeout.\n   * @returns {Function} Returns the new debounced function.\n   * @example\n   *\n   * // Avoid costly calculations while the window size is in flux.\n   * jQuery(window).on('resize', _.debounce(calculateLayout, 150));\n   *\n   * // Invoke `sendMail` when clicked, debouncing subsequent calls.\n   * jQuery(element).on('click', _.debounce(sendMail, 300, {\n   *   'leading': true,\n   *   'trailing': false\n   * }));\n   *\n   * // Ensure `batchLog` is invoked once after 1 second of debounced calls.\n   * var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 });\n   * var source = new EventSource('/stream');\n   * jQuery(source).on('message', debounced);\n   *\n   * // Cancel the trailing debounced invocation.\n   * jQuery(window).on('popstate', debounced.cancel);\n   */\n  function debounce(func, wait, options) {\n    var lastArgs,\n        lastThis,\n        maxWait,\n        result,\n        timerId,\n        lastCallTime,\n        lastInvokeTime = 0,\n        leading = false,\n        maxing = false,\n        trailing = true;\n\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    wait = toNumber(wait) || 0;\n    if (isObject(options)) {\n      leading = !!options.leading;\n      maxing = 'maxWait' in options;\n      maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait;\n      trailing = 'trailing' in options ? !!options.trailing : trailing;\n    }\n\n    function invokeFunc(time) {\n      var args = lastArgs,\n          thisArg = lastThis;\n\n      lastArgs = lastThis = undefined;\n      lastInvokeTime = time;\n      result = func.apply(thisArg, args);\n      return result;\n    }\n\n    function leadingEdge(time) {\n      // Reset any `maxWait` timer.\n      lastInvokeTime = time;\n      // Start the timer for the trailing edge.\n      timerId = setTimeout(timerExpired, wait);\n      // Invoke the leading edge.\n      return leading ? invokeFunc(time) : result;\n    }\n\n    function remainingWait(time) {\n      var timeSinceLastCall = time - lastCallTime,\n          timeSinceLastInvoke = time - lastInvokeTime,\n          timeWaiting = wait - timeSinceLastCall;\n\n      return maxing\n          ? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke)\n          : timeWaiting;\n    }\n\n    function shouldInvoke(time) {\n      var timeSinceLastCall = time - lastCallTime,\n          timeSinceLastInvoke = time - lastInvokeTime;\n\n      // Either this is the first call, activity has stopped and we're at the\n      // trailing edge, the system time has gone backwards and we're treating\n      // it as the trailing edge, or we've hit the `maxWait` limit.\n      return (lastCallTime === undefined || (timeSinceLastCall >= wait) ||\n          (timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait));\n    }\n\n    function timerExpired() {\n      var time = now();\n      if (shouldInvoke(time)) {\n        return trailingEdge(time);\n      }\n      // Restart the timer.\n      timerId = setTimeout(timerExpired, remainingWait(time));\n    }\n\n    function trailingEdge(time) {\n      timerId = undefined;\n\n      // Only invoke if we have `lastArgs` which means `func` has been\n      // debounced at least once.\n      if (trailing && lastArgs) {\n        return invokeFunc(time);\n      }\n      lastArgs = lastThis = undefined;\n      return result;\n    }\n\n    function cancel() {\n      if (timerId !== undefined) {\n        clearTimeout(timerId);\n      }\n      lastInvokeTime = 0;\n      lastArgs = lastCallTime = lastThis = timerId = undefined;\n    }\n\n    function flush() {\n      return timerId === undefined ? result : trailingEdge(now());\n    }\n\n    function debounced() {\n      var time = now(),\n          isInvoking = shouldInvoke(time);\n\n      lastArgs = arguments;\n      lastThis = this;\n      lastCallTime = time;\n\n      if (isInvoking) {\n        if (timerId === undefined) {\n          return leadingEdge(lastCallTime);\n        }\n        if (maxing) {\n          // Handle invocations in a tight loop.\n          timerId = setTimeout(timerExpired, wait);\n          return invokeFunc(lastCallTime);\n        }\n      }\n      if (timerId === undefined) {\n        timerId = setTimeout(timerExpired, wait);\n      }\n      return result;\n    }\n    debounced.cancel = cancel;\n    debounced.flush = flush;\n    return debounced;\n  }\n\n  /**\n   * Defers invoking the `func` until the current call stack has cleared. Any\n   * additional arguments are provided to `func` when it's invoked.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to defer.\n   * @param {...*} [args] The arguments to invoke `func` with.\n   * @returns {number} Returns the timer id.\n   * @example\n   *\n   * _.defer(function(text) {\n   *   console.log(text);\n   * }, 'deferred');\n   * // => Logs 'deferred' after one millisecond.\n   */\n  var defer = baseRest(function(func, args) {\n    return baseDelay(func, 1, args);\n  });\n\n  /**\n   * Invokes `func` after `wait` milliseconds. Any additional arguments are\n   * provided to `func` when it's invoked.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to delay.\n   * @param {number} wait The number of milliseconds to delay invocation.\n   * @param {...*} [args] The arguments to invoke `func` with.\n   * @returns {number} Returns the timer id.\n   * @example\n   *\n   * _.delay(function(text) {\n   *   console.log(text);\n   * }, 1000, 'later');\n   * // => Logs 'later' after one second.\n   */\n  var delay = baseRest(function(func, wait, args) {\n    return baseDelay(func, toNumber(wait) || 0, args);\n  });\n\n  /**\n   * Creates a function that memoizes the result of `func`. If `resolver` is\n   * provided, it determines the cache key for storing the result based on the\n   * arguments provided to the memoized function. By default, the first argument\n   * provided to the memoized function is used as the map cache key. The `func`\n   * is invoked with the `this` binding of the memoized function.\n   *\n   * **Note:** The cache is exposed as the `cache` property on the memoized\n   * function. Its creation may be customized by replacing the `_.memoize.Cache`\n   * constructor with one whose instances implement the\n   * [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object)\n   * method interface of `clear`, `delete`, `get`, `has`, and `set`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to have its output memoized.\n   * @param {Function} [resolver] The function to resolve the cache key.\n   * @returns {Function} Returns the new memoized function.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': 2 };\n   * var other = { 'c': 3, 'd': 4 };\n   *\n   * var values = _.memoize(_.values);\n   * values(object);\n   * // => [1, 2]\n   *\n   * values(other);\n   * // => [3, 4]\n   *\n   * object.a = 2;\n   * values(object);\n   * // => [1, 2]\n   *\n   * // Modify the result cache.\n   * values.cache.set(object, ['a', 'b']);\n   * values(object);\n   * // => ['a', 'b']\n   *\n   * // Replace `_.memoize.Cache`.\n   * _.memoize.Cache = WeakMap;\n   */\n  function memoize(func, resolver) {\n    if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    var memoized = function() {\n      var args = arguments,\n          key = resolver ? resolver.apply(this, args) : args[0],\n          cache = memoized.cache;\n\n      if (cache.has(key)) {\n        return cache.get(key);\n      }\n      var result = func.apply(this, args);\n      memoized.cache = cache.set(key, result) || cache;\n      return result;\n    };\n    memoized.cache = new (memoize.Cache || MapCache);\n    return memoized;\n  }\n\n  // Expose `MapCache`.\n  memoize.Cache = MapCache;\n\n  /**\n   * Creates a function that negates the result of the predicate `func`. The\n   * `func` predicate is invoked with the `this` binding and arguments of the\n   * created function.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Function\n   * @param {Function} predicate The predicate to negate.\n   * @returns {Function} Returns the new negated function.\n   * @example\n   *\n   * function isEven(n) {\n   *   return n % 2 == 0;\n   * }\n   *\n   * _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven));\n   * // => [1, 3, 5]\n   */\n  function negate(predicate) {\n    if (typeof predicate != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    return function() {\n      var args = arguments;\n      switch (args.length) {\n        case 0: return !predicate.call(this);\n        case 1: return !predicate.call(this, args[0]);\n        case 2: return !predicate.call(this, args[0], args[1]);\n        case 3: return !predicate.call(this, args[0], args[1], args[2]);\n      }\n      return !predicate.apply(this, args);\n    };\n  }\n\n  /**\n   * Creates a function that is restricted to invoking `func` once. Repeat calls\n   * to the function return the value of the first invocation. The `func` is\n   * invoked with the `this` binding and arguments of the created function.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to restrict.\n   * @returns {Function} Returns the new restricted function.\n   * @example\n   *\n   * var initialize = _.once(createApplication);\n   * initialize();\n   * initialize();\n   * // => `createApplication` is invoked once\n   */\n  function once(func) {\n    return before(2, func);\n  }\n\n  /**\n   * Creates a function that invokes `func` with the `this` binding of the\n   * created function and arguments from `start` and beyond provided as\n   * an array.\n   *\n   * **Note:** This method is based on the\n   * [rest parameter](https://mdn.io/rest_parameters).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Function\n   * @param {Function} func The function to apply a rest parameter to.\n   * @param {number} [start=func.length-1] The start position of the rest parameter.\n   * @returns {Function} Returns the new function.\n   * @example\n   *\n   * var say = _.rest(function(what, names) {\n   *   return what + ' ' + _.initial(names).join(', ') +\n   *     (_.size(names) > 1 ? ', & ' : '') + _.last(names);\n   * });\n   *\n   * say('hello', 'fred', 'barney', 'pebbles');\n   * // => 'hello fred, barney, & pebbles'\n   */\n  function rest(func, start) {\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    start = start === undefined ? start : toInteger(start);\n    return baseRest(func, start);\n  }\n\n  /**\n   * Creates a throttled function that only invokes `func` at most once per\n   * every `wait` milliseconds. The throttled function comes with a `cancel`\n   * method to cancel delayed `func` invocations and a `flush` method to\n   * immediately invoke them. Provide `options` to indicate whether `func`\n   * should be invoked on the leading and/or trailing edge of the `wait`\n   * timeout. The `func` is invoked with the last arguments provided to the\n   * throttled function. Subsequent calls to the throttled function return the\n   * result of the last `func` invocation.\n   *\n   * **Note:** If `leading` and `trailing` options are `true`, `func` is\n   * invoked on the trailing edge of the timeout only if the throttled function\n   * is invoked more than once during the `wait` timeout.\n   *\n   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred\n   * until to the next tick, similar to `setTimeout` with a timeout of `0`.\n   *\n   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)\n   * for details over the differences between `_.throttle` and `_.debounce`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Function\n   * @param {Function} func The function to throttle.\n   * @param {number} [wait=0] The number of milliseconds to throttle invocations to.\n   * @param {Object} [options={}] The options object.\n   * @param {boolean} [options.leading=true]\n   *  Specify invoking on the leading edge of the timeout.\n   * @param {boolean} [options.trailing=true]\n   *  Specify invoking on the trailing edge of the timeout.\n   * @returns {Function} Returns the new throttled function.\n   * @example\n   *\n   * // Avoid excessively updating the position while scrolling.\n   * jQuery(window).on('scroll', _.throttle(updatePosition, 100));\n   *\n   * // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes.\n   * var throttled = _.throttle(renewToken, 300000, { 'trailing': false });\n   * jQuery(element).on('click', throttled);\n   *\n   * // Cancel the trailing throttled invocation.\n   * jQuery(window).on('popstate', throttled.cancel);\n   */\n  function throttle(func, wait, options) {\n    var leading = true,\n        trailing = true;\n\n    if (typeof func != 'function') {\n      throw new TypeError(FUNC_ERROR_TEXT);\n    }\n    if (isObject(options)) {\n      leading = 'leading' in options ? !!options.leading : leading;\n      trailing = 'trailing' in options ? !!options.trailing : trailing;\n    }\n    return debounce(func, wait, {\n      'leading': leading,\n      'maxWait': wait,\n      'trailing': trailing\n    });\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a shallow clone of `value`.\n   *\n   * **Note:** This method is loosely based on the\n   * [structured clone algorithm](https://mdn.io/Structured_clone_algorithm)\n   * and supports cloning arrays, array buffers, booleans, date objects, maps,\n   * numbers, `Object` objects, regexes, sets, strings, symbols, and typed\n   * arrays. The own enumerable properties of `arguments` objects are cloned\n   * as plain objects. An empty object is returned for uncloneable values such\n   * as error objects, functions, DOM nodes, and WeakMaps.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to clone.\n   * @returns {*} Returns the cloned value.\n   * @see _.cloneDeep\n   * @example\n   *\n   * var objects = [{ 'a': 1 }, { 'b': 2 }];\n   *\n   * var shallow = _.clone(objects);\n   * console.log(shallow[0] === objects[0]);\n   * // => true\n   */\n  function clone(value) {\n    return baseClone(value, CLONE_SYMBOLS_FLAG);\n  }\n\n  /**\n   * This method is like `_.clone` except that it recursively clones `value`.\n   *\n   * @static\n   * @memberOf _\n   * @since 1.0.0\n   * @category Lang\n   * @param {*} value The value to recursively clone.\n   * @returns {*} Returns the deep cloned value.\n   * @see _.clone\n   * @example\n   *\n   * var objects = [{ 'a': 1 }, { 'b': 2 }];\n   *\n   * var deep = _.cloneDeep(objects);\n   * console.log(deep[0] === objects[0]);\n   * // => false\n   */\n  function cloneDeep(value) {\n    return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG);\n  }\n\n  /**\n   * Performs a\n   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)\n   * comparison between two values to determine if they are equivalent.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\n   * @example\n   *\n   * var object = { 'a': 1 };\n   * var other = { 'a': 1 };\n   *\n   * _.eq(object, object);\n   * // => true\n   *\n   * _.eq(object, other);\n   * // => false\n   *\n   * _.eq('a', 'a');\n   * // => true\n   *\n   * _.eq('a', Object('a'));\n   * // => false\n   *\n   * _.eq(NaN, NaN);\n   * // => true\n   */\n  function eq(value, other) {\n    return value === other || (value !== value && other !== other);\n  }\n\n  /**\n   * Checks if `value` is likely an `arguments` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is an `arguments` object,\n   *  else `false`.\n   * @example\n   *\n   * _.isArguments(function() { return arguments; }());\n   * // => true\n   *\n   * _.isArguments([1, 2, 3]);\n   * // => false\n   */\n  var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) {\n    return isObjectLike(value) && hasOwnProperty.call(value, 'callee') &&\n        !propertyIsEnumerable.call(value, 'callee');\n  };\n\n  /**\n   * Checks if `value` is classified as an `Array` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is an array, else `false`.\n   * @example\n   *\n   * _.isArray([1, 2, 3]);\n   * // => true\n   *\n   * _.isArray(document.body.children);\n   * // => false\n   *\n   * _.isArray('abc');\n   * // => false\n   *\n   * _.isArray(_.noop);\n   * // => false\n   */\n  var isArray = Array.isArray;\n\n  /**\n   * Checks if `value` is array-like. A value is considered array-like if it's\n   * not a function and has a `value.length` that's an integer greater than or\n   * equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is array-like, else `false`.\n   * @example\n   *\n   * _.isArrayLike([1, 2, 3]);\n   * // => true\n   *\n   * _.isArrayLike(document.body.children);\n   * // => true\n   *\n   * _.isArrayLike('abc');\n   * // => true\n   *\n   * _.isArrayLike(_.noop);\n   * // => false\n   */\n  function isArrayLike(value) {\n    return value != null && isLength(value.length) && !isFunction(value);\n  }\n\n  /**\n   * This method is like `_.isArrayLike` except that it also checks if `value`\n   * is an object.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is an array-like object,\n   *  else `false`.\n   * @example\n   *\n   * _.isArrayLikeObject([1, 2, 3]);\n   * // => true\n   *\n   * _.isArrayLikeObject(document.body.children);\n   * // => true\n   *\n   * _.isArrayLikeObject('abc');\n   * // => false\n   *\n   * _.isArrayLikeObject(_.noop);\n   * // => false\n   */\n  function isArrayLikeObject(value) {\n    return isObjectLike(value) && isArrayLike(value);\n  }\n\n  /**\n   * Checks if `value` is classified as a boolean primitive or object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a boolean, else `false`.\n   * @example\n   *\n   * _.isBoolean(false);\n   * // => true\n   *\n   * _.isBoolean(null);\n   * // => false\n   */\n  function isBoolean(value) {\n    return value === true || value === false ||\n        (isObjectLike(value) && baseGetTag(value) == boolTag);\n  }\n\n  /**\n   * Checks if `value` is a buffer.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.3.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a buffer, else `false`.\n   * @example\n   *\n   * _.isBuffer(new Buffer(2));\n   * // => true\n   *\n   * _.isBuffer(new Uint8Array(2));\n   * // => false\n   */\n  var isBuffer = nativeIsBuffer || stubFalse;\n\n  /**\n   * Checks if `value` is classified as a `Date` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.\n   * @example\n   *\n   * _.isDate(new Date);\n   * // => true\n   *\n   * _.isDate('Mon April 23 2012');\n   * // => false\n   */\n  var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate;\n\n  /**\n   * Checks if `value` is an empty object, collection, map, or set.\n   *\n   * Objects are considered empty if they have no own enumerable string keyed\n   * properties.\n   *\n   * Array-like values such as `arguments` objects, arrays, buffers, strings, or\n   * jQuery-like collections are considered empty if they have a `length` of `0`.\n   * Similarly, maps and sets are considered empty if they have a `size` of `0`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is empty, else `false`.\n   * @example\n   *\n   * _.isEmpty(null);\n   * // => true\n   *\n   * _.isEmpty(true);\n   * // => true\n   *\n   * _.isEmpty(1);\n   * // => true\n   *\n   * _.isEmpty([1, 2, 3]);\n   * // => false\n   *\n   * _.isEmpty({ 'a': 1 });\n   * // => false\n   */\n  function isEmpty(value) {\n    if (value == null) {\n      return true;\n    }\n    if (isArrayLike(value) &&\n        (isArray(value) || typeof value == 'string' || typeof value.splice == 'function' ||\n            isBuffer(value) || isTypedArray(value) || isArguments(value))) {\n      return !value.length;\n    }\n    var tag = getTag(value);\n    if (tag == mapTag || tag == setTag) {\n      return !value.size;\n    }\n    if (isPrototype(value)) {\n      return !baseKeys(value).length;\n    }\n    for (var key in value) {\n      if (hasOwnProperty.call(value, key)) {\n        return false;\n      }\n    }\n    return true;\n  }\n\n  /**\n   * Performs a deep comparison between two values to determine if they are\n   * equivalent.\n   *\n   * **Note:** This method supports comparing arrays, array buffers, booleans,\n   * date objects, error objects, maps, numbers, `Object` objects, regexes,\n   * sets, strings, symbols, and typed arrays. `Object` objects are compared\n   * by their own, not inherited, enumerable properties. Functions and DOM\n   * nodes are compared by strict equality, i.e. `===`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to compare.\n   * @param {*} other The other value to compare.\n   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.\n   * @example\n   *\n   * var object = { 'a': 1 };\n   * var other = { 'a': 1 };\n   *\n   * _.isEqual(object, other);\n   * // => true\n   *\n   * object === other;\n   * // => false\n   */\n  function isEqual(value, other) {\n    return baseIsEqual(value, other);\n  }\n\n  /**\n   * Checks if `value` is a finite primitive number.\n   *\n   * **Note:** This method is based on\n   * [`Number.isFinite`](https://mdn.io/Number/isFinite).\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a finite number, else `false`.\n   * @example\n   *\n   * _.isFinite(3);\n   * // => true\n   *\n   * _.isFinite(Number.MIN_VALUE);\n   * // => true\n   *\n   * _.isFinite(Infinity);\n   * // => false\n   *\n   * _.isFinite('3');\n   * // => false\n   */\n  function isFinite(value) {\n    return typeof value == 'number' && nativeIsFinite(value);\n  }\n\n  /**\n   * Checks if `value` is classified as a `Function` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a function, else `false`.\n   * @example\n   *\n   * _.isFunction(_);\n   * // => true\n   *\n   * _.isFunction(/abc/);\n   * // => false\n   */\n  function isFunction(value) {\n    if (!isObject(value)) {\n      return false;\n    }\n    // The use of `Object#toString` avoids issues with the `typeof` operator\n    // in Safari 9 which returns 'object' for typed arrays and other constructors.\n    var tag = baseGetTag(value);\n    return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag;\n  }\n\n  /**\n   * Checks if `value` is a valid array-like length.\n   *\n   * **Note:** This method is loosely based on\n   * [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a valid length, else `false`.\n   * @example\n   *\n   * _.isLength(3);\n   * // => true\n   *\n   * _.isLength(Number.MIN_VALUE);\n   * // => false\n   *\n   * _.isLength(Infinity);\n   * // => false\n   *\n   * _.isLength('3');\n   * // => false\n   */\n  function isLength(value) {\n    return typeof value == 'number' &&\n        value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER;\n  }\n\n  /**\n   * Checks if `value` is the\n   * [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types)\n   * of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`)\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is an object, else `false`.\n   * @example\n   *\n   * _.isObject({});\n   * // => true\n   *\n   * _.isObject([1, 2, 3]);\n   * // => true\n   *\n   * _.isObject(_.noop);\n   * // => true\n   *\n   * _.isObject(null);\n   * // => false\n   */\n  function isObject(value) {\n    var type = typeof value;\n    return value != null && (type == 'object' || type == 'function');\n  }\n\n  /**\n   * Checks if `value` is object-like. A value is object-like if it's not `null`\n   * and has a `typeof` result of \"object\".\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is object-like, else `false`.\n   * @example\n   *\n   * _.isObjectLike({});\n   * // => true\n   *\n   * _.isObjectLike([1, 2, 3]);\n   * // => true\n   *\n   * _.isObjectLike(_.noop);\n   * // => false\n   *\n   * _.isObjectLike(null);\n   * // => false\n   */\n  function isObjectLike(value) {\n    return value != null && typeof value == 'object';\n  }\n\n  /**\n   * Checks if `value` is classified as a `Map` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.3.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a map, else `false`.\n   * @example\n   *\n   * _.isMap(new Map);\n   * // => true\n   *\n   * _.isMap(new WeakMap);\n   * // => false\n   */\n  var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap;\n\n  /**\n   * Checks if `value` is `NaN`.\n   *\n   * **Note:** This method is based on\n   * [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as\n   * global [`isNaN`](https://mdn.io/isNaN) which returns `true` for\n   * `undefined` and other non-number values.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.\n   * @example\n   *\n   * _.isNaN(NaN);\n   * // => true\n   *\n   * _.isNaN(new Number(NaN));\n   * // => true\n   *\n   * isNaN(undefined);\n   * // => true\n   *\n   * _.isNaN(undefined);\n   * // => false\n   */\n  function isNaN(value) {\n    // An `NaN` primitive is the only value that is not equal to itself.\n    // Perform the `toStringTag` check first to avoid errors with some\n    // ActiveX objects in IE.\n    return isNumber(value) && value != +value;\n  }\n\n  /**\n   * Checks if `value` is `null`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is `null`, else `false`.\n   * @example\n   *\n   * _.isNull(null);\n   * // => true\n   *\n   * _.isNull(void 0);\n   * // => false\n   */\n  function isNull(value) {\n    return value === null;\n  }\n\n  /**\n   * Checks if `value` is classified as a `Number` primitive or object.\n   *\n   * **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are\n   * classified as numbers, use the `_.isFinite` method.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a number, else `false`.\n   * @example\n   *\n   * _.isNumber(3);\n   * // => true\n   *\n   * _.isNumber(Number.MIN_VALUE);\n   * // => true\n   *\n   * _.isNumber(Infinity);\n   * // => true\n   *\n   * _.isNumber('3');\n   * // => false\n   */\n  function isNumber(value) {\n    return typeof value == 'number' ||\n        (isObjectLike(value) && baseGetTag(value) == numberTag);\n  }\n\n  /**\n   * Checks if `value` is a plain object, that is, an object created by the\n   * `Object` constructor or one with a `[[Prototype]]` of `null`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.8.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a plain object, else `false`.\n   * @example\n   *\n   * function Foo() {\n   *   this.a = 1;\n   * }\n   *\n   * _.isPlainObject(new Foo);\n   * // => false\n   *\n   * _.isPlainObject([1, 2, 3]);\n   * // => false\n   *\n   * _.isPlainObject({ 'x': 0, 'y': 0 });\n   * // => true\n   *\n   * _.isPlainObject(Object.create(null));\n   * // => true\n   */\n  function isPlainObject(value) {\n    if (!isObjectLike(value) || baseGetTag(value) != objectTag) {\n      return false;\n    }\n    var proto = getPrototype(value);\n    if (proto === null) {\n      return true;\n    }\n    var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor;\n    return typeof Ctor == 'function' && Ctor instanceof Ctor &&\n        funcToString.call(Ctor) == objectCtorString;\n  }\n\n  /**\n   * Checks if `value` is classified as a `RegExp` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.1.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.\n   * @example\n   *\n   * _.isRegExp(/abc/);\n   * // => true\n   *\n   * _.isRegExp('/abc/');\n   * // => false\n   */\n  var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp;\n\n  /**\n   * Checks if `value` is classified as a `Set` object.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.3.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a set, else `false`.\n   * @example\n   *\n   * _.isSet(new Set);\n   * // => true\n   *\n   * _.isSet(new WeakSet);\n   * // => false\n   */\n  var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet;\n\n  /**\n   * Checks if `value` is classified as a `String` primitive or object.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a string, else `false`.\n   * @example\n   *\n   * _.isString('abc');\n   * // => true\n   *\n   * _.isString(1);\n   * // => false\n   */\n  function isString(value) {\n    return typeof value == 'string' ||\n        (!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag);\n  }\n\n  /**\n   * Checks if `value` is classified as a `Symbol` primitive or object.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a symbol, else `false`.\n   * @example\n   *\n   * _.isSymbol(Symbol.iterator);\n   * // => true\n   *\n   * _.isSymbol('abc');\n   * // => false\n   */\n  function isSymbol(value) {\n    return typeof value == 'symbol' ||\n        (isObjectLike(value) && baseGetTag(value) == symbolTag);\n  }\n\n  /**\n   * Checks if `value` is classified as a typed array.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.\n   * @example\n   *\n   * _.isTypedArray(new Uint8Array);\n   * // => true\n   *\n   * _.isTypedArray([]);\n   * // => false\n   */\n  var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray;\n\n  /**\n   * Checks if `value` is `undefined`.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Lang\n   * @param {*} value The value to check.\n   * @returns {boolean} Returns `true` if `value` is `undefined`, else `false`.\n   * @example\n   *\n   * _.isUndefined(void 0);\n   * // => true\n   *\n   * _.isUndefined(null);\n   * // => false\n   */\n  function isUndefined(value) {\n    return value === undefined;\n  }\n\n  /**\n   * Converts `value` to an array.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Lang\n   * @param {*} value The value to convert.\n   * @returns {Array} Returns the converted array.\n   * @example\n   *\n   * _.toArray({ 'a': 1, 'b': 2 });\n   * // => [1, 2]\n   *\n   * _.toArray('abc');\n   * // => ['a', 'b', 'c']\n   *\n   * _.toArray(1);\n   * // => []\n   *\n   * _.toArray(null);\n   * // => []\n   */\n  function toArray(value) {\n    if (!value) {\n      return [];\n    }\n    if (isArrayLike(value)) {\n      return isString(value) ? stringToArray(value) : copyArray(value);\n    }\n    if (symIterator && value[symIterator]) {\n      return iteratorToArray(value[symIterator]());\n    }\n    var tag = getTag(value),\n        func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values);\n\n    return func(value);\n  }\n\n  /**\n   * Converts `value` to a finite number.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.12.0\n   * @category Lang\n   * @param {*} value The value to convert.\n   * @returns {number} Returns the converted number.\n   * @example\n   *\n   * _.toFinite(3.2);\n   * // => 3.2\n   *\n   * _.toFinite(Number.MIN_VALUE);\n   * // => 5e-324\n   *\n   * _.toFinite(Infinity);\n   * // => 1.7976931348623157e+308\n   *\n   * _.toFinite('3.2');\n   * // => 3.2\n   */\n  function toFinite(value) {\n    if (!value) {\n      return value === 0 ? value : 0;\n    }\n    value = toNumber(value);\n    if (value === INFINITY || value === -INFINITY) {\n      var sign = (value < 0 ? -1 : 1);\n      return sign * MAX_INTEGER;\n    }\n    return value === value ? value : 0;\n  }\n\n  /**\n   * Converts `value` to an integer.\n   *\n   * **Note:** This method is loosely based on\n   * [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to convert.\n   * @returns {number} Returns the converted integer.\n   * @example\n   *\n   * _.toInteger(3.2);\n   * // => 3\n   *\n   * _.toInteger(Number.MIN_VALUE);\n   * // => 0\n   *\n   * _.toInteger(Infinity);\n   * // => 1.7976931348623157e+308\n   *\n   * _.toInteger('3.2');\n   * // => 3\n   */\n  function toInteger(value) {\n    var result = toFinite(value),\n        remainder = result % 1;\n\n    return result === result ? (remainder ? result - remainder : result) : 0;\n  }\n\n  /**\n   * Converts `value` to a number.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to process.\n   * @returns {number} Returns the number.\n   * @example\n   *\n   * _.toNumber(3.2);\n   * // => 3.2\n   *\n   * _.toNumber(Number.MIN_VALUE);\n   * // => 5e-324\n   *\n   * _.toNumber(Infinity);\n   * // => Infinity\n   *\n   * _.toNumber('3.2');\n   * // => 3.2\n   */\n  function toNumber(value) {\n    if (typeof value == 'number') {\n      return value;\n    }\n    if (isSymbol(value)) {\n      return NAN;\n    }\n    if (isObject(value)) {\n      var other = typeof value.valueOf == 'function' ? value.valueOf() : value;\n      value = isObject(other) ? (other + '') : other;\n    }\n    if (typeof value != 'string') {\n      return value === 0 ? value : +value;\n    }\n    value = value.replace(reTrim, '');\n    var isBinary = reIsBinary.test(value);\n    return (isBinary || reIsOctal.test(value))\n        ? freeParseInt(value.slice(2), isBinary ? 2 : 8)\n        : (reIsBadHex.test(value) ? NAN : +value);\n  }\n\n  /**\n   * Converts `value` to a plain object flattening inherited enumerable string\n   * keyed properties of `value` to own properties of the plain object.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Lang\n   * @param {*} value The value to convert.\n   * @returns {Object} Returns the converted plain object.\n   * @example\n   *\n   * function Foo() {\n   *   this.b = 2;\n   * }\n   *\n   * Foo.prototype.c = 3;\n   *\n   * _.assign({ 'a': 1 }, new Foo);\n   * // => { 'a': 1, 'b': 2 }\n   *\n   * _.assign({ 'a': 1 }, _.toPlainObject(new Foo));\n   * // => { 'a': 1, 'b': 2, 'c': 3 }\n   */\n  function toPlainObject(value) {\n    return copyObject(value, keysIn(value));\n  }\n\n  /**\n   * Converts `value` to a string. An empty string is returned for `null`\n   * and `undefined` values. The sign of `-0` is preserved.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Lang\n   * @param {*} value The value to convert.\n   * @returns {string} Returns the converted string.\n   * @example\n   *\n   * _.toString(null);\n   * // => ''\n   *\n   * _.toString(-0);\n   * // => '-0'\n   *\n   * _.toString([1, 2, 3]);\n   * // => '1,2,3'\n   */\n  function toString(value) {\n    return value == null ? '' : baseToString(value);\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * This method is like `_.assign` except that it iterates over own and\n   * inherited source properties.\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @alias extend\n   * @category Object\n   * @param {Object} object The destination object.\n   * @param {...Object} [sources] The source objects.\n   * @returns {Object} Returns `object`.\n   * @see _.assign\n   * @example\n   *\n   * function Foo() {\n   *   this.a = 1;\n   * }\n   *\n   * function Bar() {\n   *   this.c = 3;\n   * }\n   *\n   * Foo.prototype.b = 2;\n   * Bar.prototype.d = 4;\n   *\n   * _.assignIn({ 'a': 0 }, new Foo, new Bar);\n   * // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 }\n   */\n  var assignIn = createAssigner(function(object, source) {\n    copyObject(source, keysIn(source), object);\n  });\n\n  /**\n   * Creates an object that inherits from the `prototype` object. If a\n   * `properties` object is given, its own enumerable string keyed properties\n   * are assigned to the created object.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.3.0\n   * @category Object\n   * @param {Object} prototype The object to inherit from.\n   * @param {Object} [properties] The properties to assign to the object.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * function Shape() {\n   *   this.x = 0;\n   *   this.y = 0;\n   * }\n   *\n   * function Circle() {\n   *   Shape.call(this);\n   * }\n   *\n   * Circle.prototype = _.create(Shape.prototype, {\n   *   'constructor': Circle\n   * });\n   *\n   * var circle = new Circle;\n   * circle instanceof Circle;\n   * // => true\n   *\n   * circle instanceof Shape;\n   * // => true\n   */\n  function create(prototype, properties) {\n    var result = baseCreate(prototype);\n    return properties == null ? result : baseAssign(result, properties);\n  }\n\n  /**\n   * Assigns own and inherited enumerable string keyed properties of source\n   * objects to the destination object for all destination properties that\n   * resolve to `undefined`. Source objects are applied from left to right.\n   * Once a property is set, additional values of the same property are ignored.\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The destination object.\n   * @param {...Object} [sources] The source objects.\n   * @returns {Object} Returns `object`.\n   * @see _.defaultsDeep\n   * @example\n   *\n   * _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 });\n   * // => { 'a': 1, 'b': 2 }\n   */\n  var defaults = baseRest(function(object, sources) {\n    object = Object(object);\n\n    var index = -1;\n    var length = sources.length;\n    var guard = length > 2 ? sources[2] : undefined;\n\n    if (guard && isIterateeCall(sources[0], sources[1], guard)) {\n      length = 1;\n    }\n\n    while (++index < length) {\n      var source = sources[index];\n      var props = keysIn(source);\n      var propsIndex = -1;\n      var propsLength = props.length;\n\n      while (++propsIndex < propsLength) {\n        var key = props[propsIndex];\n        var value = object[key];\n\n        if (value === undefined ||\n            (eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) {\n          object[key] = source[key];\n        }\n      }\n    }\n\n    return object;\n  });\n\n  /**\n   * This method is like `_.defaults` except that it recursively assigns\n   * default properties.\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.10.0\n   * @category Object\n   * @param {Object} object The destination object.\n   * @param {...Object} [sources] The source objects.\n   * @returns {Object} Returns `object`.\n   * @see _.defaults\n   * @example\n   *\n   * _.defaultsDeep({ 'a': { 'b': 2 } }, { 'a': { 'b': 1, 'c': 3 } });\n   * // => { 'a': { 'b': 2, 'c': 3 } }\n   */\n  var defaultsDeep = baseRest(function(args) {\n    args.push(undefined, customDefaultsMerge);\n    return apply(mergeWith, undefined, args);\n  });\n\n  /**\n   * This method is like `_.find` except that it returns the key of the first\n   * element `predicate` returns truthy for instead of the element itself.\n   *\n   * @static\n   * @memberOf _\n   * @since 1.1.0\n   * @category Object\n   * @param {Object} object The object to inspect.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @returns {string|undefined} Returns the key of the matched element,\n   *  else `undefined`.\n   * @example\n   *\n   * var users = {\n   *   'barney':  { 'age': 36, 'active': true },\n   *   'fred':    { 'age': 40, 'active': false },\n   *   'pebbles': { 'age': 1,  'active': true }\n   * };\n   *\n   * _.findKey(users, function(o) { return o.age < 40; });\n   * // => 'barney' (iteration order is not guaranteed)\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.findKey(users, { 'age': 1, 'active': true });\n   * // => 'pebbles'\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.findKey(users, ['active', false]);\n   * // => 'fred'\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.findKey(users, 'active');\n   * // => 'barney'\n   */\n  function findKey(object, predicate) {\n    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn);\n  }\n\n  /**\n   * This method is like `_.findKey` except that it iterates over elements of\n   * a collection in the opposite order.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.0.0\n   * @category Object\n   * @param {Object} object The object to inspect.\n   * @param {Function} [predicate=_.identity] The function invoked per iteration.\n   * @returns {string|undefined} Returns the key of the matched element,\n   *  else `undefined`.\n   * @example\n   *\n   * var users = {\n   *   'barney':  { 'age': 36, 'active': true },\n   *   'fred':    { 'age': 40, 'active': false },\n   *   'pebbles': { 'age': 1,  'active': true }\n   * };\n   *\n   * _.findLastKey(users, function(o) { return o.age < 40; });\n   * // => returns 'pebbles' assuming `_.findKey` returns 'barney'\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.findLastKey(users, { 'age': 36, 'active': true });\n   * // => 'barney'\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.findLastKey(users, ['active', false]);\n   * // => 'fred'\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.findLastKey(users, 'active');\n   * // => 'pebbles'\n   */\n  function findLastKey(object, predicate) {\n    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight);\n  }\n\n  /**\n   * Gets the value at `path` of `object`. If the resolved value is\n   * `undefined`, the `defaultValue` is returned in its place.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.7.0\n   * @category Object\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path of the property to get.\n   * @param {*} [defaultValue] The value returned for `undefined` resolved values.\n   * @returns {*} Returns the resolved value.\n   * @example\n   *\n   * var object = { 'a': [{ 'b': { 'c': 3 } }] };\n   *\n   * _.get(object, 'a[0].b.c');\n   * // => 3\n   *\n   * _.get(object, ['a', '0', 'b', 'c']);\n   * // => 3\n   *\n   * _.get(object, 'a.b.c', 'default');\n   * // => 'default'\n   */\n  function get(object, path, defaultValue) {\n    var result = object == null ? undefined : baseGet(object, path);\n    return result === undefined ? defaultValue : result;\n  }\n\n  /**\n   * Checks if `path` is a direct property of `object`.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path to check.\n   * @returns {boolean} Returns `true` if `path` exists, else `false`.\n   * @example\n   *\n   * var object = { 'a': { 'b': 2 } };\n   * var other = _.create({ 'a': _.create({ 'b': 2 }) });\n   *\n   * _.has(object, 'a');\n   * // => true\n   *\n   * _.has(object, 'a.b');\n   * // => true\n   *\n   * _.has(object, ['a', 'b']);\n   * // => true\n   *\n   * _.has(other, 'a');\n   * // => false\n   */\n  function has(object, path) {\n    return object != null && hasPath(object, path, baseHas);\n  }\n\n  /**\n   * Checks if `path` is a direct or inherited property of `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Object\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path to check.\n   * @returns {boolean} Returns `true` if `path` exists, else `false`.\n   * @example\n   *\n   * var object = _.create({ 'a': _.create({ 'b': 2 }) });\n   *\n   * _.hasIn(object, 'a');\n   * // => true\n   *\n   * _.hasIn(object, 'a.b');\n   * // => true\n   *\n   * _.hasIn(object, ['a', 'b']);\n   * // => true\n   *\n   * _.hasIn(object, 'b');\n   * // => false\n   */\n  function hasIn(object, path) {\n    return object != null && hasPath(object, path, baseHasIn);\n  }\n\n  /**\n   * Creates an object composed of the inverted keys and values of `object`.\n   * If `object` contains duplicate values, subsequent values overwrite\n   * property assignments of previous values.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.7.0\n   * @category Object\n   * @param {Object} object The object to invert.\n   * @returns {Object} Returns the new inverted object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': 2, 'c': 1 };\n   *\n   * _.invert(object);\n   * // => { '1': 'c', '2': 'b' }\n   */\n  var invert = createInverter(function(result, value, key) {\n    if (value != null &&\n        typeof value.toString != 'function') {\n      value = nativeObjectToString.call(value);\n    }\n\n    result[value] = key;\n  }, constant(identity));\n\n  /**\n   * This method is like `_.invert` except that the inverted object is generated\n   * from the results of running each element of `object` thru `iteratee`. The\n   * corresponding inverted value of each inverted key is an array of keys\n   * responsible for generating the inverted value. The iteratee is invoked\n   * with one argument: (value).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.1.0\n   * @category Object\n   * @param {Object} object The object to invert.\n   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.\n   * @returns {Object} Returns the new inverted object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': 2, 'c': 1 };\n   *\n   * _.invertBy(object);\n   * // => { '1': ['a', 'c'], '2': ['b'] }\n   *\n   * _.invertBy(object, function(value) {\n   *   return 'group' + value;\n   * });\n   * // => { 'group1': ['a', 'c'], 'group2': ['b'] }\n   */\n  var invertBy = createInverter(function(result, value, key) {\n    if (value != null &&\n        typeof value.toString != 'function') {\n      value = nativeObjectToString.call(value);\n    }\n\n    if (hasOwnProperty.call(result, value)) {\n      result[value].push(key);\n    } else {\n      result[value] = [key];\n    }\n  }, baseIteratee);\n\n  /**\n   * Creates an array of the own enumerable property names of `object`.\n   *\n   * **Note:** Non-object values are coerced to objects. See the\n   * [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)\n   * for more details.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names.\n   * @example\n   *\n   * function Foo() {\n   *   this.a = 1;\n   *   this.b = 2;\n   * }\n   *\n   * Foo.prototype.c = 3;\n   *\n   * _.keys(new Foo);\n   * // => ['a', 'b'] (iteration order is not guaranteed)\n   *\n   * _.keys('hi');\n   * // => ['0', '1']\n   */\n  function keys(object) {\n    return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object);\n  }\n\n  /**\n   * Creates an array of the own and inherited enumerable property names of `object`.\n   *\n   * **Note:** Non-object values are coerced to objects.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Object\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property names.\n   * @example\n   *\n   * function Foo() {\n   *   this.a = 1;\n   *   this.b = 2;\n   * }\n   *\n   * Foo.prototype.c = 3;\n   *\n   * _.keysIn(new Foo);\n   * // => ['a', 'b', 'c'] (iteration order is not guaranteed)\n   */\n  function keysIn(object) {\n    return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object);\n  }\n\n  /**\n   * This method is like `_.assign` except that it recursively merges own and\n   * inherited enumerable string keyed properties of source objects into the\n   * destination object. Source properties that resolve to `undefined` are\n   * skipped if a destination value exists. Array and plain object properties\n   * are merged recursively. Other objects and value types are overridden by\n   * assignment. Source objects are applied from left to right. Subsequent\n   * sources overwrite property assignments of previous sources.\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.5.0\n   * @category Object\n   * @param {Object} object The destination object.\n   * @param {...Object} [sources] The source objects.\n   * @returns {Object} Returns `object`.\n   * @example\n   *\n   * var object = {\n   *   'a': [{ 'b': 2 }, { 'd': 4 }]\n   * };\n   *\n   * var other = {\n   *   'a': [{ 'c': 3 }, { 'e': 5 }]\n   * };\n   *\n   * _.merge(object, other);\n   * // => { 'a': [{ 'b': 2, 'c': 3 }, { 'd': 4, 'e': 5 }] }\n   */\n  var merge = createAssigner(function(object, source, srcIndex) {\n    baseMerge(object, source, srcIndex);\n  });\n\n  /**\n   * This method is like `_.merge` except that it accepts `customizer` which\n   * is invoked to produce the merged values of the destination and source\n   * properties. If `customizer` returns `undefined`, merging is handled by the\n   * method instead. The `customizer` is invoked with six arguments:\n   * (objValue, srcValue, key, object, source, stack).\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Object\n   * @param {Object} object The destination object.\n   * @param {...Object} sources The source objects.\n   * @param {Function} customizer The function to customize assigned values.\n   * @returns {Object} Returns `object`.\n   * @example\n   *\n   * function customizer(objValue, srcValue) {\n   *   if (_.isArray(objValue)) {\n   *     return objValue.concat(srcValue);\n   *   }\n   * }\n   *\n   * var object = { 'a': [1], 'b': [2] };\n   * var other = { 'a': [3], 'b': [4] };\n   *\n   * _.mergeWith(object, other, customizer);\n   * // => { 'a': [1, 3], 'b': [2, 4] }\n   */\n  var mergeWith = createAssigner(function(object, source, srcIndex, customizer) {\n    baseMerge(object, source, srcIndex, customizer);\n  });\n\n  /**\n   * The opposite of `_.pick`; this method creates an object composed of the\n   * own and inherited enumerable property paths of `object` that are not omitted.\n   *\n   * **Note:** This method is considerably slower than `_.pick`.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The source object.\n   * @param {...(string|string[])} [paths] The property paths to omit.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': '2', 'c': 3 };\n   *\n   * _.omit(object, ['a', 'c']);\n   * // => { 'b': '2' }\n   */\n  var omit = flatRest(function(object, paths) {\n    var result = {};\n    if (object == null) {\n      return result;\n    }\n    var isDeep = false;\n    paths = arrayMap(paths, function(path) {\n      path = castPath(path, object);\n      isDeep || (isDeep = path.length > 1);\n      return path;\n    });\n    copyObject(object, getAllKeysIn(object), result);\n    if (isDeep) {\n      result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone);\n    }\n    var length = paths.length;\n    while (length--) {\n      baseUnset(result, paths[length]);\n    }\n    return result;\n  });\n\n  /**\n   * The opposite of `_.pickBy`; this method creates an object composed of\n   * the own and inherited enumerable string keyed properties of `object` that\n   * `predicate` doesn't return truthy for. The predicate is invoked with two\n   * arguments: (value, key).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Object\n   * @param {Object} object The source object.\n   * @param {Function} [predicate=_.identity] The function invoked per property.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': '2', 'c': 3 };\n   *\n   * _.omitBy(object, _.isNumber);\n   * // => { 'b': '2' }\n   */\n  function omitBy(object, predicate) {\n    return pickBy(object, negate(baseIteratee(predicate)));\n  }\n\n  /**\n   * Creates an object composed of the picked `object` properties.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The source object.\n   * @param {...(string|string[])} [paths] The property paths to pick.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': '2', 'c': 3 };\n   *\n   * _.pick(object, ['a', 'c']);\n   * // => { 'a': 1, 'c': 3 }\n   */\n  var pick = flatRest(function(object, paths) {\n    return object == null ? {} : basePick(object, paths);\n  });\n\n  /**\n   * Creates an object composed of the `object` properties `predicate` returns\n   * truthy for. The predicate is invoked with two arguments: (value, key).\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Object\n   * @param {Object} object The source object.\n   * @param {Function} [predicate=_.identity] The function invoked per property.\n   * @returns {Object} Returns the new object.\n   * @example\n   *\n   * var object = { 'a': 1, 'b': '2', 'c': 3 };\n   *\n   * _.pickBy(object, _.isNumber);\n   * // => { 'a': 1, 'c': 3 }\n   */\n  function pickBy(object, predicate) {\n    if (object == null) {\n      return {};\n    }\n    var props = arrayMap(getAllKeysIn(object), function(prop) {\n      return [prop];\n    });\n    predicate = baseIteratee(predicate);\n    return basePickBy(object, props, function(value, path) {\n      return predicate(value, path[0]);\n    });\n  }\n\n  /**\n   * This method is like `_.get` except that if the resolved value is a\n   * function it's invoked with the `this` binding of its parent object and\n   * its result is returned.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The object to query.\n   * @param {Array|string} path The path of the property to resolve.\n   * @param {*} [defaultValue] The value returned for `undefined` resolved values.\n   * @returns {*} Returns the resolved value.\n   * @example\n   *\n   * var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] };\n   *\n   * _.result(object, 'a[0].b.c1');\n   * // => 3\n   *\n   * _.result(object, 'a[0].b.c2');\n   * // => 4\n   *\n   * _.result(object, 'a[0].b.c3', 'default');\n   * // => 'default'\n   *\n   * _.result(object, 'a[0].b.c3', _.constant('default'));\n   * // => 'default'\n   */\n  function result(object, path, defaultValue) {\n    path = castPath(path, object);\n\n    var index = -1,\n        length = path.length;\n\n    // Ensure the loop is entered when path is empty.\n    if (!length) {\n      length = 1;\n      object = undefined;\n    }\n    while (++index < length) {\n      var value = object == null ? undefined : object[toKey(path[index])];\n      if (value === undefined) {\n        index = length;\n        value = defaultValue;\n      }\n      object = isFunction(value) ? value.call(object) : value;\n    }\n    return object;\n  }\n\n  /**\n   * Sets the value at `path` of `object`. If a portion of `path` doesn't exist,\n   * it's created. Arrays are created for missing index properties while objects\n   * are created for all other missing properties. Use `_.setWith` to customize\n   * `path` creation.\n   *\n   * **Note:** This method mutates `object`.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.7.0\n   * @category Object\n   * @param {Object} object The object to modify.\n   * @param {Array|string} path The path of the property to set.\n   * @param {*} value The value to set.\n   * @returns {Object} Returns `object`.\n   * @example\n   *\n   * var object = { 'a': [{ 'b': { 'c': 3 } }] };\n   *\n   * _.set(object, 'a[0].b.c', 4);\n   * console.log(object.a[0].b.c);\n   * // => 4\n   *\n   * _.set(object, ['x', '0', 'y', 'z'], 5);\n   * console.log(object.x[0].y.z);\n   * // => 5\n   */\n  function set(object, path, value) {\n    return object == null ? object : baseSet(object, path, value);\n  }\n\n  /**\n   * Creates an array of the own enumerable string keyed property values of `object`.\n   *\n   * **Note:** Non-object values are coerced to objects.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Object\n   * @param {Object} object The object to query.\n   * @returns {Array} Returns the array of property values.\n   * @example\n   *\n   * function Foo() {\n   *   this.a = 1;\n   *   this.b = 2;\n   * }\n   *\n   * Foo.prototype.c = 3;\n   *\n   * _.values(new Foo);\n   * // => [1, 2] (iteration order is not guaranteed)\n   *\n   * _.values('hi');\n   * // => ['h', 'i']\n   */\n  function values(object) {\n    return object == null ? [] : baseValues(object, keys(object));\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Clamps `number` within the inclusive `lower` and `upper` bounds.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.0.0\n   * @category Number\n   * @param {number} number The number to clamp.\n   * @param {number} [lower] The lower bound.\n   * @param {number} upper The upper bound.\n   * @returns {number} Returns the clamped number.\n   * @example\n   *\n   * _.clamp(-10, -5, 5);\n   * // => -5\n   *\n   * _.clamp(10, -5, 5);\n   * // => 5\n   */\n  function clamp(number, lower, upper) {\n    if (upper === undefined) {\n      upper = lower;\n      lower = undefined;\n    }\n    if (upper !== undefined) {\n      upper = toNumber(upper);\n      upper = upper === upper ? upper : 0;\n    }\n    if (lower !== undefined) {\n      lower = toNumber(lower);\n      lower = lower === lower ? lower : 0;\n    }\n    return baseClamp(toNumber(number), lower, upper);\n  }\n\n  /**\n   * Produces a random number between the inclusive `lower` and `upper` bounds.\n   * If only one argument is provided a number between `0` and the given number\n   * is returned. If `floating` is `true`, or either `lower` or `upper` are\n   * floats, a floating-point number is returned instead of an integer.\n   *\n   * **Note:** JavaScript follows the IEEE-754 standard for resolving\n   * floating-point values which can produce unexpected results.\n   *\n   * @static\n   * @memberOf _\n   * @since 0.7.0\n   * @category Number\n   * @param {number} [lower=0] The lower bound.\n   * @param {number} [upper=1] The upper bound.\n   * @param {boolean} [floating] Specify returning a floating-point number.\n   * @returns {number} Returns the random number.\n   * @example\n   *\n   * _.random(0, 5);\n   * // => an integer between 0 and 5\n   *\n   * _.random(5);\n   * // => also an integer between 0 and 5\n   *\n   * _.random(5, true);\n   * // => a floating-point number between 0 and 5\n   *\n   * _.random(1.2, 5.2);\n   * // => a floating-point number between 1.2 and 5.2\n   */\n  function random(lower, upper, floating) {\n    if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) {\n      upper = floating = undefined;\n    }\n    if (floating === undefined) {\n      if (typeof upper == 'boolean') {\n        floating = upper;\n        upper = undefined;\n      }\n      else if (typeof lower == 'boolean') {\n        floating = lower;\n        lower = undefined;\n      }\n    }\n    if (lower === undefined && upper === undefined) {\n      lower = 0;\n      upper = 1;\n    }\n    else {\n      lower = toFinite(lower);\n      if (upper === undefined) {\n        upper = lower;\n        lower = 0;\n      } else {\n        upper = toFinite(upper);\n      }\n    }\n    if (lower > upper) {\n      var temp = lower;\n      lower = upper;\n      upper = temp;\n    }\n    if (floating || lower % 1 || upper % 1) {\n      var rand = nativeRandom();\n      return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper);\n    }\n    return baseRandom(lower, upper);\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Converts the characters \"&\", \"<\", \">\", '\"', and \"'\" in `string` to their\n   * corresponding HTML entities.\n   *\n   * **Note:** No other characters are escaped. To escape additional\n   * characters use a third-party library like [_he_](https://mths.be/he).\n   *\n   * Though the \">\" character is escaped for symmetry, characters like\n   * \">\" and \"/\" don't need escaping in HTML and have no special meaning\n   * unless they're part of a tag or unquoted attribute value. See\n   * [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands)\n   * (under \"semi-related fun fact\") for more details.\n   *\n   * When working with HTML you should always\n   * [quote attribute values](http://wonko.com/post/html-escaping) to reduce\n   * XSS vectors.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category String\n   * @param {string} [string=''] The string to escape.\n   * @returns {string} Returns the escaped string.\n   * @example\n   *\n   * _.escape('fred, barney, & pebbles');\n   * // => 'fred, barney, &amp; pebbles'\n   */\n  function escape(string) {\n    string = toString(string);\n    return (string && reHasUnescapedHtml.test(string))\n        ? string.replace(reUnescapedHtml, escapeHtmlChar)\n        : string;\n  }\n\n  /**\n   * Removes leading and trailing whitespace or specified characters from `string`.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category String\n   * @param {string} [string=''] The string to trim.\n   * @param {string} [chars=whitespace] The characters to trim.\n   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.\n   * @returns {string} Returns the trimmed string.\n   * @example\n   *\n   * _.trim('  abc  ');\n   * // => 'abc'\n   *\n   * _.trim('-_-abc-_-', '_-');\n   * // => 'abc'\n   *\n   * _.map(['  foo  ', '  bar  '], _.trim);\n   * // => ['foo', 'bar']\n   */\n  function trim(string, chars, guard) {\n    string = toString(string);\n    if (string && (guard || chars === undefined)) {\n      return string.replace(reTrim, '');\n    }\n    if (!string || !(chars = baseToString(chars))) {\n      return string;\n    }\n    var strSymbols = stringToArray(string),\n        chrSymbols = stringToArray(chars),\n        start = charsStartIndex(strSymbols, chrSymbols),\n        end = charsEndIndex(strSymbols, chrSymbols) + 1;\n\n    return castSlice(strSymbols, start, end).join('');\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Creates a function that returns `value`.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.4.0\n   * @category Util\n   * @param {*} value The value to return from the new function.\n   * @returns {Function} Returns the new constant function.\n   * @example\n   *\n   * var objects = _.times(2, _.constant({ 'a': 1 }));\n   *\n   * console.log(objects);\n   * // => [{ 'a': 1 }, { 'a': 1 }]\n   *\n   * console.log(objects[0] === objects[1]);\n   * // => true\n   */\n  function constant(value) {\n    return function() {\n      return value;\n    };\n  }\n\n  /**\n   * This method returns the first argument it receives.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Util\n   * @param {*} value Any value.\n   * @returns {*} Returns `value`.\n   * @example\n   *\n   * var object = { 'a': 1 };\n   *\n   * console.log(_.identity(object) === object);\n   * // => true\n   */\n  function identity(value) {\n    return value;\n  }\n\n  /**\n   * Creates a function that invokes `func` with the arguments of the created\n   * function. If `func` is a property name, the created function returns the\n   * property value for a given element. If `func` is an array or object, the\n   * created function returns `true` for elements that contain the equivalent\n   * source properties, otherwise it returns `false`.\n   *\n   * @static\n   * @since 4.0.0\n   * @memberOf _\n   * @category Util\n   * @param {*} [func=_.identity] The value to convert to a callback.\n   * @returns {Function} Returns the callback.\n   * @example\n   *\n   * var users = [\n   *   { 'user': 'barney', 'age': 36, 'active': true },\n   *   { 'user': 'fred',   'age': 40, 'active': false }\n   * ];\n   *\n   * // The `_.matches` iteratee shorthand.\n   * _.filter(users, _.iteratee({ 'user': 'barney', 'active': true }));\n   * // => [{ 'user': 'barney', 'age': 36, 'active': true }]\n   *\n   * // The `_.matchesProperty` iteratee shorthand.\n   * _.filter(users, _.iteratee(['user', 'fred']));\n   * // => [{ 'user': 'fred', 'age': 40 }]\n   *\n   * // The `_.property` iteratee shorthand.\n   * _.map(users, _.iteratee('user'));\n   * // => ['barney', 'fred']\n   *\n   * // Create custom iteratee shorthands.\n   * _.iteratee = _.wrap(_.iteratee, function(iteratee, func) {\n   *   return !_.isRegExp(func) ? iteratee(func) : function(string) {\n   *     return func.test(string);\n   *   };\n   * });\n   *\n   * _.filter(['abc', 'def'], /ef/);\n   * // => ['def']\n   */\n  function iteratee(func) {\n    return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG));\n  }\n\n  /**\n   * Creates a function that performs a partial deep comparison between a given\n   * object and `source`, returning `true` if the given object has equivalent\n   * property values, else `false`.\n   *\n   * **Note:** The created function is equivalent to `_.isMatch` with `source`\n   * partially applied.\n   *\n   * Partial comparisons will match empty array and empty object `source`\n   * values against any array or object value, respectively. See `_.isEqual`\n   * for a list of supported value comparisons.\n   *\n   * @static\n   * @memberOf _\n   * @since 3.0.0\n   * @category Util\n   * @param {Object} source The object of property values to match.\n   * @returns {Function} Returns the new spec function.\n   * @example\n   *\n   * var objects = [\n   *   { 'a': 1, 'b': 2, 'c': 3 },\n   *   { 'a': 4, 'b': 5, 'c': 6 }\n   * ];\n   *\n   * _.filter(objects, _.matches({ 'a': 4, 'c': 6 }));\n   * // => [{ 'a': 4, 'b': 5, 'c': 6 }]\n   */\n  function matches(source) {\n    return baseMatches(baseClone(source, CLONE_DEEP_FLAG));\n  }\n\n  /**\n   * Adds all own enumerable string keyed function properties of a source\n   * object to the destination object. If `object` is a function, then methods\n   * are added to its prototype as well.\n   *\n   * **Note:** Use `_.runInContext` to create a pristine `lodash` function to\n   * avoid conflicts caused by modifying the original.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Util\n   * @param {Function|Object} [object=lodash] The destination object.\n   * @param {Object} source The object of functions to add.\n   * @param {Object} [options={}] The options object.\n   * @param {boolean} [options.chain=true] Specify whether mixins are chainable.\n   * @returns {Function|Object} Returns `object`.\n   * @example\n   *\n   * function vowels(string) {\n   *   return _.filter(string, function(v) {\n   *     return /[aeiou]/i.test(v);\n   *   });\n   * }\n   *\n   * _.mixin({ 'vowels': vowels });\n   * _.vowels('fred');\n   * // => ['e']\n   *\n   * _('fred').vowels().value();\n   * // => ['e']\n   *\n   * _.mixin({ 'vowels': vowels }, { 'chain': false });\n   * _('fred').vowels();\n   * // => ['e']\n   */\n  function mixin(object, source, options) {\n    var props = keys(source),\n        methodNames = baseFunctions(source, props);\n\n    if (options == null &&\n        !(isObject(source) && (methodNames.length || !props.length))) {\n      options = source;\n      source = object;\n      object = this;\n      methodNames = baseFunctions(source, keys(source));\n    }\n    var chain = !(isObject(options) && 'chain' in options) || !!options.chain,\n        isFunc = isFunction(object);\n\n    arrayEach(methodNames, function(methodName) {\n      var func = source[methodName];\n      object[methodName] = func;\n      if (isFunc) {\n        object.prototype[methodName] = function() {\n          var chainAll = this.__chain__;\n          if (chain || chainAll) {\n            var result = object(this.__wrapped__),\n                actions = result.__actions__ = copyArray(this.__actions__);\n\n            actions.push({ 'func': func, 'args': arguments, 'thisArg': object });\n            result.__chain__ = chainAll;\n            return result;\n          }\n          return func.apply(object, arrayPush([this.value()], arguments));\n        };\n      }\n    });\n\n    return object;\n  }\n\n  /**\n   * Reverts the `_` variable to its previous value and returns a reference to\n   * the `lodash` function.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Util\n   * @returns {Function} Returns the `lodash` function.\n   * @example\n   *\n   * var lodash = _.noConflict();\n   */\n  function noConflict() {\n    if (root._ === this) {\n      root._ = oldDash;\n    }\n    return this;\n  }\n\n  /**\n   * This method returns `undefined`.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.3.0\n   * @category Util\n   * @example\n   *\n   * _.times(2, _.noop);\n   * // => [undefined, undefined]\n   */\n  function noop() {\n    // No operation performed.\n  }\n\n  /**\n   * Creates a function that returns the value at `path` of a given object.\n   *\n   * @static\n   * @memberOf _\n   * @since 2.4.0\n   * @category Util\n   * @param {Array|string} path The path of the property to get.\n   * @returns {Function} Returns the new accessor function.\n   * @example\n   *\n   * var objects = [\n   *   { 'a': { 'b': 2 } },\n   *   { 'a': { 'b': 1 } }\n   * ];\n   *\n   * _.map(objects, _.property('a.b'));\n   * // => [2, 1]\n   *\n   * _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b');\n   * // => [1, 2]\n   */\n  function property(path) {\n    return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path);\n  }\n\n  /**\n   * Creates an array of numbers (positive and/or negative) progressing from\n   * `start` up to, but not including, `end`. A step of `-1` is used if a negative\n   * `start` is specified without an `end` or `step`. If `end` is not specified,\n   * it's set to `start` with `start` then set to `0`.\n   *\n   * **Note:** JavaScript follows the IEEE-754 standard for resolving\n   * floating-point values which can produce unexpected results.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Util\n   * @param {number} [start=0] The start of the range.\n   * @param {number} end The end of the range.\n   * @param {number} [step=1] The value to increment or decrement by.\n   * @returns {Array} Returns the range of numbers.\n   * @see _.inRange, _.rangeRight\n   * @example\n   *\n   * _.range(4);\n   * // => [0, 1, 2, 3]\n   *\n   * _.range(-4);\n   * // => [0, -1, -2, -3]\n   *\n   * _.range(1, 5);\n   * // => [1, 2, 3, 4]\n   *\n   * _.range(0, 20, 5);\n   * // => [0, 5, 10, 15]\n   *\n   * _.range(0, -4, -1);\n   * // => [0, -1, -2, -3]\n   *\n   * _.range(1, 4, 0);\n   * // => [1, 1, 1]\n   *\n   * _.range(0);\n   * // => []\n   */\n  var range = createRange();\n\n  /**\n   * This method returns a new empty array.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.13.0\n   * @category Util\n   * @returns {Array} Returns the new empty array.\n   * @example\n   *\n   * var arrays = _.times(2, _.stubArray);\n   *\n   * console.log(arrays);\n   * // => [[], []]\n   *\n   * console.log(arrays[0] === arrays[1]);\n   * // => false\n   */\n  function stubArray() {\n    return [];\n  }\n\n  /**\n   * This method returns `false`.\n   *\n   * @static\n   * @memberOf _\n   * @since 4.13.0\n   * @category Util\n   * @returns {boolean} Returns `false`.\n   * @example\n   *\n   * _.times(2, _.stubFalse);\n   * // => [false, false]\n   */\n  function stubFalse() {\n    return false;\n  }\n\n  /**\n   * Generates a unique ID. If `prefix` is given, the ID is appended to it.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Util\n   * @param {string} [prefix=''] The value to prefix the ID with.\n   * @returns {string} Returns the unique ID.\n   * @example\n   *\n   * _.uniqueId('contact_');\n   * // => 'contact_104'\n   *\n   * _.uniqueId();\n   * // => '105'\n   */\n  function uniqueId(prefix) {\n    var id = ++idCounter;\n    return toString(prefix) + id;\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * Computes the maximum value of `array`. If `array` is empty or falsey,\n   * `undefined` is returned.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Math\n   * @param {Array} array The array to iterate over.\n   * @returns {*} Returns the maximum value.\n   * @example\n   *\n   * _.max([4, 2, 8, 6]);\n   * // => 8\n   *\n   * _.max([]);\n   * // => undefined\n   */\n  function max(array) {\n    return (array && array.length)\n        ? baseExtremum(array, identity, baseGt)\n        : undefined;\n  }\n\n  /**\n   * Computes the minimum value of `array`. If `array` is empty or falsey,\n   * `undefined` is returned.\n   *\n   * @static\n   * @since 0.1.0\n   * @memberOf _\n   * @category Math\n   * @param {Array} array The array to iterate over.\n   * @returns {*} Returns the minimum value.\n   * @example\n   *\n   * _.min([4, 2, 8, 6]);\n   * // => 2\n   *\n   * _.min([]);\n   * // => undefined\n   */\n  function min(array) {\n    return (array && array.length)\n        ? baseExtremum(array, identity, baseLt)\n        : undefined;\n  }\n\n  /*------------------------------------------------------------------------*/\n\n  // Add methods that return wrapped values in chain sequences.\n  lodash.after = after;\n  lodash.assignIn = assignIn;\n  lodash.before = before;\n  lodash.bind = bind;\n  lodash.chain = chain;\n  lodash.compact = compact;\n  lodash.concat = concat;\n  lodash.countBy = countBy;\n  lodash.create = create;\n  lodash.debounce = debounce;\n  lodash.defaults = defaults;\n  lodash.defaultsDeep = defaultsDeep;\n  lodash.defer = defer;\n  lodash.delay = delay;\n  lodash.difference = difference;\n  lodash.drop = drop;\n  lodash.filter = filter;\n  lodash.flatten = flatten;\n  lodash.flattenDeep = flattenDeep;\n  lodash.groupBy = groupBy;\n  lodash.initial = initial;\n  lodash.intersection = intersection;\n  lodash.invert = invert;\n  lodash.invertBy = invertBy;\n  lodash.iteratee = iteratee;\n  lodash.keys = keys;\n  lodash.map = map;\n  lodash.matches = matches;\n  lodash.merge = merge;\n  lodash.mixin = mixin;\n  lodash.negate = negate;\n  lodash.omit = omit;\n  lodash.omitBy = omitBy;\n  lodash.once = once;\n  lodash.pick = pick;\n  lodash.range = range;\n  lodash.reject = reject;\n  lodash.rest = rest;\n  lodash.set = set;\n  lodash.slice = slice;\n  lodash.sortBy = sortBy;\n  lodash.take = take;\n  lodash.takeRight = takeRight;\n  lodash.tap = tap;\n  lodash.throttle = throttle;\n  lodash.thru = thru;\n  lodash.toArray = toArray;\n  lodash.union = union;\n  lodash.uniq = uniq;\n  lodash.uniqBy = uniqBy;\n  lodash.unzip = unzip;\n  lodash.values = values;\n  lodash.without = without;\n  lodash.zip = zip;\n  lodash.zipObject = zipObject;\n\n  // Add aliases.\n  lodash.extend = assignIn;\n\n  // Add methods to `lodash.prototype`.\n  mixin(lodash, lodash);\n\n  /*------------------------------------------------------------------------*/\n\n  // Add methods that return unwrapped values in chain sequences.\n  lodash.clamp = clamp;\n  lodash.clone = clone;\n  lodash.cloneDeep = cloneDeep;\n  lodash.escape = escape;\n  lodash.every = every;\n  lodash.find = find;\n  lodash.findIndex = findIndex;\n  lodash.findKey = findKey;\n  lodash.findLastIndex = findLastIndex;\n  lodash.findLastKey = findLastKey;\n  lodash.forEach = forEach;\n  lodash.get = get;\n  lodash.has = has;\n  lodash.head = head;\n  lodash.identity = identity;\n  lodash.indexOf = indexOf;\n  lodash.isArguments = isArguments;\n  lodash.isArray = isArray;\n  lodash.isArrayLike = isArrayLike;\n  lodash.isBoolean = isBoolean;\n  lodash.isDate = isDate;\n  lodash.isEmpty = isEmpty;\n  lodash.isEqual = isEqual;\n  lodash.isFinite = isFinite;\n  lodash.isFunction = isFunction;\n  lodash.isNaN = isNaN;\n  lodash.isNull = isNull;\n  lodash.isNumber = isNumber;\n  lodash.isObject = isObject;\n  lodash.isPlainObject = isPlainObject;\n  lodash.isRegExp = isRegExp;\n  lodash.isString = isString;\n  lodash.isUndefined = isUndefined;\n  lodash.last = last;\n  lodash.max = max;\n  lodash.min = min;\n  lodash.noConflict = noConflict;\n  lodash.noop = noop;\n  lodash.random = random;\n  lodash.reduce = reduce;\n  lodash.result = result;\n  lodash.size = size;\n  lodash.some = some;\n  lodash.trim = trim;\n  lodash.uniqueId = uniqueId;\n\n  // Add aliases.\n  lodash.each = forEach;\n  lodash.first = head;\n\n  mixin(lodash, (function() {\n    var source = {};\n    baseForOwn(lodash, function(func, methodName) {\n      if (!hasOwnProperty.call(lodash.prototype, methodName)) {\n        source[methodName] = func;\n      }\n    });\n    return source;\n  }()), { 'chain': false });\n\n  /*------------------------------------------------------------------------*/\n\n  /**\n   * The semantic version number.\n   *\n   * @static\n   * @memberOf _\n   * @type {string}\n   */\n  lodash.VERSION = VERSION;\n\n  // Add `LazyWrapper` methods for `_.drop` and `_.take` variants.\n  arrayEach(['drop', 'take'], function(methodName, index) {\n    LazyWrapper.prototype[methodName] = function(n) {\n      n = n === undefined ? 1 : nativeMax(toInteger(n), 0);\n\n      var result = (this.__filtered__ && !index)\n          ? new LazyWrapper(this)\n          : this.clone();\n\n      if (result.__filtered__) {\n        result.__takeCount__ = nativeMin(n, result.__takeCount__);\n      } else {\n        result.__views__.push({\n          'size': nativeMin(n, MAX_ARRAY_LENGTH),\n          'type': methodName + (result.__dir__ < 0 ? 'Right' : '')\n        });\n      }\n      return result;\n    };\n\n    LazyWrapper.prototype[methodName + 'Right'] = function(n) {\n      return this.reverse()[methodName](n).reverse();\n    };\n  });\n\n  // Add `LazyWrapper` methods that accept an `iteratee` value.\n  arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) {\n    var type = index + 1,\n        isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG;\n\n    LazyWrapper.prototype[methodName] = function(iteratee) {\n      var result = this.clone();\n      result.__iteratees__.push({\n        'iteratee': getIteratee(iteratee, 3),\n        'type': type\n      });\n      result.__filtered__ = result.__filtered__ || isFilter;\n      return result;\n    };\n  });\n\n  // Add `LazyWrapper` methods for `_.head` and `_.last`.\n  arrayEach(['head', 'last'], function(methodName, index) {\n    var takeName = 'take' + (index ? 'Right' : '');\n\n    LazyWrapper.prototype[methodName] = function() {\n      return this[takeName](1).value()[0];\n    };\n  });\n\n  // Add `LazyWrapper` methods for `_.initial` and `_.tail`.\n  arrayEach(['initial', 'tail'], function(methodName, index) {\n    var dropName = 'drop' + (index ? '' : 'Right');\n\n    LazyWrapper.prototype[methodName] = function() {\n      return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1);\n    };\n  });\n\n  LazyWrapper.prototype.compact = function() {\n    return this.filter(identity);\n  };\n\n  LazyWrapper.prototype.find = function(predicate) {\n    return this.filter(predicate).head();\n  };\n\n  LazyWrapper.prototype.findLast = function(predicate) {\n    return this.reverse().find(predicate);\n  };\n\n  LazyWrapper.prototype.invokeMap = baseRest(function(path, args) {\n    if (typeof path == 'function') {\n      return new LazyWrapper(this);\n    }\n    return this.map(function(value) {\n      return baseInvoke(value, path, args);\n    });\n  });\n\n  LazyWrapper.prototype.reject = function(predicate) {\n    return this.filter(negate(getIteratee(predicate)));\n  };\n\n  LazyWrapper.prototype.slice = function(start, end) {\n    start = toInteger(start);\n\n    var result = this;\n    if (result.__filtered__ && (start > 0 || end < 0)) {\n      return new LazyWrapper(result);\n    }\n    if (start < 0) {\n      result = result.takeRight(-start);\n    } else if (start) {\n      result = result.drop(start);\n    }\n    if (end !== undefined) {\n      end = toInteger(end);\n      result = end < 0 ? result.dropRight(-end) : result.take(end - start);\n    }\n    return result;\n  };\n\n  LazyWrapper.prototype.takeRightWhile = function(predicate) {\n    return this.reverse().takeWhile(predicate).reverse();\n  };\n\n  LazyWrapper.prototype.toArray = function() {\n    return this.take(MAX_ARRAY_LENGTH);\n  };\n\n  // Add `LazyWrapper` methods to `lodash.prototype`.\n  baseForOwn(LazyWrapper.prototype, function(func, methodName) {\n    var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName),\n        isTaker = /^(?:head|last)$/.test(methodName),\n        lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName],\n        retUnwrapped = isTaker || /^find/.test(methodName);\n\n    if (!lodashFunc) {\n      return;\n    }\n    lodash.prototype[methodName] = function() {\n      var value = this.__wrapped__,\n          args = isTaker ? [1] : arguments,\n          isLazy = value instanceof LazyWrapper,\n          iteratee = args[0],\n          useLazy = isLazy || isArray(value);\n\n      var interceptor = function(value) {\n        var result = lodashFunc.apply(lodash, arrayPush([value], args));\n        return (isTaker && chainAll) ? result[0] : result;\n      };\n\n      if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) {\n        // Avoid lazy use if the iteratee has a \"length\" value other than `1`.\n        isLazy = useLazy = false;\n      }\n      var chainAll = this.__chain__,\n          isHybrid = !!this.__actions__.length,\n          isUnwrapped = retUnwrapped && !chainAll,\n          onlyLazy = isLazy && !isHybrid;\n\n      if (!retUnwrapped && useLazy) {\n        value = onlyLazy ? value : new LazyWrapper(this);\n        var result = func.apply(value, args);\n        result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined });\n        return new LodashWrapper(result, chainAll);\n      }\n      if (isUnwrapped && onlyLazy) {\n        return func.apply(this, args);\n      }\n      result = this.thru(interceptor);\n      return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result;\n    };\n  });\n\n  // Add `Array` methods to `lodash.prototype`.\n  arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) {\n    var func = arrayProto[methodName],\n        chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru',\n        retUnwrapped = /^(?:pop|shift)$/.test(methodName);\n\n    lodash.prototype[methodName] = function() {\n      var args = arguments;\n      if (retUnwrapped && !this.__chain__) {\n        var value = this.value();\n        return func.apply(isArray(value) ? value : [], args);\n      }\n      return this[chainName](function(value) {\n        return func.apply(isArray(value) ? value : [], args);\n      });\n    };\n  });\n\n  // Map minified method names to their real names.\n  baseForOwn(LazyWrapper.prototype, function(func, methodName) {\n    var lodashFunc = lodash[methodName];\n    if (lodashFunc) {\n      var key = (lodashFunc.name + ''),\n          names = realNames[key] || (realNames[key] = []);\n\n      names.push({ 'name': methodName, 'func': lodashFunc });\n    }\n  });\n\n  realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{\n    'name': 'wrapper',\n    'func': undefined\n  }];\n\n  // Add methods to `LazyWrapper`.\n  LazyWrapper.prototype.clone = lazyClone;\n  LazyWrapper.prototype.reverse = lazyReverse;\n  LazyWrapper.prototype.value = lazyValue;\n\n  // Add lazy aliases.\n  lodash.prototype.first = lodash.prototype.head;\n\n  if (symIterator) {\n    lodash.prototype[symIterator] = wrapperToIterator;\n  }\n\n  /*--------------------------------------------------------------------------*/\n\n  // Some AMD build optimizers, like r.js, check for condition patterns like:\n  if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) {\n    // Expose Lodash on the global object to prevent errors when Lodash is\n    // loaded by a script tag in the presence of an AMD loader.\n    // See http://requirejs.org/docs/errors.html#mismatch for more details.\n    // Use `_.noConflict` to remove Lodash from the global object.\n    root._ = lodash;\n\n    // Define as an anonymous module so, through path mapping, it can be\n    // referenced as the \"underscore\" module.\n    define(function() {\n      return lodash;\n    });\n  }\n  // Check for `exports` after `define` in case a build optimizer adds it.\n  else if (freeModule) {\n    // Export for Node.js.\n    (freeModule.exports = lodash)._ = lodash;\n    // Export for CommonJS support.\n    freeExports._ = lodash;\n  }\n  else {\n    // Export to the global object.\n    root._ = lodash;\n  }\n}.call(this));\n"},105:function(e,n,t){(function(e,n){function t(){c=!1;for(var e=u.slice(0),n=u.length=0;n<e.length;n++)e[n]()}var r,a,i,o,s,u,c,l,h,p,f;_global=undefined,_global="undefined"!=typeof window?window:void 0!==e?e:"undefined"!=typeof self?self:this,_global.BI||(_global.BI={}),h=function(r,a){return function(e,n,t){return r.call(a,n,e,t)}},p=function(e){return function(){return _[e].apply(_,arguments)}},f=function(n){return function(){var e=Array.prototype.slice.call(arguments,0);return e[1]=_.isFunction(e[1])?h(e[1],e[2]):e[1],_[n].apply(_,e)}},_.extend(BI,{assert:function(e,n){if(this.isFunction(n)){if(n(e))return!0;throw new Error(e+" error")}if(this.isArray(n)||(n=[n]),!this.deepContains(n,e))throw new Error(e+" error");return!0},warn:function(e){console.warn(e)},UUID:function(){for(var e=["0","1","2","3","4","5","6","7","8","9","a","b","c","d","e","f"],n="",t=0;t<16;t++){n+=e[parseInt(e.length*Math.random(),10)]}return n},isWidget:function(e){return e instanceof BI.Widget||BI.View&&e instanceof BI.View},createWidgets:function(e,t,n){if(!BI.isArray(e))throw new Error("cannot create Widgets");return t=BI.isWidget(t)?{}:t||{},BI.map(BI.flatten(e),function(e,n){return BI.createWidget(n,BI.deepClone(t))})},createItems:function(e,t,r){return t=BI.isArray(t)?t:BI.makeArray(BI.flatten(e).length,t||{}),r=BI.isArray(r)?r:BI.makeArray(BI.flatten(e).length,r||{}),BI.map(e,function(e,n){return BI.isArray(n)?BI.createItems(n,t,r):n instanceof BI.Widget?BI.extend({},t.shift(),r.shift(),{type:null,el:n}):t[0]instanceof BI.Widget?(r.shift(),BI.extend({},n,{el:t.shift()})):n.el instanceof BI.Widget||BI.View&&n.el instanceof BI.View?(t.shift(),BI.extend({},r.shift(),{type:null},n)):n.el?BI.extend({},r.shift(),n,{el:BI.extend({},t.shift(),n.el)}):BI.extend({},r.shift(),{el:BI.extend({},t.shift(),n)})})},packageItems:function(e,t){for(var r=t.length-1;0<=r;r--)e=BI.map(e,function(e,n){return BI.extend({},t[r],{items:[BI.extend({},t[r].el,{el:n})]})});return e},formatEL:function(e){return e&&!e.type&&e.el?e:{el:e}},stripEL:function(e){return e.type&&e||e.el||e},trans2Element:function(e){return BI.map(e,function(e,n){return n.element})}}),_.each(["where","findWhere","invoke","pluck","shuffle","sample","toArray","size"],function(e){BI[e]=p(e)}),_.each(["get","set","each","map","reduce","reduceRight","find","filter","reject","every","all","some","any","max","min","sortBy","groupBy","indexBy","countBy","partition","clamp"],function(e){BI[e]=f("any"===e?"some":e)}),_.extend(BI,{count:function(e,n,t){var r;if(t)for(r=e;r<n;r++)t(r);return n-e},inverse:function(e,n,t){return BI.count(n,e,t)},firstKey:function(e){var t=r;return BI.any(e,function(e,n){return t=e,!0}),t},lastKey:function(e){var t=r;return BI.each(e,function(e,n){return t=e,!0}),t},firstObject:function(e){var t=r;return BI.any(e,function(e,n){return t=n,!0}),t},lastObject:function(e){var t=r;return BI.each(e,function(e,n){return t=n,!0}),t},concat:function(e,n){return BI.isKey(e)?BI.map([].slice.apply(arguments),function(e,n){return n}).join(""):BI.isArray(e)?_.concat.apply([],arguments):BI.isObject(e)?_.extend.apply({},arguments):void 0},backEach:function(e,n,t){n=BI.iteratee(n,t);for(var r=e.length-1;0<=r;r--)n(r,e[r],e);return!1},backAny:function(e,n,t){n=BI.iteratee(n,t);for(var r=e.length-1;0<=r;r--)if(n(r,e[r],e))return!0;return!1},backEvery:function(e,n,t){n=BI.iteratee(n,t);for(var r=e.length-1;0<=r;r--)if(!n(r,e[r],e))return!1;return!0},backFindKey:function(e,n,t){n=BI.iteratee(n,t);for(var r,a=_.keys(e),i=a.length-1;0<=i;i--)if(n(e[r=a[i]],r,e))return r},backFind:function(e,n,t){var r=BI.isArray(e)?BI.findLastIndex(e,n,t):BI.backFindKey(e,n,t);if(void 0!==r&&-1!==r)return e[r]},remove:function(t,r,a){var e,i=BI.isFunction(r);if(r=i||BI.isArray(r)?r:[r],BI.isArray(t))for(e=0;e<t.length;e++)(i&&!0===r.apply(a,[e,t[e]])||!i&&BI.contains(r,t[e]))&&t.splice(e--,1);else BI.each(t,function(e,n){(i&&!0===r.apply(a,[e,t[e]])||!i&&BI.contains(r,t[e]))&&delete t[e]})},removeAt:function(e,n){n=BI.isArray(n)?n:[n];for(var t=BI.isArray(e),r=0;r<n.length;r++)t?e[n[r]]="$deleteIndex":delete e[n[r]];t&&BI.remove(e,"$deleteIndex")},string2Array:function(e){return e.split("&-&")},array2String:function(e){return e.join("&-&")},abc2Int:function(e){for(var n=0,t=0,r=(e=e.toUpperCase()).length;t<r;++t)if((n=e.charAt(t).charCodeAt(0)-"A".charCodeAt(0)+26*n+1)>(2147483646-e.charAt(t).charCodeAt(0)+"A".charCodeAt(0))/26)return 0;return n},int2Abc:function(e){var n=["A","B","C","D","E","F","G","H","I","J","K","L","M","N","O","P","Q","R","S","T","U","V","W","X","Y","Z"],t=e,r="";if(0===e)return"";for(;0!==t;){var a=t%26;0===a&&(a=26),r=n[a-1]+r,t=(t-a)/26}return r}}),_.each(["first","initial","last","rest","compact","flatten","without","union","intersection","difference","zip","unzip","object","indexOf","lastIndexOf","sortedIndex","range","take","takeRight","uniqBy"],function(e){BI[e]=p(e)}),_.each(["findIndex","findLastIndex"],function(e){BI[e]=f(e)}),_.extend(BI,{makeArray:function(e,n){for(var t=[],r=0;r<e;r++)BI.isNull(n)?t.push(r):t.push(BI.deepClone(n));return t},makeObject:function(e,n){for(var t={},r=0;r<e.length;r++)BI.isNull(n)?t[e[r]]=e[r]:t[e[r]]=BI.deepClone(n);return t},makeArrayByArray:function(e,n){var t=[];if(!e)return t;for(var r=0,a=e.length;r<a;r++)BI.isArray(e[r])?t.push(arguments.callee(e[r],n)):t.push(BI.deepClone(n));return t},uniq:function(e,n,t,r){return null==e?[]:(_.isBoolean(n)||(r=t,t=n,n=!1),t=t&&h(t,r),_.uniq.call(_,e,n,t,r))}}),_.each(["keys","allKeys","values","pairs","invert","create","functions","extend","extendOwn","defaults","clone","property","propertyOf","matcher","isEqual","isMatch","isEmpty","isElement","isNumber","isString","isArray","isObject","isPlainObject","isArguments","isFunction","isFinite","isBoolean","isDate","isRegExp","isError","isNaN","isUndefined","zipObject","cloneDeep"],function(e){BI[e]=p(e)}),_.each(["mapObject","findKey","pick","omit","tap"],function(e){BI[e]=f(e)}),_.extend(BI,{inherit:function(e,n,t){"object"==typeof n&&(t=n,n=e,e=function(){return n.apply(this,arguments)});var r=function(){},a=n.prototype;return r.prototype=a,e.prototype=new r,e.superclass=a,_.extend(e.prototype,t,{superclass:n}),e},init:function(){for(;BI.prepares&&0<BI.prepares.length;)BI.prepares.shift()();for(;_global.___fineuiExposedFunction&&0<_global.___fineuiExposedFunction.length;)_global.___fineuiExposedFunction.shift()();BI.initialized=!0},has:function(t,e){return BI.isArray(e)?0!==e.length&&BI.every(e,function(e,n){return _.has(t,n)}):_.has.apply(_,arguments)},freeze:function(e){return Object.freeze&&BI.isObject(e)?Object.freeze(e):e},isKey:function(e){return BI.isNumber(e)||BI.isString(e)&&0<e.length},isCapitalEqual:function(e,n){return e=BI.isNull(e)?e:(""+e).toLowerCase(),n=BI.isNull(n)?n:(""+n).toLowerCase(),BI.isEqual(e,n)},isWidthOrHeight:function(e){return"number"==typeof e?0<=e:"string"==typeof e?/^\d{1,3}%$/.exec(e)||"auto"==e||/^\d+px$/.exec(e):void 0},isNotNull:function(e){return!BI.isNull(e)},isNull:function(e){return null==e},isEmptyArray:function(e){return BI.isArray(e)&&BI.isEmpty(e)},isNotEmptyArray:function(e){return BI.isArray(e)&&!BI.isEmpty(e)},isEmptyObject:function(e){return BI.isEqual(e,{})},isNotEmptyObject:function(e){return BI.isPlainObject(e)&&!BI.isEmptyObject(e)},isEmptyString:function(e){return BI.isString(e)&&0===e.length},isNotEmptyString:function(e){return BI.isString(e)&&!BI.isEmptyString(e)},isWindow:function(e){return null!=e&&e==e.window}}),_.extend(BI,{deepClone:_.cloneDeep,deepExtend:_.merge,isDeepMatch:function(e,n){var t=BI.keys(n),r=t.length;if(null==e)return!r;for(var a=Object(e),i=0;i<r;i++){var o=t[i];if(!(BI.isEqual(n[o],a[o])&&o in a))return!1}return!0},contains:function(e,n,t){return _.isArrayLike(e)||(e=_.values(e)),0<=_.indexOf(e,n,"number"==typeof t&&t)},deepContains:function(e,t){return BI.isObject(t)?BI.any(e,function(e,n){if(BI.isEqual(n,t))return!0}):BI.contains(e,t)},deepIndexOf:function(e,n){for(var t=0;t<e.length;t++)if(BI.isEqual(n,e[t]))return t;return-1},deepRemove:function(t,r){var e,a=!1;if(BI.isArray(t))for(e=0;e<t.length;e++)BI.isEqual(r,t[e])&&(t.splice(e--,1),a=!0);else BI.each(t,function(e,n){BI.isEqual(r,t[e])&&(delete t[e],a=!0)});return a},deepWithout:function(t,r){if(BI.isArray(t)){for(var a=[],e=0;e<t.length;e++)BI.isEqual(r,t[e])||a.push(t[e]);return a}a={};return BI.each(t,function(e,n){BI.isEqual(r,t[e])||(a[e]=n)}),a},deepUnique:function(e){var t=[];return BI.each(e,function(e,n){BI.deepContains(t,n)||t.push(n)}),t},deepDiff:function(e,n){e=e||{},n=n||{};var t=[],r=[];for(var a in e)this.has(e,a)&&(this.isEqual(e[a],n[a])||t.push(a),r.push(a));for(var a in n)this.has(n,a)&&!BI.contains(r,a)&&t.push(a);return t}}),_.each(["uniqueId","result","chain","iteratee","escape","unescape","before","after"],function(e){BI[e]=function(){return _[e].apply(_,arguments)}}),_.each(["bind","once","partial","debounce","throttle","delay","defer","wrap"],function(e){BI[e]=function(){return _[e].apply(_,arguments)}}),_.extend(BI,{nextTick:(c=!(u=[]),l=void 0,l="undefined"!=typeof Promise?(a=Promise.resolve(),function l(){a.then(t)}):"undefined"!=typeof MutationObserver?(i=1,o=new MutationObserver(t),s=document.createTextNode(String(i)),o.observe(s,{characterData:!0}),function l(){i=(i+1)%2,s.data=String(i)}):void 0!==n?function l(){n(t)}:function l(){setTimeout(t,0)},function(n){var t=void 0,r=[].slice.call(arguments,1);if(u.push(function(){if(n)try{n.apply(null,r)}catch(e){console.error(e)}else t&&t.apply(null,r)}),c||(c=!0,l()),!n&&"undefined"!=typeof Promise)return new Promise(function(e,n){t=e})})}),_.each(["random"],function(e){BI[e]=p(e)}),_.extend(BI,{getTime:function(){return _global.performance&&_global.performance.now?_global.performance.now():_global.performance&&_global.performance.webkitNow?_global.performance.webkitNow():Date.now?Date.now():BI.getDate().getTime()},parseInt:function(e){var n=10;/^0x/g.test(e)&&(n=16);try{return parseInt(e,n)}catch(t){throw new Error(e+"parse int error")}},parseSafeInt:function(e){var n=9007199254740991;return e?this.clamp(this.parseInt(e),-n,n):0===e?e:0},parseFloat:function(e){try{return parseFloat(e)}catch(n){throw new Error(e+"parse float error")}},isNaturalNumber:function(e){return!!/^\d+$/.test(e)},isPositiveInteger:function(e){return!!/^\+?[1-9][0-9]*$/.test(e)},isNegativeInteger:function(e){return!!/^\-[1-9][0-9]*$/.test(e)},isInteger:function(e){return!!/^\-?\d+$/.test(e)},isNumeric:function(e){return!isNaN(parseFloat(e))&&isFinite(e)},isFloat:function(e){return!!/^([+-]?)\d*\.\d+$/.test(e)},isOdd:function(e){return!!BI.isInteger(e)&&1==(1&e)},isEven:function(e){return!!BI.isInteger(e)&&0==(1&e)},sum:function(e,t,r){var a=0;return BI.each(e,function(e,n){a+=t?Number(t.apply(r,[e,n])):Number(n)}),a},average:function(e,n,t){return BI.sum(e,n,t)/e.length}}),_.extend(BI,{trim:function(){return _.trim.apply(_,arguments)},toUpperCase:function(e){return(e+"").toLocaleUpperCase()},toLowerCase:function(e){return(e+"").toLocaleLowerCase()},isEndWithBlank:function(e){return/(\s|\u00A0)$/.test(e)},isLiteral:function(e){return/^\s?(true|false|-?[\d\.]+|'[^']*'|"[^"]*")\s?$/.test(e)},stripQuotes:function(e){var n=e.charCodeAt(0);return n!==e.charCodeAt(e.length-1)||34!==n&&39!==n?e:e.slice(1,-1)},camelize:function(e){return e.replace(/-(.)/g,function(e,n){return n.toUpperCase()})},hyphenate:function(e){return e.replace(/([A-Z])/g,"-$1").toLowerCase()},isNotEmptyString:function(e){return BI.isString(e)&&!BI.isEmpty(e)},isEmptyString:function(e){return BI.isString(e)&&BI.isEmpty(e)},encrypt:function(e,n,t){switch(e){case BI.CRYPT_TYPE.AES:default:return BI.aesEncrypt(n,t)}},decrypt:function(e,n,t){switch(e){case BI.CRYPT_TYPE.AES:default:return BI.aesDecrypt(n,t)}},escape:function(e){return e.replace(/('|\\)/g,"\\$1")},leftPad:function(e,n,t){var r=String(e);for(t=t||" ";r.length<n;)r=t+r;return r.toString()},format:function(e){var t=Array.prototype.slice.call(arguments,1);return e.replace(/\{(\d+)\}/g,function(e,n){return t[n]})}}),_.extend(BI,{isLeapYear:function(e){return e%4==0&&e%100!=0||e%400==0},checkDateVoid:function(e,n,t,r,a){var i=[];return e|=0,n|=0,t|=0,r=BI.isString(r)?r.match(/\d+/g):r,a=BI.isString(a)?a.match(/\d+/g):a,e<r[0]?i=["y"]:e>a[0]?i=["y",1]:e>=r[0]&&e<=a[0]&&(e==r[0]&&(n<r[1]?i=["m"]:n==r[1]&&t<r[2]&&(i=["d"])),e==a[0]&&(n>a[1]?i=["m",1]:n==a[1]&&t>a[2]&&(i=["d",1]))),i},checkDateLegal:function(e){var n=e.match(/\d+/g),t=0|n[0],r=0|n[1],a=0|n[2];if(n.length<=1)return!0;if(n.length<=2)return 1<=r&&r<=12;var i=BI.Date._MD.slice(0);return i[1]=BI.isLeapYear(t)?29:28,1<=r&&r<=12&&a<=i[r-1]},parseDateTime:function(e,n){var t=BI.getDate(),r=0,a=0,i=1,o=e.split(/\W+/);"%y%x"!=n.toLowerCase()&&"%y%x%d"!=n.toLowerCase()||(o[0]=e.substring(0,4),o[1]=e.substring(4,6),o[2]=e.substring(6,8));for(var s=n.match(/%./g),u=0,c=0,l=0,h=0,p=0,u=0;u<o.length;++u)switch(s[u]){case"%d":case"%e":i=parseInt(o[u],10);break;case"%X":case"%x":a=parseInt(o[u],10)-1;break;case"%Y":case"%y":(r=parseInt(o[u],10))<100&&(r+=29<r?1900:2e3);break;case"%b":case"%B":for(c=0;c<12;++c)if(BI.Date._MN[c].substr(0,o[u].length).toLowerCase()==o[u].toLowerCase()){a=c;break}break;case"%H":case"%I":case"%k":case"%l":l=parseInt(o[u],10);break;case"%P":case"%p":/pm/i.test(o[u])&&l<12?l+=12:/am/i.test(o[u])&&12<=l&&(l-=12);break;case"%M":h=parseInt(o[u],10);case"%S":p=parseInt(o[u],10)}if(isNaN(r)&&(r=t.getFullYear()),isNaN(a)&&(a=t.getMonth()),isNaN(i)&&(i=t.getDate()),isNaN(l)&&(l=t.getHours()),isNaN(h)&&(h=t.getMinutes()),isNaN(p)&&(p=t.getSeconds()),0!=r)return BI.getDate(r,a,i,l,h,p);for(a=-1,u=i=r=0;u<o.length;++u)if(-1!=o[u].search(/[a-zA-Z]+/)){for(var f=-1,c=0;c<12;++c)if(BI.Date._MN[c].substr(0,o[u].length).toLowerCase()==o[u].toLowerCase()){f=c;break}-1!=f&&(-1!=a&&(i=a+1),a=f)}else parseInt(o[u],10)<=12&&-1==a?a=o[u]-1:31<parseInt(o[u],10)&&0==r?(r=parseInt(o[u],10))<100&&(r+=29<r?1900:2e3):0==i&&(i=o[u]);return 0==r&&(r=t.getFullYear()),-1!=a&&0!=i?BI.getDate(r,a,i,l,h,p):t},getDate:function(){var e,n=arguments;switch(arguments.length){case 0:e=new Date;break;case 1:e=new Date(n[0]);break;case 2:e=new Date(n[0],n[1]);break;case 3:e=new Date(n[0],n[1],n[2]);break;case 4:e=new Date(n[0],n[1],n[2],n[3]);break;case 5:e=new Date(n[0],n[1],n[2],n[3],n[4]);break;case 6:e=new Date(n[0],n[1],n[2],n[3],n[4],n[5]);break;case 7:e=new Date(n[0],n[1],n[2],n[3],n[4],n[5],n[6]);break;default:e=new Date}if(BI.isNotNull(BI.timeZone)&&(0===arguments.length||1===arguments.length&&BI.isNumber(arguments[0]))){var t=e.getTime(),r=6e4*e.getTimezoneOffset();return new Date(t+r+BI.timeZone)}return e},getTime:function(){var e,n=arguments;switch(arguments.length){case 0:e=new Date;break;case 1:e=new Date(n[0]);break;case 2:e=new Date(n[0],n[1]);break;case 3:e=new Date(n[0],n[1],n[2]);break;case 4:e=new Date(n[0],n[1],n[2],n[3]);break;case 5:e=new Date(n[0],n[1],n[2],n[3],n[4]);break;case 6:e=new Date(n[0],n[1],n[2],n[3],n[4],n[5]);break;case 7:e=new Date(n[0],n[1],n[2],n[3],n[4],n[5],n[6]);break;default:e=new Date}return BI.isNotNull(BI.timeZone)?e.getTime()-BI.timeZone-6e4*(new Date).getTimezoneOffset():e.getTime()}})}).call(this,t(13),t(52).setImmediate)},106:function(e,n,t){"use strict";(function(e,n){function t(e){delete s[e]}function r(e){if(u)setTimeout(r,0,e);else{var n=s[e];if(n){u=!0;try{!function(e){var n=e.callback,t=e.args;switch(t.length){case 0:n();break;case 1:n(t[0]);break;case 2:n(t[0],t[1]);break;case 3:n(t[0],t[1],t[2]);break;default:n.apply(i,t)}}(n)}finally{t(e),u=!1}}}}var a,i,o,s,u,c,l,h,p,f,d,m;(a="undefined"==typeof self?void 0===e?void 0:e:self).setImmediate||(o=1,u=!(s={}),c=a.document,m=(m=Object.getPrototypeOf&&Object.getPrototypeOf(a))&&m.setTimeout?m:a,l="[object process]"==={}.toString.call(a.process)?function l(e){n.nextTick(function(){r(e)})}:function(){if(a.postMessage&&!a.importScripts){var e=!0,n=a.onmessage;return a.onmessage=function(){e=!1},a.postMessage("","*"),a.onmessage=n,e}}()?(f="setImmediate$"+Math.random()+"$",d=function d(e){e.source===a&&"string"==typeof e.data&&0===e.data.indexOf(f)&&r(+e.data.slice(f.length))},a.addEventListener?a.addEventListener("message",d,!1):a.attachEvent("onmessage",d),function l(e){a.postMessage(f+e,"*")}):a.MessageChannel?((p=new MessageChannel).port1.onmessage=function(e){r(e.data)},function l(e){p.port2.postMessage(e)}):c&&"onreadystatechange"in c.createElement("script")?(h=c.documentElement,function l(e){var n=c.createElement("script");n.onreadystatechange=function(){r(e),n.onreadystatechange=null,h.removeChild(n),n=null},h.appendChild(n)}):function l(e){setTimeout(r,0,e)},m.setImmediate=function(e){"function"!=typeof e&&(e=new Function(""+e));for(var n=new Array(arguments.length-1),t=0;t<n.length;t++)n[t]=arguments[t+1];var r={callback:e,args:n};return s[o]=r,l(o),o++},m.clearImmediate=t)}).call(this,t(13),t(66))},107:function(e,n){BI.OB=function(e){this._constructor(e)},_.extend(BI.OB.prototype,{props:{},init:null,destroyed:null,_constructor:function(e){this._initProps(e),this._init(),this._initRef()},_defaultConfig:function(e){return{}},_initProps:function(e){var n=this.props;BI.isFunction(this.props)&&(n=this.props(e)),this.options=function(e){for(var n,t,r,a=e||{},i=arguments.length,o=1;o<i;o++)if(null!=(n=arguments[o]))for(t in n)a[t],a!==(r=n[t])&&r!==undefined&&(a[t]=r);return a}(this._defaultConfig(e),n,e)},_init:function(){this._initListeners(),this.init&&this.init()},_initListeners:function(){var n=this;null!=this.options.listeners&&(_.each(this.options.listeners,function(e){(e.target?e.target:n)[e.once?"once":"on"](e.eventName,_.bind(e.action,n))}),delete this.options.listeners)},_initRef:function(){this.options.ref&&this.options.ref.call(this,this)},_purgeRef:function(){this.options.ref&&(this.options.ref.call(null),this.options.ref=null)},_getEvents:function(){return _.isArray(this.events)||(this.events=[]),this.events},on:function(e,n){e=e.toLowerCase();var t=this._getEvents()[e];_.isArray(t)||(t=[],this._getEvents()[e]=t),t.push(n)},once:function(e,n){var t=function(){n.apply(this,arguments),this.un(e,t)};this.on(e,t)},un:function(e,n){var t,r;e=e.toLowerCase(),null==n?delete this._getEvents()[e]:(t=this._getEvents()[e],_.isArray(t)&&(r=[],_.each(t,function(e){e!=n&&r.push(e)}),this._getEvents()[e]=r))},purgeListeners:function(){this.events=[]},fireEvent:function(){var e=arguments[0].toLowerCase(),n=this._getEvents()[e];if(BI.isArray(n))if(BI.isArguments(arguments[1])){for(var t=0;t<n.length;t++)if(!1===n[t].apply(this,arguments[1]))return!1}else for(var r=Array.prototype.slice.call(arguments,1),t=0;t<n.length;t++)if(!1===n[t].apply(this,r))return!1;return!0},destroy:function(){this.destroyed&&this.destroyed(),this._purgeRef(),this.purgeListeners()}})},1073:function(e,n,t){t(101),t(102),t(130),t(123),t(126),t(127),t(124),t(125),t(105),t(107),t(122),t(129),t(128),t(108),t(109),t(110),t(111),t(112),t(113),t(114),t(115),t(116),t(117),t(118),t(119),t(120),t(121),t(744),t(1074),t(131),t(132),e.exports=t(133)},1074:function(e,n){BI.Date=BI.Date||{},BI.Date._DN=["星期日","星期一","星期二","星期三","星期四","星期五","星期六","星期日"],BI.Date._SDN=["日","一","二","三","四","五","六","日"],BI.Date._FD=1,BI.Date._MN=["一月","二月","三月","四月","五月","六月","七月","八月","九月","十月","十一月","十二月"],BI.Date._SMN=[0,1,2,3,4,5,6,7,8,9,10,11],BI.Date._QN=["","第1季度","第2季度","第3季度","第4季度"],BI.Date._MD=[31,28,31,30,31,30,31,31,30,31,30,31],BI.Date._OFFSET=[0,-1,-2,-3,-4,-5,-6]},108:function(e,n){!function(){BI.CRYPT_TYPE=BI.CRYPT_TYPE||{},BI.CRYPT_TYPE.AES="aes";var l,e,n,t,h,r,a,i,o,s,u,p,c,f,d,m,y,g,b,v,Y=Y||(l=Math,n=(e={}).lib={},t=n.Base={extend:function(e){T.prototype=this;var n=new T;return e&&n.mixIn(e),n.hasOwnProperty("init")||(n.init=function(){n.$super.init.apply(this,arguments)}),(n.init.prototype=n).$super=this,n},create:function(){var e=this.extend();return e.init.apply(e,arguments),e},init:function(){},mixIn:function(e){for(var n in e)e.hasOwnProperty(n)&&(this[n]=e[n]);e.hasOwnProperty("toString")&&(this.toString=e.toString)},clone:function(){return this.init.prototype.extend(this)}},h=n.WordArray=t.extend({init:function(e,n){e=this.words=e||[],this.sigBytes=null!=n?n:4*e.length},toString:function(e){return(e||a).stringify(this)},concat:function(e){var n=this.words,t=e.words,r=this.sigBytes,a=e.sigBytes;if(this.clamp(),r%4)for(var i=0;i<a;i++){var o=t[i>>>2]>>>24-i%4*8&255;n[r+i>>>2]|=o<<24-(r+i)%4*8}else if(65535<t.length)for(i=0;i<a;i+=4)n[r+i>>>2]=t[i>>>2];else n.push.apply(n,t);return this.sigBytes+=a,this},clamp:function(){var e=this.words,n=this.sigBytes;e[n>>>2]&=4294967295<<32-n%4*8,e.length=l.ceil(n/4)},clone:function(){var e=t.clone.call(this);return e.words=this.words.slice(0),e},random:function(e){for(var n=[],t=0;t<e;t+=4)n.push(4294967296*l.random()|0);return new h.init(n,e)}}),r=e.enc={},a=r.Hex={stringify:function(e){for(var n=e.words,t=e.sigBytes,r=[],a=0;a<t;a++){var i=n[a>>>2]>>>24-a%4*8&255;r.push((i>>>4).toString(16)),r.push((15&i).toString(16))}return r.join("")},parse:function(e){for(var n=e.length,t=[],r=0;r<n;r+=2)t[r>>>3]|=parseInt(e.substr(r,2),16)<<24-r%8*4;return new h.init(t,n/2)}},i=r.Latin1={stringify:function(e){for(var n=e.words,t=e.sigBytes,r=[],a=0;a<t;a++){var i=n[a>>>2]>>>24-a%4*8&255;r.push(String.fromCharCode(i))}return r.join("")},parse:function(e){for(var n=e.length,t=[],r=0;r<n;r++)t[r>>>2]|=(255&e.charCodeAt(r))<<24-r%4*8;return new h.init(t,n)}},o=r.Utf8={stringify:function(e){try{return decodeURIComponent(escape(i.stringify(e)))}catch(n){throw new Error("Malformed UTF-8 data")}},parse:function(e){return i.parse(unescape(encodeURIComponent(e)))}},s=n.BufferedBlockAlgorithm=t.extend({reset:function(){this._data=new h.init,this._nDataBytes=0},_append:function(e){"string"==typeof e&&(e=o.parse(e)),this._data.concat(e),this._nDataBytes+=e.sigBytes},_process:function(e){var n=this._data,t=n.words,r=n.sigBytes,a=this.blockSize,i=r/(4*a),o=(i=e?l.ceil(i):l.max((0|i)-this._minBufferSize,0))*a,s=l.min(4*o,r);if(o){for(var u=0;u<o;u+=a)this._doProcessBlock(t,u);var c=t.splice(0,o);n.sigBytes-=s}return new h.init(c,s)},clone:function(){var e=t.clone.call(this);return e._data=this._data.clone(),e},_minBufferSize:0}),n.Hasher=s.extend({cfg:t.extend(),init:function(e){this.cfg=this.cfg.extend(e),this.reset()},reset:function(){s.reset.call(this),this._doReset()},update:function(e){return this._append(e),this._process(),this},finalize:function(e){return e&&this._append(e),this._doFinalize()},blockSize:16,_createHelper:function(t){return function(e,n){return new t.init(n).finalize(e)}},_createHmacHelper:function(t){return function(e,n){return new u.HMAC.init(t,n).finalize(e)}}}),u=e.algo={},e);function T(){}p=Y.lib.WordArray,Y.enc.Base64={stringify:function(e){var n=e.words,t=e.sigBytes,r=this._map;e.clamp();for(var a=[],i=0;i<t;i+=3)for(var o=(n[i>>>2]>>>24-i%4*8&255)<<16|(n[i+1>>>2]>>>24-(i+1)%4*8&255)<<8|n[i+2>>>2]>>>24-(i+2)%4*8&255,s=0;s<4&&i+.75*s<t;s++)a.push(r.charAt(o>>>6*(3-s)&63));var u=r.charAt(64);if(u)for(;a.length%4;)a.push(u);return a.join("")},parse:function(e){var n,t=e.length,r=this._map,a=r.charAt(64);!a||-1!=(n=e.indexOf(a))&&(t=n);for(var i,o,s=[],u=0,c=0;c<t;c++){c%4&&(i=r.indexOf(e.charAt(c-1))<<c%4*2,o=r.indexOf(e.charAt(c))>>>6-c%4*2,s[u>>>2]|=(i|o)<<24-u%4*8,u++)}return p.create(s,u)},_map:"ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/="},function(l){var e=Y,n=e.lib,t=n.WordArray,r=n.Hasher,a=e.algo,C=[];!function(){for(var e=0;e<64;e++)C[e]=4294967296*l.abs(l.sin(e+1))|0}();var i=a.MD5=r.extend({_doReset:function(){this._hash=new t.init([1732584193,4023233417,2562383102,271733878])},_doProcessBlock:function(e,n){for(var t=0;t<16;t++){var r=n+t,a=e[r];e[r]=16711935&(a<<8|a>>>24)|4278255360&(a<<24|a>>>8)}var i=this._hash.words,o=e[n+0],s=e[n+1],u=e[n+2],c=e[n+3],l=e[n+4],h=e[n+5],p=e[n+6],f=e[n+7],d=e[n+8],m=e[n+9],y=e[n+10],g=e[n+11],b=e[n+12],v=e[n+13],T=e[n+14],_=e[n+15],Y=B(Y=i[0],Z=i[1],L=i[2],S=i[3],o,7,C[0]),S=B(S,Y,Z,L,s,12,C[1]),L=B(L,S,Y,Z,u,17,C[2]),Z=B(Z,L,S,Y,c,22,C[3]);Y=B(Y,Z,L,S,l,7,C[4]),S=B(S,Y,Z,L,h,12,C[5]),L=B(L,S,Y,Z,p,17,C[6]),Z=B(Z,L,S,Y,f,22,C[7]),Y=B(Y,Z,L,S,d,7,C[8]),S=B(S,Y,Z,L,m,12,C[9]),L=B(L,S,Y,Z,y,17,C[10]),Z=B(Z,L,S,Y,g,22,C[11]),Y=B(Y,Z,L,S,b,7,C[12]),S=B(S,Y,Z,L,v,12,C[13]),L=B(L,S,Y,Z,T,17,C[14]),Y=I(Y,Z=B(Z,L,S,Y,_,22,C[15]),L,S,s,5,C[16]),S=I(S,Y,Z,L,p,9,C[17]),L=I(L,S,Y,Z,g,14,C[18]),Z=I(Z,L,S,Y,o,20,C[19]),Y=I(Y,Z,L,S,h,5,C[20]),S=I(S,Y,Z,L,y,9,C[21]),L=I(L,S,Y,Z,_,14,C[22]),Z=I(Z,L,S,Y,l,20,C[23]),Y=I(Y,Z,L,S,m,5,C[24]),S=I(S,Y,Z,L,T,9,C[25]),L=I(L,S,Y,Z,c,14,C[26]),Z=I(Z,L,S,Y,d,20,C[27]),Y=I(Y,Z,L,S,v,5,C[28]),S=I(S,Y,Z,L,u,9,C[29]),L=I(L,S,Y,Z,f,14,C[30]),Y=X(Y,Z=I(Z,L,S,Y,b,20,C[31]),L,S,h,4,C[32]),S=X(S,Y,Z,L,d,11,C[33]),L=X(L,S,Y,Z,g,16,C[34]),Z=X(Z,L,S,Y,T,23,C[35]),Y=X(Y,Z,L,S,s,4,C[36]),S=X(S,Y,Z,L,l,11,C[37]),L=X(L,S,Y,Z,f,16,C[38]),Z=X(Z,L,S,Y,y,23,C[39]),Y=X(Y,Z,L,S,v,4,C[40]),S=X(S,Y,Z,L,o,11,C[41]),L=X(L,S,Y,Z,c,16,C[42]),Z=X(Z,L,S,Y,p,23,C[43]),Y=X(Y,Z,L,S,m,4,C[44]),S=X(S,Y,Z,L,b,11,C[45]),L=X(L,S,Y,Z,_,16,C[46]),Y=J(Y,Z=X(Z,L,S,Y,u,23,C[47]),L,S,o,6,C[48]),S=J(S,Y,Z,L,f,10,C[49]),L=J(L,S,Y,Z,T,15,C[50]),Z=J(Z,L,S,Y,h,21,C[51]),Y=J(Y,Z,L,S,b,6,C[52]),S=J(S,Y,Z,L,c,10,C[53]),L=J(L,S,Y,Z,y,15,C[54]),Z=J(Z,L,S,Y,s,21,C[55]),Y=J(Y,Z,L,S,d,6,C[56]),S=J(S,Y,Z,L,_,10,C[57]),L=J(L,S,Y,Z,p,15,C[58]),Z=J(Z,L,S,Y,v,21,C[59]),Y=J(Y,Z,L,S,l,6,C[60]),S=J(S,Y,Z,L,g,10,C[61]),L=J(L,S,Y,Z,u,15,C[62]),Z=J(Z,L,S,Y,m,21,C[63]),i[0]=i[0]+Y|0,i[1]=i[1]+Z|0,i[2]=i[2]+L|0,i[3]=i[3]+S|0},_doFinalize:function(){var e=this._data,n=e.words,t=8*this._nDataBytes,r=8*e.sigBytes;n[r>>>5]|=128<<24-r%32;var a=l.floor(t/4294967296),i=t;n[15+(64+r>>>9<<4)]=16711935&(a<<8|a>>>24)|4278255360&(a<<24|a>>>8),n[14+(64+r>>>9<<4)]=16711935&(i<<8|i>>>24)|4278255360&(i<<24|i>>>8),e.sigBytes=4*(n.length+1),this._process();for(var o=this._hash,s=o.words,u=0;u<4;u++){var c=s[u];s[u]=16711935&(c<<8|c>>>24)|4278255360&(c<<24|c>>>8)}return o},clone:function(){var e=r.clone.call(this);return e._hash=this._hash.clone(),e}});function B(e,n,t,r,a,i,o){var s=e+(n&t|~n&r)+a+o;return(s<<i|s>>>32-i)+n}function I(e,n,t,r,a,i,o){var s=e+(n&r|t&~r)+a+o;return(s<<i|s>>>32-i)+n}function X(e,n,t,r,a,i,o){var s=e+(n^t^r)+a+o;return(s<<i|s>>>32-i)+n}function J(e,n,t,r,a,i,o){var s=e+(t^(n|~r))+a+o;return(s<<i|s>>>32-i)+n}e.MD5=r._createHelper(i),e.HmacMD5=r._createHmacHelper(i)}(Math),f=(c=Y).lib,d=f.Base,m=f.WordArray,y=c.algo,g=y.MD5,b=y.EvpKDF=d.extend({cfg:d.extend({keySize:4,hasher:g,iterations:1}),init:function(e){this.cfg=this.cfg.extend(e)},compute:function(e,n){for(var t=this.cfg,r=t.hasher.create(),a=m.create(),i=a.words,o=t.keySize,s=t.iterations;i.length<o;){u&&r.update(u);var u=r.update(e).finalize(n);r.reset();for(var c=1;c<s;c++)u=r.finalize(u),r.reset();a.concat(u)}return a.sigBytes=4*o,a}}),c.EvpKDF=function(e,n,t){return b.create(t).compute(e,n)},Y.lib.Cipher||function(){var e=Y,n=e.lib,t=n.Base,u=n.WordArray,r=n.BufferedBlockAlgorithm,a=e.enc,i=(a.Utf8,a.Base64),o=e.algo.EvpKDF,s=n.Cipher=r.extend({cfg:t.extend(),createEncryptor:function(e,n){return this.create(this._ENC_XFORM_MODE,e,n)},createDecryptor:function(e,n){return this.create(this._DEC_XFORM_MODE,e,n)},init:function(e,n,t){this.cfg=this.cfg.extend(t),this._xformMode=e,this._key=n,this.reset()},reset:function(){r.reset.call(this),this._doReset()},process:function(e){return this._append(e),this._process()},finalize:function(e){return e&&this._append(e),this._doFinalize()},keySize:4,ivSize:4,_ENC_XFORM_MODE:1,_DEC_XFORM_MODE:2,_createHelper:function(r){return{encrypt:function(e,n,t){return c(n).encrypt(r,e,n,t)},decrypt:function(e,n,t){return c(n).decrypt(r,e,n,t)}}}});function c(e){return"string"==typeof e?T:b}n.StreamCipher=s.extend({_doFinalize:function(){return this._process(!0)},blockSize:1});var l,h=e.mode={},p=n.BlockCipherMode=t.extend({createEncryptor:function(e,n){return this.Encryptor.create(e,n)},createDecryptor:function(e,n){return this.Decryptor.create(e,n)},init:function(e,n){this._cipher=e,this._iv=n}}),f=h.CBC=((l=p.extend()).Encryptor=l.extend({processBlock:function(e,n){var t=this._cipher,r=t.blockSize;d.call(this,e,n,r),t.encryptBlock(e,n),this._prevBlock=e.slice(n,n+r)}}),l.Decryptor=l.extend({processBlock:function(e,n){var t=this._cipher,r=t.blockSize,a=e.slice(n,n+r);t.decryptBlock(e,n),d.call(this,e,n,r),this._prevBlock=a}}),l);function d(e,n,t){var r,a=this._iv;a?(r=a,this._iv=void 0):r=this._prevBlock;for(var i=0;i<t;i++)e[n+i]^=r[i]}var m=(e.pad={}).Pkcs7={pad:function(e,n){for(var t=4*n,r=t-e.sigBytes%t,a=r<<24|r<<16|r<<8|r,i=[],o=0;o<r;o+=4)i.push(a);var s=u.create(i,r);e.concat(s)},unpad:function(e){var n=255&e.words[e.sigBytes-1>>>2];e.sigBytes-=n}},y=(n.BlockCipher=s.extend({cfg:s.cfg.extend({mode:f,padding:m}),reset:function(){s.reset.call(this);var e,n=this.cfg,t=n.iv,r=n.mode;this._xformMode==this._ENC_XFORM_MODE?e=r.createEncryptor:(e=r.createDecryptor,this._minBufferSize=1),this._mode=e.call(r,this,t&&t.words)},_doProcessBlock:function(e,n){this._mode.processBlock(e,n)},_doFinalize:function(){var e,n=this.cfg.padding;return this._xformMode==this._ENC_XFORM_MODE?(n.pad(this._data,this.blockSize),e=this._process(!0)):(e=this._process(!0),n.unpad(e)),e},blockSize:4}),n.CipherParams=t.extend({init:function(e){this.mixIn(e)},toString:function(e){return(e||this.formatter).stringify(this)}})),g=(e.format={}).OpenSSL={stringify:function(e){var n=e.ciphertext,t=e.salt;return(t?u.create([1398893684,1701076831]).concat(t).concat(n):n).toString(i)},parse:function(e){var n,t=i.parse(e),r=t.words;return 1398893684==r[0]&&1701076831==r[1]&&(n=u.create(r.slice(2,4)),r.splice(0,4),t.sigBytes-=16),y.create({ciphertext:t,salt:n})}},b=n.SerializableCipher=t.extend({cfg:t.extend({format:g}),encrypt:function(e,n,t,r){r=this.cfg.extend(r);var a=e.createEncryptor(t,r),i=a.finalize(n),o=a.cfg;return y.create({ciphertext:i,key:t,iv:o.iv,algorithm:e,mode:o.mode,padding:o.padding,blockSize:e.blockSize,formatter:r.format})},decrypt:function(e,n,t,r){return r=this.cfg.extend(r),n=this._parse(n,r.format),e.createDecryptor(t,r).finalize(n.ciphertext)},_parse:function(e,n){return"string"==typeof e?n.parse(e,this):e}}),v=(e.kdf={}).OpenSSL={execute:function(e,n,t,r){r=r||u.random(8);var a=o.create({keySize:n+t}).compute(e,r),i=u.create(a.words.slice(n),4*t);return a.sigBytes=4*n,y.create({key:a,iv:i,salt:r})}},T=n.PasswordBasedCipher=b.extend({cfg:b.cfg.extend({kdf:v}),encrypt:function(e,n,t,r){var a=(r=this.cfg.extend(r)).kdf.execute(t,e.keySize,e.ivSize);r.iv=a.iv;var i=b.encrypt.call(this,e,n,a.key,r);return i.mixIn(a),i},decrypt:function(e,n,t,r){r=this.cfg.extend(r),n=this._parse(n,r.format);var a=r.kdf.execute(t,e.keySize,e.ivSize,n.salt);return r.iv=a.iv,b.decrypt.call(this,e,n,a.key,r)}})}(),Y.mode.ECB=((v=Y.lib.BlockCipherMode.extend()).Encryptor=v.extend({processBlock:function(e,n){this._cipher.encryptBlock(e,n)}}),v.Decryptor=v.extend({processBlock:function(e,n){this._cipher.decryptBlock(e,n)}}),v),function(){var e=Y,n=e.lib.BlockCipher,t=e.algo,c=[],l=[],h=[],p=[],f=[],d=[],m=[],y=[],g=[],b=[];!function(){for(var e=[],n=0;n<256;n++)e[n]=n<128?n<<1:n<<1^283;for(var t=0,r=0,n=0;n<256;n++){var a=(a=r^r<<1^r<<2^r<<3^r<<4)>>>8^255&a^99;c[t]=a;var i=e[l[a]=t],o=e[i],s=e[o],u=257*e[a]^16843008*a;h[t]=u<<24|u>>>8,p[t]=u<<16|u>>>16,f[t]=u<<8|u>>>24,d[t]=u;u=16843009*s^65537*o^257*i^16843008*t;m[a]=u<<24|u>>>8,y[a]=u<<16|u>>>16,g[a]=u<<8|u>>>24,b[a]=u,t?(t=i^e[e[e[s^i]]],r^=e[e[r]]):t=r=1}}();var v=[0,1,2,4,8,16,32,64,128,27,54],r=t.AES=n.extend({_doReset:function(){for(var e=this._key,n=e.words,t=e.sigBytes/4,r=4*(1+(this._nRounds=6+t)),a=this._keySchedule=[],i=0;i<r;i++){i<t?a[i]=n[i]:(u=a[i-1],i%t?6<t&&i%t==4&&(u=c[u>>>24]<<24|c[u>>>16&255]<<16|c[u>>>8&255]<<8|c[255&u]):(u=c[(u=u<<8|u>>>24)>>>24]<<24|c[u>>>16&255]<<16|c[u>>>8&255]<<8|c[255&u],u^=v[i/t|0]<<24),a[i]=a[i-t]^u)}for(var o=this._invKeySchedule=[],s=0;s<r;s++){var u,i=r-s;u=s%4?a[i]:a[i-4],o[s]=s<4||i<=4?u:m[c[u>>>24]]^y[c[u>>>16&255]]^g[c[u>>>8&255]]^b[c[255&u]]}},encryptBlock:function(e,n){this._doCryptBlock(e,n,this._keySchedule,h,p,f,d,c)},decryptBlock:function(e,n){var t=e[n+1];e[n+1]=e[n+3],e[n+3]=t,this._doCryptBlock(e,n,this._invKeySchedule,m,y,g,b,l);t=e[n+1];e[n+1]=e[n+3],e[n+3]=t},_doCryptBlock:function(e,n,t,r,a,i,o,s){for(var u=this._nRounds,c=e[n]^t[0],l=e[n+1]^t[1],h=e[n+2]^t[2],p=e[n+3]^t[3],f=4,d=1;d<u;d++)var m=r[c>>>24]^a[l>>>16&255]^i[h>>>8&255]^o[255&p]^t[f++],y=r[l>>>24]^a[h>>>16&255]^i[p>>>8&255]^o[255&c]^t[f++],g=r[h>>>24]^a[p>>>16&255]^i[c>>>8&255]^o[255&l]^t[f++],b=r[p>>>24]^a[c>>>16&255]^i[l>>>8&255]^o[255&h]^t[f++],c=m,l=y,h=g,p=b;m=(s[c>>>24]<<24|s[l>>>16&255]<<16|s[h>>>8&255]<<8|s[255&p])^t[f++],y=(s[l>>>24]<<24|s[h>>>16&255]<<16|s[p>>>8&255]<<8|s[255&c])^t[f++],g=(s[h>>>24]<<24|s[p>>>16&255]<<16|s[c>>>8&255]<<8|s[255&l])^t[f++],b=(s[p>>>24]<<24|s[c>>>16&255]<<16|s[l>>>8&255]<<8|s[255&h])^t[f++];e[n]=m,e[n+1]=y,e[n+2]=g,e[n+3]=b},keySize:8});e.AES=n._createHelper(r)}(),_.extend(BI,{aesEncrypt:function(e,n){return n=Y.enc.Utf8.parse(n),Y.AES.encrypt(e,n,{mode:Y.mode.ECB,padding:Y.pad.Pkcs7}).ciphertext.toString(Y.enc.Base64)},aesDecrypt:function(e,n){n=Y.enc.Utf8.parse(n);var t=Y.AES.decrypt(e,n,{mode:Y.mode.ECB,padding:Y.pad.Pkcs7});return Y.enc.Utf8.stringify(t)}})}()},109:function(e,n){function t(o){return function(e,n,t){var u,r=e[n];r&&r.target==e||((u=e[n]=function(){for(var e,n=u.before,t=arguments,r=n.length;r--;){if(!1===(e=n[r].advice.apply(this,t)))return!1;t=e||t}for(var a=u.method.apply(this,t),i=u.after,o=0,s=i.length;o<s;o++){if(e=i[o].advice.call(this,a,t),!1===a)return!1;t=e||t}return a}).before=[],u.after=[],r&&(u.method=r),u.target=e);var a=(u||r)[o],i={advice:t,_index:a.length,remove:function(){a.splice(this._index,1)}};return a.push(i),i}}BI.aspect={before:t("before"),after:t("after")},BI.aspect},110:function(e,n){var l;l="ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=",_.extend(BI,{encode:function(e){var n,t,r,a,i,o,s,u="",c=0;for(e=function(e){e=e.replace(/\r\n/g,"\n");for(var n="",t=0;t<e.length;t++){var r=e.charCodeAt(t);r<128?n+=String.fromCharCode(r):(127<r&&r<2048?n+=String.fromCharCode(r>>6|192):(n+=String.fromCharCode(r>>12|224),n+=String.fromCharCode(r>>6&63|128)),n+=String.fromCharCode(63&r|128))}return n}(e);c<e.length;)a=(n=e.charCodeAt(c++))>>2,i=(3&n)<<4|(t=e.charCodeAt(c++))>>4,o=(15&t)<<2|(r=e.charCodeAt(c++))>>6,s=63&r,isNaN(t)?o=s=64:isNaN(r)&&(s=64),u=u+l.charAt(a)+l.charAt(i)+l.charAt(o)+l.charAt(s);return u},decode:function(e){var n,t,r,a,i,o,s="",u=0;for(e=e.replace(/[^A-Za-z0-9\+\/\=]/g,"");u<e.length;)n=l.indexOf(e.charAt(u++))<<2|(a=l.indexOf(e.charAt(u++)))>>4,t=(15&a)<<4|(i=l.indexOf(e.charAt(u++)))>>2,r=(3&i)<<6|(o=l.indexOf(e.charAt(u++))),s+=String.fromCharCode(n),64!=i&&(s+=String.fromCharCode(t)),64!=o&&(s+=String.fromCharCode(r));return s=function(e){for(var n,t,r="",a=0,i=0;a<e.length;)(n=e.charCodeAt(a))<128?(r+=String.fromCharCode(n),a++):191<n&&n<224?(i=e.charCodeAt(a+1),r+=String.fromCharCode((31&n)<<6|63&i),a+=2):(i=e.charCodeAt(a+1),t=e.charCodeAt(a+2),r+=String.fromCharCode((15&n)<<12|(63&i)<<6|63&t),a+=3);return r}(s)}})},111:function(e,n){BI.Cache={_prefix:"bi",setUsername:function(e){localStorage.setItem(BI.Cache._prefix+".username",(e+""||"").toUpperCase())},getUsername:function(){return localStorage.getItem(BI.Cache._prefix+".username")||""},_getKeyPrefix:function(){return BI.Cache.getUsername()+"."+BI.Cache._prefix+"."},_generateKey:function(e){return BI.Cache._getKeyPrefix()+(e||"")},getItem:function(e){return localStorage.getItem(BI.Cache._generateKey(e))},setItem:function(e,n){localStorage.setItem(BI.Cache._generateKey(e),n)},removeItem:function(e){localStorage.removeItem(BI.Cache._generateKey(e))},clear:function(){for(var e=localStorage.length;0<=e;e--){var n=localStorage.key(e);n&&0===n.indexOf(BI.Cache._getKeyPrefix())&&localStorage.removeItem(n)}},keys:function(){for(var e=[],n=localStorage.length;0<=n;n--){var t,r=localStorage.key(n);r&&(t=BI.Cache._getKeyPrefix(),0===r.indexOf(t)&&(e[e.length]=r.substring(t.length)))}return e},addCookie:function(e,n,t,r){var a,i=e+"="+escape(n);r&&0<r&&((a=new Date).setTime(a.getTime()+3600*r*1e3),i=i+"; expires="+a.toUTCString()),t&&(i=i+"; path="+t),document.cookie=i},getCookie:function(e){var n,t=new RegExp("(^| )"+e+"=([^;]*)(;|$)");return(n=document.cookie.match(t))?unescape(n[2]):null},deleteCookie:function(e,n){var t=new Date;t.setTime(t.getTime()-1e4);var r=e+"=v; expires="+t.toUTCString();n&&(r=r+"; path="+n),document.cookie=r}}},112:function(e,n){BI.CellSizeAndPositionManager=function(e,n,t){this._cellSizeGetter=n,this._cellCount=e,this._estimatedCellSize=t,this._cellSizeAndPositionData={},this._lastMeasuredIndex=-1},BI.CellSizeAndPositionManager.prototype={constructor:BI.CellSizeAndPositionManager,configure:function(e,n){this._cellCount=e,this._estimatedCellSize=n},getCellCount:function(){return this._cellCount},getEstimatedCellSize:function(){return this._estimatedCellSize},getLastMeasuredIndex:function(){return this._lastMeasuredIndex},getSizeAndPositionOfCell:function(e){if(!(e<0||e>=this._cellCount)){if(e>this._lastMeasuredIndex){for(var n=this.getSizeAndPositionOfLastMeasuredCell(),t=n.offset+n.size,r=this._lastMeasuredIndex+1;r<=e;r++){var a=this._cellSizeGetter(r);null==a||isNaN(a)||(this._cellSizeAndPositionData[r]={offset:t,size:a},t+=a)}this._lastMeasuredIndex=e}return this._cellSizeAndPositionData[e]}},getSizeAndPositionOfLastMeasuredCell:function(){return 0<=this._lastMeasuredIndex?this._cellSizeAndPositionData[this._lastMeasuredIndex]:{offset:0,size:0}},getTotalSize:function(){var e=this.getSizeAndPositionOfLastMeasuredCell();return e.offset+e.size+(this._cellCount-this._lastMeasuredIndex-1)*this._estimatedCellSize},getUpdatedOffsetForIndex:function(e,n,t,r){var a,i=this.getSizeAndPositionOfCell(r),o=i.offset,s=o-n+i.size;switch(e){case"start":a=o;break;case"end":a=s;break;case"center":a=o-(n-i.size)/2;break;default:a=Math.max(s,Math.min(o,t))}var u=this.getTotalSize();return Math.max(0,Math.min(u-n,a))},getVisibleCellRange:function(e,n){if(0===this.getTotalSize())return{};var t=n+e,r=this._findNearestCell(n),a=this.getSizeAndPositionOfCell(r);n=a.offset+a.size;for(var i=r;n<t&&i<this._cellCount-1;)i++,n+=this.getSizeAndPositionOfCell(i).size;return{start:r,stop:i}},resetCell:function(e){this._lastMeasuredIndex=Math.min(this._lastMeasuredIndex,e-1)},_binarySearch:function(e,n,t){for(var r,a;n<=e;){if(r=n+Math.floor((e-n)/2),(a=this.getSizeAndPositionOfCell(r).offset)===t)return r;a<t?n=r+1:t<a&&(e=r-1)}if(0<n)return n-1},_exponentialSearch:function(e,n){for(var t=1;e<this._cellCount&&this.getSizeAndPositionOfCell(e).offset<n;)e+=t,t*=2;return this._binarySearch(Math.min(e,this._cellCount-1),Math.floor(e/2),n)},_findNearestCell:function(e){if(!isNaN(e)){e=Math.max(0,e);var n=this.getSizeAndPositionOfLastMeasuredCell(),t=Math.max(0,this._lastMeasuredIndex);return n.offset>=e?this._binarySearch(t,0,e):this._exponentialSearch(t,e)}}},BI.ScalingCellSizeAndPositionManager=function(e,n,t,r){this._cellSizeAndPositionManager=new BI.CellSizeAndPositionManager(e,n,t),this._maxScrollSize=r||1e7},BI.ScalingCellSizeAndPositionManager.prototype={constructor:BI.ScalingCellSizeAndPositionManager,configure:function(){this._cellSizeAndPositionManager.configure.apply(this._cellSizeAndPositionManager,arguments)},getCellCount:function(){return this._cellSizeAndPositionManager.getCellCount()},getEstimatedCellSize:function(){return this._cellSizeAndPositionManager.getEstimatedCellSize()},getLastMeasuredIndex:function(){return this._cellSizeAndPositionManager.getLastMeasuredIndex()},getOffsetAdjustment:function(e,n){var t=this._cellSizeAndPositionManager.getTotalSize(),r=this.getTotalSize(),a=this._getOffsetPercentage(e,n,r);return Math.round(a*(r-t))},getSizeAndPositionOfCell:function(e){return this._cellSizeAndPositionManager.getSizeAndPositionOfCell(e)},getSizeAndPositionOfLastMeasuredCell:function(){return this._cellSizeAndPositionManager.getSizeAndPositionOfLastMeasuredCell()},getTotalSize:function(){return Math.min(this._maxScrollSize,this._cellSizeAndPositionManager.getTotalSize())},getUpdatedOffsetForIndex:function(e,n,t,r){t=this._safeOffsetToOffset(n,t);var a=this._cellSizeAndPositionManager.getUpdatedOffsetForIndex(e,n,t,r);return this._offsetToSafeOffset(n,a)},getVisibleCellRange:function(e,n){return n=this._safeOffsetToOffset(e,n),this._cellSizeAndPositionManager.getVisibleCellRange(e,n)},resetCell:function(e){this._cellSizeAndPositionManager.resetCell(e)},_getOffsetPercentage:function(e,n,t){return t<=e?0:n/(t-e)},_offsetToSafeOffset:function(e,n){var t=this._cellSizeAndPositionManager.getTotalSize(),r=this.getTotalSize();if(t===r)return n;var a=this._getOffsetPercentage(e,n,t);return Math.round(a*(r-e))},_safeOffsetToOffset:function(e,n){var t=this._cellSizeAndPositionManager.getTotalSize(),r=this.getTotalSize();if(t===r)return n;var a=this._getOffsetPercentage(e,n,r);return Math.round(a*(t-e))}}},113:function(e,n){var u;u={19969:"DZ",19975:"WM",19988:"QJ",20048:"YL",20056:"SC",20060:"NM",20094:"QG",20127:"QJ",20167:"QC",20193:"YG",20250:"KH",20256:"ZC",20282:"SC",20285:"QJG",20291:"TD",20314:"YD",20315:"BF",20340:"NE",20375:"TD",20389:"YJ",20391:"CZ",20415:"PB",20446:"YS",20447:"SQ",20504:"TC",20608:"KG",20854:"QJ",20857:"ZC",20911:"PF",20985:"AW",21032:"PB",21048:"XQ",21049:"SC",21089:"YS",21119:"JC",21242:"SB",21273:"SC",21305:"YP",21306:"QO",21330:"ZC",21333:"SDC",21345:"QK",21378:"CA",21397:"SC",21414:"XS",21442:"SC",21477:"JG",21480:"TD",21484:"ZS",21494:"YX",21505:"YX",21512:"HG",21523:"XH",21537:"PB",21542:"PF",21549:"KH",21571:"E",21574:"DA",21588:"TD",21589:"O",21618:"ZC",21621:"KHA",21632:"ZJ",21654:"KG",21679:"LKG",21683:"KH",21710:"A",21719:"YH",21734:"WOE",21769:"A",21780:"WN",21804:"XH",21834:"A",21899:"ZD",21903:"RN",21908:"WO",21939:"ZC",21956:"SA",21964:"YA",21970:"TD",22003:"A",22031:"JG",22040:"XS",22060:"ZC",22066:"ZC",22079:"MH",22129:"XJ",22179:"XA",22237:"NJ",22244:"TD",22280:"JQ",22300:"YH",22313:"XW",22331:"YQ",22343:"YJ",22351:"PH",22395:"DC",22412:"TD",22484:"PB",22500:"PB",22534:"ZD",22549:"DH",22561:"PB",22612:"TD",22771:"KQ",22831:"HB",22841:"JG",22855:"QJ",22865:"XQ",23013:"ML",23081:"WM",23487:"SX",23558:"QJ",23561:"YW",23586:"YW",23614:"YW",23615:"SN",23631:"PB",23646:"ZS",23663:"ZT",23673:"YG",23762:"TD",23769:"ZS",23780:"QJ",23884:"QK",24055:"XH",24113:"DC",24162:"ZC",24191:"GA",24273:"QJ",24324:"NL",24377:"TD",24378:"QJ",24439:"PF",24554:"ZS",24683:"TD",24694:"WE",24733:"LK",24925:"TN",25094:"ZG",25100:"XQ",25103:"XH",25153:"PB",25170:"PB",25179:"KG",25203:"PB",25240:"ZS",25282:"FB",25303:"NA",25324:"KG",25341:"ZY",25373:"WZ",25375:"XJ",25384:"A",25457:"A",25528:"SD",25530:"SC",25552:"TD",25774:"ZC",25874:"ZC",26044:"YW",26080:"WM",26292:"PB",26333:"PB",26355:"ZY",26366:"CZ",26397:"ZC",26399:"QJ",26415:"ZS",26451:"SB",26526:"ZC",26552:"JG",26561:"TD",26588:"JG",26597:"CZ",26629:"ZS",26638:"YL",26646:"XQ",26653:"KG",26657:"XJ",26727:"HG",26894:"ZC",26937:"ZS",26946:"ZC",26999:"KJ",27099:"KJ",27449:"YQ",27481:"XS",27542:"ZS",27663:"ZS",27748:"TS",27784:"SC",27788:"ZD",27795:"TD",27812:"O",27850:"PB",27852:"MB",27895:"SL",27898:"PL",27973:"QJ",27981:"KH",27986:"HX",27994:"XJ",28044:"YC",28065:"WG",28177:"SM",28267:"QJ",28291:"KH",28337:"ZQ",28463:"TL",28548:"DC",28601:"TD",28689:"PB",28805:"JG",28820:"QG",28846:"PB",28952:"TD",28975:"ZC",29100:"A",29325:"QJ",29575:"SL",29602:"FB",30010:"TD",30044:"CX",30058:"PF",30091:"YSP",30111:"YN",30229:"XJ",30427:"SC",30465:"SX",30631:"YQ",30655:"QJ",30684:"QJG",30707:"SD",30729:"XH",30796:"LG",30917:"PB",31074:"NM",31085:"JZ",31109:"SC",31181:"ZC",31192:"MLB",31293:"JQ",31400:"YX",31584:"YJ",31896:"ZN",31909:"ZY",31995:"XJ",32321:"PF",32327:"ZY",32418:"HG",32420:"XQ",32421:"HG",32438:"LG",32473:"GJ",32488:"TD",32521:"QJ",32527:"PB",32562:"ZSQ",32564:"JZ",32735:"ZD",32793:"PB",33071:"PF",33098:"XL",33100:"YA",33152:"PB",33261:"CX",33324:"BP",33333:"TD",33406:"YA",33426:"WM",33432:"PB",33445:"JG",33486:"ZN",33493:"TS",33507:"QJ",33540:"QJ",33544:"ZC",33564:"XQ",33617:"YT",33632:"QJ",33636:"XH",33637:"YX",33694:"WG",33705:"PF",33728:"YW",33882:"SR",34067:"WM",34074:"YW",34121:"QJ",34255:"ZC",34259:"XL",34425:"JH",34430:"XH",34485:"KH",34503:"YS",34532:"HG",34552:"XS",34558:"YE",34593:"ZL",34660:"YQ",34892:"XH",34928:"SC",34999:"QJ",35048:"PB",35059:"SC",35098:"ZC",35203:"TQ",35265:"JX",35299:"JX",35782:"SZ",35828:"YS",35830:"E",35843:"TD",35895:"YG",35977:"MH",36158:"JG",36228:"QJ",36426:"XQ",36466:"DC",36710:"CJ",36711:"ZYG",36767:"PB",36866:"SK",36951:"YW",37034:"YX",37063:"XH",37218:"ZC",37325:"ZC",38063:"PB",38079:"TD",38085:"QY",38107:"DC",38116:"TD",38123:"YD",38224:"HG",38241:"XTC",38271:"ZC",38415:"YE",38426:"KH",38461:"YD",38463:"AE",38466:"PB",38477:"XJ",38518:"YT",38551:"WK",38585:"ZC",38704:"XS",38739:"LJ",38761:"GJ",38808:"SQ",39048:"JG",39049:"XJ",39052:"HG",39076:"CZ",39271:"XT",39534:"TD",39552:"TD",39584:"PB",39647:"SB",39730:"LG",39748:"TPB",40109:"ZQ",40479:"ND",40516:"HG",40536:"HG",40583:"QJ",40765:"YQ",40784:"QJ",40840:"YK",40863:"QJG"},_.extend(BI,{makeFirstPY:function(e,n){if(n=n||{},"string"!=typeof e)return""+e;for(var t,r,a=[],i=0,o=e.length;i<o;i++){var s=e.charAt(i);a.push((r=void 0,40869<(r=(t=s).charCodeAt(0))||r<19968?t:u[r]?u[r]:"YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY".charAt(r-19968)))}return function(e,n){for(var t=n.ignoreMulti,r=n.splitChar,a=[""],i=0,o=0,s=e.length;o<s;o++){var u=e[o],c=u.length;if(1==c||14<i||t)for(var l=u.substring(0,1),h=0;h<a.length;h++)a[h]+=l;else{var p=a.slice(0),a=[];for(i++,h=0;h<c;h++){for(var f=p.slice(0),d=0;d<f.length;d++)f[d]+=u.charAt(h);a=a.concat(f)}}}return a.join(r||"").toLowerCase()}(a,n)}})},114:function(e,n){function t(e,n){return e<n}BI.Heap=function(e,n){this._items=e||[],this._size=this._items.length,this._comparator=n||t,this._heapify()},BI.Heap.prototype={constructor:BI.Heap,empty:function(){return 0===this._size},pop:function(){if(0!==this._size){var e=this._items[0],n=this._items.pop();return this._size--,0<this._size&&(this._items[0]=n,this._sinkDown(0)),e}},push:function(e){this._items[this._size++]=e,this._bubbleUp(this._size-1)},size:function(){return this._size},peek:function(){if(0!==this._size)return this._items[0]},_heapify:function(){for(var e=Math.floor((this._size+1)/2);0<=e;e--)this._sinkDown(e)},_bubbleUp:function(e){for(var n=this._items[e];0<e;){var t=Math.floor((e+1)/2)-1,r=this._items[t];if(this._comparator(r,n))return;this._items[t]=n,this._items[e]=r,e=t}},_sinkDown:function(e){for(var n=this._items[e];;){var t,r,a=2*(e+1)-1,i=2*(e+1),o=-1;if(a<this._size&&(t=this._items[a],this._comparator(t,n)&&(o=a)),i<this._size&&(r=this._items[i],this._comparator(r,n)&&(-1!==o&&!this._comparator(r,this._items[o])||(o=i))),-1===o)return;this._items[e]=this._items[o],this._items[o]=n,e=o}}}},115:function(e,n){BI.LinkHashMap=function(){this.array=[],this.map={}},BI.LinkHashMap.prototype={constructor:BI.LinkHashMap,has:function(e){return e in this.map},add:function(e,n){void 0!==e&&(e in this.map||this.array.push(e),this.map[e]=n)},remove:function(e){if(e in this.map){delete this.map[e];for(var n=0;n<this.array.length;n++)if(this.array[n]==e){this.array.splice(n,1);break}}},size:function(){return this.array.length},each:function(e,n){n=n||window;if(null!=(e=e||null)&&"function"==typeof e)for(var t=0;t<this.array.length;t++){var r=this.array[t],a=this.map[r];if(0==e.call(n,r,a,t,this.array,this.map))break}},get:function(e){return this.map[e]},toArray:function(){var t=[];return this.each(function(e,n){t.push(n)}),t}}},116:function(e,n){!function(){BI.LRU=function(e){this.size=0,this.limit=e,this.head=this.tail=undefined,this._keymap={}};var e=BI.LRU.prototype;e.put=function(e,n){var t;this.size===this.limit&&(t=this.shift());var r=this.get(e,!0);return r||(r={key:e},this._keymap[e]=r,this.tail?(this.tail.newer=r).older=this.tail:this.head=r,this.tail=r,this.size++),r.value=n,t},e.shift=function(){var e=this.head;return e&&(this.head=this.head.newer,this.head.older=undefined,e.newer=e.older=undefined,this._keymap[e.key]=undefined,this.size--),e},e.get=function(e,n){var t=this._keymap[e];if(t!==undefined)return t===this.tail||(t.newer&&(t===this.head&&(this.head=t.newer),t.newer.older=t.older),t.older&&(t.older.newer=t.newer),t.newer=undefined,t.older=this.tail,this.tail&&(this.tail.newer=t),this.tail=t),n?t:t.value},e.has=function(e){return null!=this._keymap[e]}}()},117:function(e,n){var r,t;r=function(e){return Math.floor(e/2)},t=_global.Int32Array||function(e){for(var n=[],t=e-1;0<=t;--t)n[t]=0;return n},BI.PrefixIntervalTree=function(e){var n;for(this._size=e.length,this._half=function(e){for(var n=1;n<e;)n*=2;return n}(this._size),this._heap=new t(2*this._half),n=0;n<this._size;++n)this._heap[this._half+n]=e[n];for(n=this._half-1;0<n;--n)this._heap[n]=this._heap[2*n]+this._heap[2*n+1]},BI.PrefixIntervalTree.prototype={constructor:BI.PrefixIntervalTree,set:function(e,n){var t=this._half+e;for(this._heap[t]=n,t=r(t);0!==t;t=r(t))this._heap[t]=this._heap[2*t]+this._heap[2*t+1]},get:function(e){var n=this._half+e;return this._heap[n]},getSize:function(){return this._size},sumUntil:function(e){if(0===e)return 0;for(var n=this._half+e-1,t=this._heap[n];1!==n;n=r(n))n%2==1&&(t+=this._heap[n-1]);return t},sumTo:function(e){return this.sumUntil(e+1)},sum:function(e,n){return this.sumUntil(n)-this.sumUntil(e)},greatestLowerBound:function(e){if(e<0)return-1;var n=1;if(this._heap[n]<=e)return this._size;for(;n<this._half;){var t=this._heap[2*n];e<t?n*=2:(n=2*n+1,e-=t)}return n-this._half},greatestStrictLowerBound:function(e){if(e<=0)return-1;var n=1;if(this._heap[n]<e)return this._size;for(;n<this._half;){var t=this._heap[2*n];e<=t?n*=2:(n=2*n+1,e-=t)}return n-this._half},leastUpperBound:function(e){return this.greatestStrictLowerBound(e)+1},leastStrictUpperBound:function(e){return this.greatestLowerBound(e)+1}},BI.PrefixIntervalTree.uniform=function(e,n){for(var t=[],r=e-1;0<=r;--r)t[r]=n;return new BI.PrefixIntervalTree(t)},BI.PrefixIntervalTree.empty=function(e){return BI.PrefixIntervalTree.uniform(e,0)}},118:function(e,n){BI.Queue=function(e){this.capacity=e,this.array=[]},BI.Queue.prototype={constructor:BI.Queue,contains:function(e){return BI.contains(this.array,e)},indexOf:function(e){return BI.contains(this.array,e)},getElementByIndex:function(e){return this.array[e]},push:function(e){this.array.push(e),this.capacity&&this.array.length>this.capacity&&this.array.shift()},pop:function(){this.array.pop()},shift:function(){this.array.shift()},unshift:function(e){this.array.unshift(e),this.capacity&&this.array.length>this.capacity&&this.array.pop()},remove:function(e){BI.remove(this.array,e)},splice:function(){this.array.splice.apply(this.array,arguments)},slice:function(){this.array.slice.apply(this.array,arguments)},size:function(){return this.array.length},each:function(e,n){n=n||window;if(null!=(e=e||null)&&"function"==typeof e)for(var t=0;t<this.array.length;t++){if(0==e.call(n,t,this.array[t],this.array))break}},toArray:function(){return this.array},fromArray:function(e){var t=this;BI.each(e,function(e,n){t.push(n)})},clear:function(){this.array.length=0}}},119:function(e,n){!function(){var p=function(e,n,t,r){this.height=e,this.width=n,this.x=t,this.y=r,this._indexMap={},this._indices=[]};p.prototype={constructor:p,addCellIndex:function(e){this._indexMap[e]||(this._indexMap[e]=!0,this._indices.push(e))},getCellIndices:function(){return this._indices}};BI.SectionManager=function(e){this._sectionSize=e||100,this._cellMetadata=[],this._sections={}},BI.SectionManager.prototype={constructor:BI.SectionManager,getCellIndices:function(e,n,t,r){var a={};return BI.each(this.getSections(e,n,t,r),function(e,n){BI.each(n.getCellIndices(),function(e,n){a[n]=n})}),BI.map(BI.keys(a),function(e,n){return a[n]})},getCellMetadata:function(e){return this._cellMetadata[e]},getSections:function(e,n,t,r){for(var a=Math.floor(t/this._sectionSize),i=Math.floor((t+n-1)/this._sectionSize),o=Math.floor(r/this._sectionSize),s=Math.floor((r+e-1)/this._sectionSize),u=[],c=a;c<=i;c++)for(var l=o;l<=s;l++){var h=c+"."+l;this._sections[h]||(this._sections[h]=new p(this._sectionSize,this._sectionSize,c*this._sectionSize,l*this._sectionSize)),u.push(this._sections[h])}return u},getTotalSectionCount:function(){return BI.size(this._sections)},registerCell:function(e,t){this._cellMetadata[t]=e,BI.each(this.getSections(e.height,e.width,e.x,e.y),function(e,n){n.addCellIndex(t)})}}}()},120:function(e,n){BI.Tree=function(){this.root=new BI.Node(BI.UUID())},BI.Tree.prototype={constructor:BI.Tree,addNode:function(e,n,t){BI.isNull(n)?this.root.addChild(e,t):BI.isNull(e)?this.root.addChild(n,t):e.addChild(n,t)},isRoot:function(e){return e===this.root},getRoot:function(){return this.root},clear:function(){this.root.clear()},initTree:function(e){var r=this;this.clear();var a=[];for(BI.each(e,function(e,n){var t=new BI.Node(n);t.set("data",n),r.addNode(t),a.push(t)});!BI.isEmpty(a);){var i=a.shift(),n=i.get("data");BI.each(n.children,function(e,n){var t=new BI.Node(n);t.set("data",n),a.push(t),r.addNode(i,t)})}},_toJSON:function(e){var t=this,r=[];return BI.each(e.getChildren(),function(e,n){r.push(t._toJSON(n))}),BI.extend({id:e.id},BI.deepClone(e.get("data")),0<r.length?{children:r}:{})},toJSON:function(e){var t=this,r=[];return BI.each((e||this.root).getChildren(),function(e,n){r.push(t._toJSON(n))}),r},_toJSONWithNode:function(e){var t=this,r=[];return BI.each(e.getChildren(),function(e,n){r.push(t._toJSONWithNode(n))}),BI.extend({id:e.id},BI.deepClone(e.get("data")),{node:e},0<r.length?{children:r}:{})},toJSONWithNode:function(e){var t=this,r=[];return BI.each((e||this.root).getChildren(),function(e,n){r.push(t._toJSONWithNode(n))}),r},search:function(e,t,r){if(!(e instanceof BI.Node))return arguments.callee.apply(this,[this.root,e,t]);var a=this,i=null;return BI.isNull(t)?null:BI.isEqual(e[r||"id"],t)?e:(BI.any(e.getChildren(),function(e,n){if(null!==(i=a.search(n,t,r)))return!0}),i)},_traverse:function(e,n){var t=[];for(t.push(e);!BI.isEmpty(t);){var r=t.shift(),a=n&&n(r);if(!1===a)break;!0!==a&&null!=r&&(t=t.concat(r.getChildren()))}},traverse:function(e){this._traverse(this.root,e)},_recursion:function(e,a,i){var o=this;return BI.every(e.getChildren(),function(e,n){var t=BI.clone(a);t.push(n.id);var r=i&&i(n,t);return!1!==r&&(!0===r||o._recursion(n,t,i))})},recursion:function(e){this._recursion(this.root,[],e)},inOrderTraverse:function(e){this._inOrderTraverse(this.root,e)},_inOrderTraverse:function(e,n){null!=e&&(this._inOrderTraverse(e.getLeft()),n&&n(e),this._inOrderTraverse(e.getRight()))},nrInOrderTraverse:function(e){for(var n=[],t=this.root;null!=t||!BI.isEmpty(n);){for(;null!=t;)n.push(t),t=t.getLeft();t=n.pop(),e&&e(t),t=t.getRight()}},preOrderTraverse:function(e){this._preOrderTraverse(this.root,e)},_preOrderTraverse:function(e,n){null!=e&&(n&&n(e),this._preOrderTraverse(e.getLeft()),this._preOrderTraverse(e.getRight()))},nrPreOrderTraverse:function(e){for(var n=[],t=this.root;null!=t||!BI.isEmpty(n);){for(;null!=t;)e&&e(t),n.push(t),t=t.getLeft();t=(t=n.pop()).getRight()}},postOrderTraverse:function(e){this._postOrderTraverse(this.root,e)},_postOrderTraverse:function(e,n){null!=e&&(this._postOrderTraverse(e.getLeft()),this._postOrderTraverse(e.getRight()),n&&n(e))},nrPostOrderTraverse:function(e){for(var n=[],t=this.root,r=null;null!=t||!BI.isEmpty(n);){for(;null!=t;)n.push(t),t=t.getLeft();t=null==(t=BI.last(n)).getRight()||t.getRight()==r?(e&&e(t),r=t=n.pop(),null):t.getRight()}}},BI.Node=function(e){BI.isObject(e)?BI.extend(this,e):this.id=e,this.clear.apply(this,arguments)},BI.Node.prototype={constructor:BI.Node,set:function(e,n){BI.isObject(e)?BI.extend(this,e):this[e]=n},get:function(e){return this[e]},isLeaf:function(){return BI.isEmpty(this.children)},getChildren:function(){return this.children},getChildrenLength:function(){return this.children.length},getFirstChild:function(){return BI.first(this.children)},getLastChild:function(){return BI.last(this.children)},setLeft:function(e){this.left=e},getLeft:function(){return this.left},setRight:function(e){this.right=e},getRight:function(){return this.right},setParent:function(e){this.parent=e},getParent:function(){return this.parent},getChild:function(e){return this.children[e]},getChildIndex:function(t){return BI.findIndex(this.children,function(e,n){return n.get("id")===t})},removeChild:function(e){this.removeChildByIndex(this.getChildIndex(e))},removeChildByIndex:function(e){var n=this.getChild(e-1),t=this.getChild(e+1);null!=n&&n.setRight(t||null),null!=t&&t.setLeft(n||null),this.children.splice(e,1)},removeAllChilds:function(){this.children=[]},addChild:function(e,n){var t=null,t=BI.isUndefined(n)?this.children.length-1:n-1;e.setParent(this),0<=t&&(this.getChild(t)&&this.getChild(t).setRight(e),e.setLeft(this.getChild(t))),BI.isUndefined(n)?this.children.push(e):this.children.splice(n,0,e)},equals:function(e){return this===e||this.id===e.id},clear:function(){this.parent=null,this.left=null,this.right=null,this.children=[]}},BI.extend(BI.Tree,{transformToArrayFormat:function(e,n){if(!e)return[];var t=[];if(BI.isArray(e))for(var r=0,a=e.length;r<a;r++){var i=BI.clone(e[r]);i.pId=null==i.pId?n:i.pId,delete i.children,t.push(i),e[r].children&&(t=t.concat(BI.Tree.transformToArrayFormat(e[r].children,i.id)))}else{var o=BI.clone(e);o.pId=null==o.pId?n:o.pId,delete o.children,t.push(o),e.children&&(t=t.concat(BI.Tree.transformToArrayFormat(e.children,o.id)))}return t},arrayFormat:function(e,n){if(!e)return[];var t=[];if(BI.isArray(e))for(var r=0,a=e.length;r<a;r++){var i=e[r];i.pId=null==i.pId?n:i.pId,t.push(i),e[r].children&&(t=t.concat(BI.Tree.arrayFormat(e[r].children,i.id)))}else{var o=e;o.pId=null==o.pId?n:o.pId,t.push(o),e.children&&(t=t.concat(BI.Tree.arrayFormat(e.children,o.id)))}return t},transformToTreeFormat:function(e){if(!e)return[];if(BI.isArray(e)){for(var n=[],t={},r=0,a=e.length;r<a;r++){if(BI.isNull(e[r].id))return e;t[e[r].id]=BI.clone(e[r])}for(r=0,a=e.length;r<a;r++)t[e[r].pId]&&e[r].id!==e[r].pId?(t[e[r].pId].children||(t[e[r].pId].children=[]),t[e[r].pId].children.push(t[e[r].id])):n.push(t[e[r].id]),delete t[e[r].id].pId;return n}return[e]},treeFormat:function(e){if(!e)return[];if(BI.isArray(e)){for(var n=[],t={},r=0,a=e.length;r<a;r++){if(BI.isNull(e[r].id))return e;t[e[r].id]=e[r]}for(r=0,a=e.length;r<a;r++)t[e[r].pId]&&e[r].id!==e[r].pId?(t[e[r].pId].children||(t[e[r].pId].children=[]),t[e[r].pId].children.push(t[e[r].id])):n.push(t[e[r].id]);return n}return[e]},traversal:function(e,t){var r;BI.isNull(e)||(r=this,BI.some(e,function(e,n){return!1===t(e,n)||void r.traversal(n.children,t)}))}})},121:function(e,n){BI.Vector=function(e,n){this.x=e,this.y=n},BI.Vector.prototype={constructor:BI.Vector,cross:function(e){return this.x*e.y-this.y*e.x},length:function(e){return Math.sqrt(this.x*e.x+this.y*e.y)}},BI.Region=function(e,n,t,r){this.x=e,this.y=n,this.w=t,this.h=r},BI.Region.prototype={constructor:BI.Region,isIntersects:function(e){if(this.isPointInside(e.x,e.y)||this.isPointInside(e.x+e.w,e.y)||this.isPointInside(e.x,e.y+e.h)||this.isPointInside(e.x+e.w,e.y+e.h))return!0;if(e.isPointInside(this.x,this.y)||e.isPointInside(this.x+this.w,this.y)||e.isPointInside(this.x,this.y+this.h)||e.isPointInside(this.x+this.w,this.y+this.h))return!0;if(null!=e.x&&null!=e.y){var n=new BI.Vector(this.w,this.h),t=new BI.Vector(e.x-this.x,e.y-this.y),r=new BI.Vector(t.x+e.w,t.y+e.h);if(n.cross(t)*n.cross(r)<0)return!0}return!1},isPointInside:function(e,n){return null!=this.x&&null!=this.y&&(e>=this.x&&e<=this.x+this.w&&n>=this.y&&n<=this.y+this.h)},getPosition:function(){var e=[];return e.push(this.x+this.w/2),e.push(this.y+this.h/2),e}}},122:function(module,exports,__webpack_require__){(function(global){!function(){var _global;function isEmpty(e){return""===e||null===e||e===undefined}function isInvalidDate(e){return"Invalid Date"==e||"NaN"==e}function _eFormat(e,n){return function(e,n){var t=e<0?(e*=-1,"-"):"",r="",a=Math[0<e&&e<1?"floor":"ceil"](Math.log(e)/Math.log(10));if(!isFinite(a))return n.replace(/#/gi,"").replace(/\.e/gi,"E");0<(e/=Math.pow(10,a))&&e<1&&(e*=10,--a);var i=function(e,n){if(!/e/gi.test(n))return 0;var t,r,a=n.split(/e/gi)[0].split(".")[0],i=a.length,o=0;for(t=0;t<i;t++)(0==(r=a.charAt(t))||"#"==r&&i-t<=e+1)&&o++;return o}(a,n);1<i&&(a-=i-1,e*=Math.pow(10,i-1)),a<0&&(r="-",a*=-1);var o=function(e){if(!/e/gi.test(e))return 0;var n=e.split(/e/gi)[0].split(".");return 1<n.length?n[1].length:0}(n),s=function(e){var n=Math.round(e);return e=(e+"").split(".")[0],n=(n+"").split(".")[0],e.length!==n.length}(e);return e*=Math.pow(10,o),e=Math.round(e),s&&(e/=10,a+="-"===r?-1:1),e=(e/=Math.pow(10,o)).toFixed(o),a=function(e,n,t){if(n+="",!/e/gi.test(e))return n;e=e.split(/e/gi)[1];for(;n.length<e.length;)n="0"+n;for(var r=!0,a=0,i=n.length;a<i;a++)r=r&&"0"===n.charAt(a);return(t=r?"":t)+n}(n,a,r),t+e+"E"+a}(e=+e,n)}function _dealNumberPrecision(e,n){if(/[eE]/.test(e)){var t,r=0,a=0;/[%‰]$/.test(n)&&(r=/[%]$/.test(n)?2:3);for(var i=n.length;a<i;a++)"0"!=(t=n.charAt(a))&&"#"!=t||r++;return Number(e).toFixed(r)}return e}function _numberFormat(e,n){if(!/[0-9]/.test(e=e+"")||!n)return e;var t=n.indexOf(";");if(-1<t)return 0<=e?_numberFormat(e+"",n.substring(0,t)):_numberFormat(-e+"",n.substr(t+1));if(+e<0&&"-"!==n.charAt(0))return _numberFormat(-e+"","-"+n);var r,a=n.split("."),i=a[0]||"",o=a[1]||"",s=(e=_dealNumberPrecision(e,o)).split("."),u=s[0]||"",c=s[1]||"";/[%‰]$/.test(n)&&(u=(u+=(c+=r=/[%]$/.test(n)?"00":"000").substr(0,r.length)).replace(/^0+/gi,""),c=c.substr(r.length).replace(/0+$/gi,""));var l=_dealWithRight(c,o);l.leftPlus&&(u=parseInt(u)+1+"",u=isNaN(u)?"1":u),l=l.num;var h=_dealWithLeft(u,i);return/[0-9]/.test(h)||(h+="0"),/[0-9]/.test(l)?h+"."+l:h+l}function _dealWithRight(e,n){for(var t="",r=0,a=0,i=n.length;a<i;a++){var o=n.charAt(a),s=e.charAt(r);switch(o){case"0":isEmpty(s)&&(s="0"),t+=s,r++;break;case"#":t+=s,r++;break;default:t+=o}}var u,c,l,h,p=e.substr(r),f={};return!isEmpty(p)&&4<p.charAt(0)&&(f.leftPlus=!0,(u=t.match(/^[0-9]+/))&&(l=(c=u[0]).length,(h=parseInt(c)+1+"").length>l?h=h.substr(1):(h=BI.leftPad(h,l,"0"),f.leftPlus=!1),t=t.replace(/^[0-9]+/,h))),f.num=t,f}function _dealWithLeft(e,n){for(var t,r="",a=e.length-1,i=-1,o=-1,s=n.length-1;0<=s;s--){var u,c=n.charAt(s),l=e.charAt(a);switch(c){case"0":isEmpty(l)&&(l="0"),o=-1,r=l+r,a--;break;case"#":o=s,r=l+r,a--;break;case",":isEmpty(l)||((u=n.match(/,[#0]+/))&&(i=u[0].length-1),r=","+r);break;default:r=c+r}}if(-1<o&&(t=e.substr(0,a+1),r=r.substr(0,o)+t+r.substr(o)),0<i){var h=r.match(/[0-9]+,/);if(h){for(var p="",f=(h=h[0]).length-1-i;0<=f;f-=i)p=h.substr(f,i)+","+p;var d=h.substr(0,f+i);isEmpty(d)||(p=d+","+p)}r=r.replace(/[0-9]+,/,p)}return r}_global="undefined"!=typeof window?window:void 0!==global?global:"undefined"!=typeof self?self:this,_global.BI||(_global.BI={}),BI.cjkEncode=function(e){if("string"!=typeof e)return e;for(var n="",t=0;t<e.length;t++){var r=e.charCodeAt(t);n+=128<=r||91===r||93===r?"["+r.toString(16)+"]":e.charAt(t)}return n},BI.cjkDecode=function(text){if(null==text)return"";if(!isNaN(text)||-1==text.indexOf("["))return text;for(var newText="",i=0;i<text.length;i++){var ch=text.charAt(i),rightIdx,subText;"["==ch&&(rightIdx=text.indexOf("]",i+1),i+1<rightIdx&&(subText=text.substring(i+1,rightIdx),0<subText.length&&(ch=String.fromCharCode(eval("0x"+subText))),i=rightIdx)),newText+=ch}return newText};var SPECIAL_TAGS={"&":"&amp;",'"':"&quot;","<":"&lt;",">":"&gt;"};BI.htmlEncode=function(e){return BI.isNull(e)?"":BI.replaceAll(e+"",'&|"|<|>',function(e){return SPECIAL_TAGS[e]?SPECIAL_TAGS[e]:"&nbsp;"})},BI.htmlDecode=function(e){return BI.isNull(e)?"":BI.replaceAll(e+"","&amp;|&quot;|&lt;|&gt;|&nbsp;",function(e){switch(e){case"&amp;":return"&";case"&quot;":return'"';case"&lt;":return"<";case"&gt;":return">";case"&nbsp;":default:return" "}})},BI.cjkEncodeDO=function(e){if(BI.isPlainObject(e)){var t={};return _.each(e,function(e,n){"string"!=typeof e&&(e=BI.jsonEncode(e)),n=BI.cjkEncode(n),t[n]=BI.cjkEncode(e)}),t}return e},BI.jsonEncode=function(e){var n,t=!!{}.hasOwnProperty,r={"\b":"\\b","\t":"\\t","\n":"\\n","\f":"\\f","\r":"\\r",'"':'\\"',"\\":"\\\\"};if(null==e)return"null";if(BI.isArray(e))return function(e){for(var n,t,r=["["],a=e.length,i=0;i<a;i+=1)switch(typeof(t=e[i])){case"undefined":case"function":case"unknown":break;default:n&&r.push(","),r.push(null===t?"null":BI.jsonEncode(t)),n=!0}return r.push("]"),r.join("")}(e);if(e instanceof Date)return BI.jsonEncode({__time__:e.getTime()});if("string"==typeof e)return/["\\\x00-\x1f]/.test(n=e)?'"'+n.replace(/([\x00-\x1f\\"])/g,function(e,n){var t=r[n];return t||(t=n.charCodeAt(),"\\u00"+Math.floor(t/16).toString(16)+(t%16).toString(16))})+'"':'"'+n+'"';if("number"==typeof e)return isFinite(e)?String(e):"null";if("boolean"==typeof e)return String(e);if(BI.isFunction(e))return String(e);var a,i,o,s=["{"];for(i in e)if(!t||e.hasOwnProperty(i))switch(typeof(o=e[i])){case"undefined":case"unknown":break;default:a&&s.push(","),s.push(BI.jsonEncode(i),":",null===o?"null":BI.jsonEncode(o)),a=!0}return s.push("}"),s.join("")},BI.jsonDecode=function(e){try{var n=BI.$?BI.$.parseJSON(e):_global.JSON.parse(e);null==n&&(n={})}catch(r){try{n=new Function("return "+e)()||{}}catch(r){}null==n&&(n=[])}if(!(t=e)||"string"!=typeof t||-1==t.indexOf("__time__"))return n;var t;return function(e){if("string"==typeof e)return e;if(e&&null!=e.__time__)return new Date(e.__time__);for(var n in e){if(e[n]==e||"object"==typeof e[n]||_.isFunction(e[n]))break;e[n]=arguments.callee(e[n])}return e}(n)},BI.getEncodeURL=function(e,t){return BI.replaceAll(e,"\\{(.*?)\\}",function(e,n){return BI.encodeURIComponent(BI.isObject(t)?t[n]:t)})},BI.encodeURIComponent=function(e){return BI.specialCharsMap=BI.specialCharsMap||{},e=e||"",e=BI.replaceAll(e+"",BI.keys(BI.specialCharsMap||[]).join("|"),function(e){switch(e){case"\\":return BI.specialCharsMap["\\\\"]||e;default:return BI.specialCharsMap[e]||e}}),_global.encodeURIComponent(e)},BI.decodeURIComponent=function(e){var t={};return BI.each(BI.specialCharsMap,function(e,n){t[n]="\\\\"===e?"\\":e}),e=e||"",e=BI.replaceAll(e+"",BI.keys(t||[]).join("|"),function(e){return t[e]||e}),_global.decodeURIComponent(e)},BI.contentFormat=function(e,n){if(isEmpty(e))return"";var t,r=e.toString();return isEmpty(n)||n.match(/^T/)?r:(n.match(/^D/)?(e instanceof Date||(e="number"==typeof e?new Date(e):new Date(Date.parse((""+e).replace(/-|\./g,"/")))),isInvalidDate(e)||BI.isNull(e)||(t=n.match(/^DT/),r=BI.date2Str(e,n.substring(t?2:1)))):r=(n.match(/E/)?_eFormat:_numberFormat)(r,n),r=r.replace(/¤/g,"￥"))},BI.parseFmt=function(e){return e?(e=String(e).replace(/y{4,}/g,"%Y").replace(/y{2}/g,"%y").replace(/M{4,}/g,"%b").replace(/M{3}/g,"%B").replace(/M{2}/g,"%X").replace(/M{1}/g,"%x").replace(/a{1}/g,"%p"),e=new RegExp("d{2,}","g").test(e)?e.replace(/d{2,}/g,"%d"):e.replace(/d{1}/g,"%e"),e=new RegExp("h{2,}","g").test(e)?e.replace(/h{2,}/g,"%I"):e.replace(/h{1}/g,"%I"),e=(e=new RegExp("H{2,}","g").test(e)?e.replace(/H{2,}/g,"%H"):e.replace(/H{1}/g,"%H")).replace(/m{2,}/g,"%M").replace(/s{2,}/g,"%S")):""},BI.str2Date=function(e,n){if("string"!=typeof e||"string"!=typeof n)return null;var t=BI.parseFmt(n);return BI.parseDateTime(e,t)},BI.date2Str=function(e,n){if(!e)return"";var t=n.length,r="";if(0<t){for(var a=n.charAt(0),i=0,o=a,s=1;s<t;s++){var u=n.charAt(s);a!==u?(r+=c({"char":a,str:o,len:s-i},e),i=s,o=a=u):o+=u}r+=c({"char":a,str:o,len:t-i},e)}return r;function c(e,n){var t=e.str,r=e.len;switch(e["char"]){case"E":t=BI.Date._DN[n.getDay()];break;case"y":t=r<=3?(n.getFullYear()+"").slice(2,4):n.getFullYear();break;case"M":t=2<r?BI.Date._MN[n.getMonth()]:r<2?n.getMonth()+1:BI.leftPad(n.getMonth()+1+"",2,"0");break;case"d":t=1<r?BI.leftPad(n.getDate()+"",2,"0"):n.getDate();break;case"h":var a=n.getHours()%12;0===a&&(a=12),t=1<r?BI.leftPad(a+"",2,"0"):a;break;case"H":t=1<r?BI.leftPad(n.getHours()+"",2,"0"):n.getHours();break;case"m":t=1<r?BI.leftPad(n.getMinutes()+"",2,"0"):n.getMinutes();break;case"s":t=1<r?BI.leftPad(n.getSeconds()+"",2,"0"):n.getSeconds();break;case"a":t=n.getHours()<12?"am":"pm";break;case"z":t=BI.getTimezone(n);break;default:t=e.str}return t}},BI.object2Number=function(e){if(null==e)return 0;if("number"==typeof e)return e;var n=e+"";return(-1===n.indexOf(".")?parseInt:parseFloat)(n)},BI.object2Date=function(e){if(null==e)return new Date;if(e instanceof Date)return e;if("number"==typeof e)return new Date(e);var n=(n=e+"").replace(/-/g,"/"),t=new Date(n);return isInvalidDate(t)?new Date:t},BI.object2Time=function(e){if(null==e)return new Date;if(e instanceof Date)return e;var n=(n=e+"").replace(/-/g,"/"),t=new Date(n);return isInvalidDate(t)&&(-1!==n.indexOf("/")||-1===n.indexOf(":")||isInvalidDate(t=new Date("1970/01/01 "+n)))&&isInvalidDate(t=BI.parseDateTime(n,"HH:mm:ss"))?new Date:t}}()}).call(this,__webpack_require__(13))},123:function(e,n){_.extend(BI,{pushArray:function(e,n){for(var t=0;t<n.length;t++)e.push(n[t])},pushDistinct:function(e,n){BI.contains(e,n)||e.push(n)},pushDistinctArray:function(e,n){for(var t=0,r=n.length;t<r;t++)BI.pushDistinct(e,n[t])}})},124:function(e,n){BI.Date=BI.Date||{},BI.Date.SECOND=1e3,BI.Date.MINUTE=60*BI.Date.SECOND,BI.Date.HOUR=60*BI.Date.MINUTE,BI.Date.DAY=24*BI.Date.HOUR,BI.Date.WEEK=7*BI.Date.DAY,_.extend(BI,{getTimezone:function(e){return e.toString().replace(/^.* (?:\((.*)\)|([A-Z]{1,4})(?:[\-+][0-9]{4})?(?: -?\d+)?)$/,"$1$2").replace(/[^A-Z]/g,"")},getMonthDays:function(e,n){var t=e.getFullYear();return void 0===n&&(n=e.getMonth()),0!=t%4||0==t%100&&0!=t%400||1!=n?BI.Date._MD[n]:29},getLastDateOfMonth:function(e){return BI.getDate(e.getFullYear(),e.getMonth(),BI.getMonthDays(e))},getDayOfYear:function(e){var n=BI.getDate(e.getFullYear(),e.getMonth(),e.getDate(),0,0,0)-BI.getDate(e.getFullYear(),0,0,0,0,0);return Math.floor(n/BI.Date.DAY)},getWeekNumber:function(e){var n=BI.getDate(e.getFullYear(),e.getMonth(),e.getDate(),0,0,0),t=n.getDay(),r=BI.StartOfWeek%7,a=(3+r)%7,i=t<r?7+t-r:t-r,o=(a=a||7)<r?7+a-r:a-r;n.setDate(n.getDate()-i+o);var s=n.valueOf();return n.setMonth(0),n.setDate(1),Math.floor((s-n.valueOf())/6048e5)+1},getQuarter:function(e){return Math.floor(e.getMonth()/3)+1},getOffsetDate:function(e,n){return BI.getDate(BI.getTime(e.getFullYear(),e.getMonth(),e.getDate(),e.getHours(),e.getMinutes(),e.getSeconds())+864e5*n)},getOffsetQuarter:function(e,n){var t=BI.getDate(BI.getTime(e.getFullYear(),e.getMonth(),e.getDate(),e.getHours(),e.getMinutes(),e.getSeconds())),r=t.getDate(),a=BI.getMonthDays(BI.getDate(t.getFullYear(),t.getMonth()+3*BI.parseInt(n),1));return a<r&&(r=a),t.setDate(r),t.setMonth(t.getMonth()+3*parseInt(n)),t},getQuarterStartMonth:function(e){var n=0,t=e.getMonth();return t<3&&(n=0),2<t&&t<6&&(n=3),5<t&&t<9&&(n=6),8<t&&(n=9),n},getQuarterStartDate:function(e){return BI.getDate(e.getFullYear(),BI.getQuarterStartMonth(e),1)},getQuarterEndDate:function(e){var n=BI.getQuarterStartMonth(e)+2;return BI.getDate(e.getFullYear(),n,BI.getMonthDays(e,n))},getOffsetMonth:function(e,n){var t=BI.getDate(BI.getTime(e.getFullYear(),e.getMonth(),e.getDate(),e.getHours(),e.getMinutes(),e.getSeconds())),r=t.getDate(),a=BI.getMonthDays(BI.getDate(t.getFullYear(),t.getMonth()+parseInt(n),1));return a<r&&(r=a),t.setDate(r),t.setMonth(t.getMonth()+parseInt(n)),t},getWeekStartDate:function(e){var n=e.getDay(),t=BI.StartOfWeek%7;return BI.getOffsetDate(e,BI.Date._OFFSET[n<t?7+n-t:n-t])},getWeekEndDate:function(e){var n=e.getDay(),t=BI.StartOfWeek%7;return BI.getOffsetDate(e,BI.Date._OFFSET[n<t?7+n-t:n-t]+6)},print:function(e,n){for(var t=e.getMonth(),r=e.getDate(),a=e.getFullYear(),i=a+"";i.length<4;)i="0"+i;var o=BI.getWeekNumber(e),s=BI.getQuarter(e),u=e.getDay(),c={},l=e.getHours(),h=12<=l,p=h?l-12:l,f=BI.getDayOfYear(e);0==p&&(p=12);var d=e.getMinutes(),m=e.getSeconds();c["%a"]=BI.Date._SDN[u],c["%A"]=BI.Date._DN[u],c["%b"]=BI.Date._SMN[t],c["%B"]=BI.Date._MN[t],c["%C"]=1+Math.floor(a/100),c["%d"]=r<10?"0"+r:r,c["%e"]=r,c["%H"]=l<10?"0"+l:l,c["%I"]=p<10?"0"+p:p,c["%j"]=f<100?f<10?"00"+f:"0"+f:f,c["%k"]=l+"",c["%l"]=p+"",c["%X"]=t<9?"0"+(1+t):1+t,c["%x"]=t+1,c["%M"]=d<10?"0"+d:d,c["%n"]="\n",c["%p"]=h?"PM":"AM",c["%P"]=h?"pm":"am",c["%s"]=Math.floor(e.getTime()/1e3),c["%S"]=m<10?"0"+m:m,c["%t"]="\t",c["%U"]=c["%W"]=c["%V"]=o<10?"0"+o:o,c["%u"]=u+1,c["%w"]=u,c["%y"]=i.substr(2,2),c["%Y"]=i,c["%%"]="%",c["%Q"]=s;var y=/%./g;if(BI.isKhtml=BI.isKhtml||function(){return!!_global.navigator&&/Konqueror|Safari|KHTML/i.test(navigator.userAgent)},!(-1===n.indexOf("%Y")&&-1===n.indexOf("%y")||-1===n.indexOf("%W")&&-1===n.indexOf("%U")&&-1===n.indexOf("%V")))switch(o){case 1:11===t&&(c["%y"]=parseInt(c["%y"])+1,c["%Y"]=parseInt(c["%Y"])+1);break;case 53:0===t&&(c["%y"]=parseInt(c["%y"])-1,c["%Y"]=parseInt(c["%Y"])-1)}if(!BI.isKhtml())return n.replace(y,function(e){return c[e]||e});for(var g=n.match(y),b=0;b<g.length;b++){var v=c[g[b]];v&&(y=new RegExp(g[b],"g"),n=n.replace(y,v))}return n}})},125:function(e,n){BI.Func={},_.extend(BI.Func,{createDistinctName:function(e,t){var n=t,r=1;for(t=t||"";!BI.every(e,function(e,n){return BI.isKey(n)?n!==t:n.name!==t});)t=n+r++;return t},getGBWidth:function(e){return e=(e+="").replace(/[^\x00-\xff]/g,"xx"),Math.ceil(e.length/2)},getSearchResult:function(e,t,r){var a,i,o,s=BI.isArray(e);if(e=s?BI.flatten(e):e,r=r||"text",!BI.isKey(t))return{find:BI.deepClone(e),match:s?[]:{}};t=BI.toUpperCase(t);var u=s?[]:{},c=s?[]:{};return BI.each(e,function(e,n){BI.isNull(n)||(n=BI.deepClone(n),a=BI.stripEL(n),i=BI.find([a[r],a.text,a.value,a.name,a],function(e,n){return BI.isNotNull(n)}),BI.isNull(i)||BI.isObject(i)||(o=BI.makeFirstPY(i,{splitChar:"​"}),i=BI.toUpperCase(i),o=BI.toUpperCase(o),-1<i.indexOf(t)?i===t?s?u.push(n):u[e]=n:s?c.push(n):c[e]=n:-1<o.indexOf(t)&&(i===t||t.length===i.length?s?u.push(n):u[e]=n:s?c.push(n):c[e]=n)))}),{match:u,find:c}}}),_.extend(BI,{beforeFunc:function(e,n){var t=e;return function(){return!1!==n.apply(e,arguments)&&t.apply(e,arguments)}},afterFunc:function(n,t){var r=n;return function(){var e=r.apply(n,arguments);return!1!==e&&(t.apply(n,arguments),e)}}})},126:function(e,n){_.extend(BI,{add:function(e,n){return function(e,n){var t,r,a,i;try{t=e.toString().split(".")[1].length}catch(s){t=0}try{r=n.toString().split(".")[1].length}catch(s){r=0}{var o;i=Math.abs(t-r),a=Math.pow(10,Math.max(t,r)),n=0<i?(o=Math.pow(10,i),r<t?(e=Number(e.toString().replace(".","")),Number(n.toString().replace(".",""))*o):(e=Number(e.toString().replace(".",""))*o,Number(n.toString().replace(".","")))):(e=Number(e.toString().replace(".","")),Number(n.toString().replace(".","")))}return(e+n)/a}(n,e)},sub:function(e,n){var t,r,a;try{t=e.toString().split(".")[1].length}catch(i){t=0}try{r=n.toString().split(".")[1].length}catch(i){r=0}return a=Math.pow(10,Math.max(t,r)),((e*a-n*a)/a).toFixed(r<=t?t:r)},mul:function(e,n){return function(e,n){var t=0,r=e.toString(),a=n.toString();try{t+=r.split(".")[1].length}catch(i){}try{t+=a.split(".")[1].length}catch(i){}return Number(r.replace(".",""))*Number(a.replace(".",""))/Math.pow(10,t)}(n,e)},div:function(e,n){return a(e,n);function s(e){var n=e.toString().split(/[eE]/),t=(n[0].split(".")[1]||"").length-(n[1]||0);return 0<t?t:0}function u(e){if(-1===e.toString().indexOf("e"))return Number(e.toString().replace(".",""));var n=s(e);return 0<n?e*Math.pow(10,n):e}function c(e,n){for(var t=[],r=2;r<arguments.length;r++)t[r-2]=arguments[r];if(0<t.length)return c.apply(void 0,[c(e,n),t[0]].concat(t.slice(1)));var a=u(e),i=u(n),o=s(e)+s(n);return a*i/Math.pow(10,o)}function a(e,n){for(var t=[],r=2;r<arguments.length;r++)t[r-2]=arguments[r];return 0<t.length?a.apply(void 0,[a(e,n),t[0]].concat(t.slice(1))):c(u(e)/u(n),Math.pow(10,s(n)-s(e)))}}})},127:function(e,n){_.extend(BI,{startWith:function(e,n){return e=e||"",!(null==n||""==n||0===e.length||n.length>e.length)&&e.substr(0,n.length)==n},endWith:function(e,n){return!(null==n||""==n||0===e.length||n.length>e.length)&&e.substring(e.length-n.length)==n},getQuery:function(e,n){var t=new RegExp("(^|&)"+n+"=([^&]*)(&|$)"),r=e.substr(e.indexOf("?")+1).match(t);return r?unescape(r[2]):null},appendQuery:function(e,n){if(!n)return e;var t=e;return-1===t.indexOf("?")&&(t+="?"),!1!==BI.endWith(t,"?")||(t+="&"),_.each(n,function(e,n){"string"==typeof n&&(t+=n+"="+e+"&")}),t=t.substr(0,t.length-1)},replaceAll:function(e,n,t){return BI.isString(e)?e.replace(new RegExp(n,"gm"),t):e},perfectStart:function(e,n){return BI.startWith(e,n)?e:n+e},allIndexOf:function(e,n){if("string"!=typeof n)return[];for(var t=[],r=0;0<e.length;){var a=e.indexOf(n);if(-1===a)break;t.push(r+a),e=e.substring(a+n.length,e.length),r+=a+n.length}return t}})},128:function(e,n){var o;o={},_.extend(BI,{addI18n:function(e){BI.extend(o,e)},i18nText:function(e){i=(i=o[e]||BI.i18n&&BI.i18n[e]||"")||e;var n=arguments.length;if(1<n){if(!(-1<i.indexOf("{R1}"))){var t=Array.prototype.slice.call(arguments),r=1;return BI.replaceAll(i,"\\{\\s*\\}",function(){return t[r++]+""})}for(var a=1;a<n;a++)var e="{R"+a+"}",i=BI.replaceAll(i,e,arguments[a]+"")}return i}})},129:function(e,n){!function(){var t={};BI.module=function(e,n){null!=t[e]&&_global.console&&console.error("module:["+e+"] has been registed"),t[e]=n};var r={};BI.constant=function(e,n){null!=r[e]&&_global.console&&console.error("constant:["+e+"] has been registed"),r[e]=n};var a={};BI.model=function(e,n){null!=a[e]&&_global.console&&console.error("model:["+e+"] has been registed"),a[e]=n};var i={};BI.store=function(e,n){null!=i[e]&&_global.console&&console.error("store:["+e+"] has been registed"),i[e]=n};var o={};BI.service=function(e,n){null!=o[e]&&_global.console&&console.error("service:["+e+"] has been registed"),o[e]=n};var s={};BI.provider=function(e,n){null!=s[e]&&_global.console&&console.error("provider:["+e+"] has been registed"),s[e]=n};var u={};BI.config=function(t,e){if(BI.initialized)return r[t]?r[t]=e(r[t]):s[t]?(m[t]||(m[t]=new s[t]),y[t]&&delete y[t],e(m[t])):BI.Plugin.configWidget(t,e);u[t]||(u[t]=[],BI.prepares.push(function(){for(var e=u[t],n=0;n<e.length;n++)r[t]?r[t]=e[n](r[t]):s[t]?(m[t]||(m[t]=new s[t]),y[t]&&delete y[t],e[n](m[t])):BI.Plugin.configWidget(t,e[n]);u[t]=null})),u[t].push(e)};var c={},l=[];BI.action=function(n,t){return BI.isFunction(n)?(l.push(n),function(){BI.remove(l,function(e){return l.indexOf(t)===e})}):(c[n]||(c[n]=[]),c[n].push(t),function(){BI.remove(c[n],function(e){return c[n].indexOf(t)===e}),0===c[n].length&&delete c[n]})};var h={};BI.point=function(e,n,t,r){h[e]||(h[e]={}),h[e][n]||(h[e][n]={}),h[e][n][r?"after":"before"]||(h[e][n][r?"after":"before"]=[]),h[e][n][r?"after":"before"].push(t)},BI.Modules={getModule:function(e){return t[e]?t[e]:(_global.console&&console.error("module:["+e+"] does not exists"),!1)},getAllModules:function(){return t}},BI.Constants={getConstant:function(e){return r[e]}};var p=function(i,e){e=BI.isArray(e)?e:[e],BI.each(e,function(e,n){if(h[n])for(var t in h[n]){var r=h[n][t].before;r&&BI.aspect.before(i,t,function(r){return function(){for(var e=0,n=r.length;e<n;e++)try{r[e].apply(i,arguments)}catch(t){_global.console&&console.error(t)}}}(r));var a=h[n][t].after;a&&BI.aspect.after(i,t,function(r){return function(){for(var e=0,n=r.length;e<n;e++)try{r[e].apply(i,arguments)}catch(t){_global.console&&console.error(t)}}}(a))}})};BI.Models={getModel:function(e,n){var t=new a[e](n);return t._constructor&&t._constructor(n),t.mixins&&p(t,t.mixins),p(t,e),t}};var f={};BI.Stores={getStore:function(e,n){if(f[e])return f[e];var t=f[e]=new i[e](n);return t._constructor&&t._constructor(n,function(){delete f[e]}),p(t,e),t}};var d={};BI.Services={getService:function(e,n){return d[e]||(d[e]=new o[e](n),p(d[e],e)),d[e]}};var m={},y={};BI.Providers={getProvider:function(e,n){return m[e]||(m[e]=new s[e]),y[e]||(y[e]=new(m[e].$get())(n)),y[e]}},BI.Actions={runAction:function(e,r,a){BI.each(c[e],function(e,n){try{n(r,a)}catch(t){_global.console&&console.error(t)}})},runGlobalAction:function(){var r=[].slice.call(arguments);BI.each(l,function(e,n){try{n.apply(null,r)}catch(t){_global.console&&console.error(t)}})}},BI.getContext=function(e,n){return r[e]?BI.Constants.getConstant(e):a[e]?BI.Models.getModel(e,n):i[e]?BI.Stores.getStore(e,n):o[e]?BI.Services.getService(e,n):s[e]?BI.Providers.getProvider(e,n):void 0}}()},13:function(e,n,t){"use strict";function r(e){return r="function"==typeof Symbol&&"symbol"==typeof Symbol.iterator?function r(n){return typeof n}:function r(n){return n&&"function"==typeof Symbol&&n.constructor===Symbol&&n!==Symbol.prototype?"symbol":typeof n},r(e)}var a=function(){return this}();try{a=a||new Function("return this")()}catch(i){"object"===("undefined"==typeof window?"undefined":r(window))&&(a=window)}e.exports=a},130:function(e,n){_.extend(BI,{MAX:0x1000000000000000,MIN:-0x1000000000000000,EVENT_RESPONSE_TIME:200,zIndex_layer:1e5,zIndex_popover:1e6,zIndex_popup:1e7,zIndex_masker:1e8,zIndex_tip:1e9,emptyStr:"",emptyFn:function(){},empty:null,Key:{48:"0",49:"1",50:"2",51:"3",52:"4",53:"5",54:"6",55:"7",56:"8",57:"9",65:"a",66:"b",67:"c",68:"d",69:"e",70:"f",71:"g",72:"h",73:"i",74:"j",75:"k",76:"l",77:"m",78:"n",79:"o",80:"p",81:"q",82:"r",83:"s",84:"t",85:"u",86:"v",87:"w",88:"x",89:"y",90:"z",96:"0",97:"1",98:"2",99:"3",100:"4",101:"5",102:"6",103:"7",104:"8",105:"9",106:"*",107:"+",109:"-",110:".",111:"/"},KeyCode:{BACKSPACE:8,COMMA:188,DELETE:46,DOWN:40,END:35,ENTER:13,ESCAPE:27,HOME:36,LEFT:37,NUMPAD_ADD:107,NUMPAD_DECIMAL:110,NUMPAD_DIVIDE:111,NUMPAD_ENTER:108,NUMPAD_MULTIPLY:106,NUMPAD_SUBTRACT:109,PAGE_DOWN:34,PAGE_UP:33,PERIOD:190,RIGHT:39,SPACE:32,TAB:9,UP:38},Status:{SUCCESS:1,WRONG:2,START:3,END:4,WAITING:5,READY:6,RUNNING:7,OUTOFBOUNDS:8,NULL:-1},Direction:{Top:"top",Bottom:"bottom",Left:"left",Right:"right",Custom:"custom"},Axis:{Vertical:"vertical",Horizontal:"horizontal"},Selection:{Default:-2,None:-1,Single:0,Multi:1,All:2},HorizontalAlign:{Left:"left",Right:"right",Center:"center",Stretch:"stretch"},VerticalAlign:{Middle:"middle",Top:"top",Bottom:"bottom",Stretch:"stretch"},StartOfWeek:1})},131:function(e,n){var t;t={},BI.BufferPool={put:function(e,n){if(BI.isNotNull(t[e]))throw new Error("Buffer Pool has the key already!");t[e]=n},get:function(e){return t[e]}}},132:function(e,n){var r;r={},BI.SharingPool={_Shared:r,put:function(e,n){r[e]=n},cat:function(){for(var e=Array.prototype.slice.call(arguments,0),n=r,t=0;t<e.length;t++)n=n&&n[e[t]];return n},get:function(){return BI.deepClone(this.cat.apply(this,arguments))},remove:function(e){delete r[e]}}},133:function(e,n){BI.Req={}},52:function(e,a,i){"use strict";(function(e){var n=void 0!==e&&e||"undefined"!=typeof self&&self||window,t=Function.prototype.apply;function r(e,n){this._id=e,this._clearFn=n}a.setTimeout=function(){return new r(t.call(setTimeout,n,arguments),clearTimeout)},a.setInterval=function(){return new r(t.call(setInterval,n,arguments),clearInterval)},a.clearTimeout=a.clearInterval=function(e){e&&e.close()},r.prototype.unref=r.prototype.ref=function(){},r.prototype.close=function(){this._clearFn.call(n,this._id)},a.enroll=function(e,n){clearTimeout(e._idleTimeoutId),e._idleTimeout=n},a.unenroll=function(e){clearTimeout(e._idleTimeoutId),e._idleTimeout=-1},a._unrefActive=a.active=function(e){clearTimeout(e._idleTimeoutId);var n=e._idleTimeout;0<=n&&(e._idleTimeoutId=setTimeout(function(){e._onTimeout&&e._onTimeout()},n))},i(106),a.setImmediate="undefined"!=typeof self&&self.setImmediate||void 0!==e&&e.setImmediate||void 0,a.clearImmediate="undefined"!=typeof self&&self.clearImmediate||void 0!==e&&e.clearImmediate||void 0}).call(this,i(13))},66:function(e,n,t){"use strict";var r,a,i=e.exports={};function o(){throw new Error("setTimeout has not been defined")}function s(){throw new Error("clearTimeout has not been defined")}function u(e){if(r===setTimeout)return setTimeout(e,0);if((r===o||!r)&&setTimeout)return r=setTimeout,setTimeout(e,0);try{return r(e,0)}catch(n){try{return r.call(null,e,0)}catch(n){return r.call(this,e,0)}}}!function(){try{r="function"==typeof setTimeout?setTimeout:o}catch(e){r=o}try{a="function"==typeof clearTimeout?clearTimeout:s}catch(e){a=s}}();var c,l=[],h=!1,p=-1;function f(){h&&c&&(h=!1,c.length?l=c.concat(l):p=-1,l.length&&d())}function d(){if(!h){var e=u(f);h=!0;for(var n=l.length;n;){for(c=l,l=[];++p<n;)c&&c[p].run();p=-1,n=l.length}c=null,h=!1,function(e){if(a===clearTimeout)return clearTimeout(e);if((a===s||!a)&&clearTimeout)return a=clearTimeout,clearTimeout(e);try{a(e)}catch(n){try{return a.call(null,e)}catch(n){return a.call(this,e)}}}(e)}}function m(e,n){this.fun=e,this.array=n}function y(){}i.nextTick=function(e){var n=new Array(arguments.length-1);if(1<arguments.length)for(var t=1;t<arguments.length;t++)n[t-1]=arguments[t];l.push(new m(e,n)),1!==l.length||h||u(d)},m.prototype.run=function(){this.fun.apply(null,this.array)},i.title="browser",i.browser=!0,i.env={},i.argv=[],i.version="",i.versions={},i.on=y,i.addListener=y,i.once=y,i.off=y,i.removeListener=y,i.removeAllListeners=y,i.emit=y,i.prependListener=y,i.prependOnceListener=y,i.listeners=function(e){return[]},i.binding=function(e){throw new Error("process.binding is not supported")},i.cwd=function(){return"/"},i.chdir=function(e){throw new Error("process.chdir is not supported")},i.umask=function(){return 0}},744:function(e,n){BI.i18n={"BI-Multi_Date_Quarter_End":"季度末","BI-Multi_Date_Month_Begin":"月初","BI-Multi_Date_YMD":"年月日","BI-Custom_Color":"自定义颜色","BI-Numerical_Interval_Input_Data":"请输入数值","BI-Please_Input_Natural_Number":"请输入非负整数","BI-No_More_Data":"无更多数据","BI-Basic_Altogether":"共","BI-Basic_Sunday":"星期日","BI-Widget_Background_Colour":"组件背景","BI-Color_Picker_Error_Text":"请输入0~255的正整数","BI-Multi_Date_Month":"月","BI-No_Selected_Item":"没有可选项","BI-Multi_Date_Year_Begin":"年初","BI-Quarter_1":"第1季度","BI-Quarter_2":"第2季度","BI-Quarter_3":"第3季度","BI-Quarter_4":"第4季度","BI-Multi_Date_Year_Next":"年后","BI-Multi_Date_Month_Prev":"个月前","BI-Month_Trigger_Error_Text":"请输入1~12的正整数","BI-Less_And_Equal":"小于等于","BI-Year_Trigger_Invalid_Text":"请输入有效时间","BI-Multi_Date_Week_Next":"周后","BI-Font_Size":"字号","BI-Basic_Total":"共","BI-Already_Selected":"已选择","BI-Formula_Insert":"插入","BI-Select_All":"全选","BI-Basic_Tuesday":"星期二","BI-Multi_Date_Month_End":"月末","BI-Load_More":"点击加载更多数据","BI-Basic_September":"九月","BI-Current_Is_Last_Page":"当前已是最后一页","BI-Basic_Auto":"自动","BI-Basic_Count":"个","BI-Basic_Value":"值","BI-Basic_Unrestricted":"无限制","BI-Quarter_Trigger_Error_Text":"请输入1~4的正整数","BI-Basic_More":"更多","BI-Basic_Wednesday":"星期三","BI-Basic_Bold":"加粗","BI-Basic_Simple_Saturday":"六","BI-Multi_Date_Month_Next":"个月后","BI-Basic_March":"三月","BI-Current_Is_First_Page":"当前已是第一页","BI-Basic_Thursday":"星期四","BI-Basic_Prompt":"提示","BI-Multi_Date_Today":"今天","BI-Multi_Date_Quarter_Prev":"个季度前","BI-Row_Header":"行表头","BI-Date_Trigger_Error_Text":"日期格式示例:2015-3-11","BI-Basic_Cancel":"取消","BI-Basic_January":"一月","BI-Basic_June":"六月","BI-Basic_July":"七月","BI-Basic_April":"四月","BI-Multi_Date_Quarter_Begin":"季度初","BI-Multi_Date_Week":"周","BI-Click_Blank_To_Select":'点击"空格键"选中完全匹配项',"BI-Basic_August":"八月","BI-Word_Align_Left":"文字居左","BI-Basic_November":"十一月","BI-Font_Colour":"字体颜色","BI-Multi_Date_Day_Prev":"天前","BI-Select_Part":"部分选择","BI-Multi_Date_Day_Next":"天后","BI-Less_Than":"小于","BI-Basic_February":"二月","BI-Multi_Date_Year":"年","BI-Number_Index":"序号","BI-Multi_Date_Week_Prev":"周前","BI-Next_Page":"下一页","BI-Right_Page":"向右翻页","BI-Numerical_Interval_Signal_Value":"前后值相等，请将操作符改为“≤”","BI-Basic_December":"十二月","BI-Basic_Saturday":"星期六","BI-Basic_Simple_Wednesday":"三","BI-Multi_Date_Quarter_Next":"个季度后","BI-Basic_October":"十月","BI-Basic_Simple_Friday":"五","BI-Basic_Save":"保存","BI-Numerical_Interval_Number_Value":"请保证前面的数值小于/等于后面的数值","BI-Previous_Page":"上一页","BI-No_Select":"搜索结果为空","BI-Basic_Clears":"清空","BI-Created_By_Me":"我创建的","BI-Basic_Simple_Tuesday":"二","BI-Word_Align_Right":"文字居右","BI-Summary_Values":"汇总","BI-Basic_Clear":"清除","BI-Upload_File_Size_Error":"文件大小不支持","BI-Up_Page":"向上翻页","BI-Basic_Simple_Sunday":"日","BI-Multi_Date_Relative_Current_Time":"相对当前时间","BI-Selected_Data":"已选数据：","BI-Multi_Date_Quarter":"季度","BI-Check_Selected":"查看已选","BI-Basic_Search":"搜索","BI-Basic_May":"五月","BI-Continue_Select":"继续选择","BI-Please_Input_Positive_Integer":"请输入正整数","BI-Upload_File_Type_Error":"文件类型不支持","BI-Upload_File_Error":"文件上传失败","BI-Basic_Friday":"星期五","BI-Down_Page":"向下翻页","BI-Basic_Monday":"星期一","BI-Left_Page":"向左翻页","BI-Transparent_Color":"透明","BI-Basic_Simple_Monday":"一","BI-Multi_Date_Year_End":"年末","BI-Time_Interval_Error_Text":"请保证开始时间早于/等于结束时间","BI-Basic_Time":"时间","BI-Basic_OK":"确定","BI-Basic_Sure":"确定","BI-Basic_Simple_Thursday":"四","BI-Multi_Date_Year_Prev":"年前","BI-Tiao_Data":"条数据","BI-Basic_Italic":"斜体","BI-Basic_Dynamic_Title":"动态时间","BI-Basic_Year":"年","BI-Basic_Single_Quarter":"季","BI-Basic_Month":"月","BI-Basic_Week":"周","BI-Basic_Day":"天","BI-Basic_Work_Day":"工作日","BI-Basic_Front":"前","BI-Basic_Behind":"后","BI-Basic_Empty":"空","BI-Basic_Month_End":"月末","BI-Basic_Month_Begin":"月初","BI-Basic_Year_End":"年末","BI-Basic_Year_Begin":"年初","BI-Basic_Quarter_End":"季末","BI-Basic_Quarter_Begin":"季初","BI-Basic_Week_End":"周末","BI-Basic_Week_Begin":"周初","BI-Basic_Current_Day":"当天","BI-Basic_Begin_Start":"初","BI-Basic_End_Stop":"末","BI-Basic_Current_Year":"今年","BI-Basic_Year_Fen":"年份","BI-Basic_Current_Month":"本月","BI-Basic_Current_Quarter":"本季度","BI-Basic_Year_Month":"年月","BI-Basic_Year_Quarter":"年季度","BI-Basic_Input_Can_Not_Null":"输入框不能为空","BI-Basic_Date_Time_Error_Text":"日期格式示例:2015-3-11 00:00:00","BI-Basic_Input_From_To_Number":"请输入{R1}的数值","BI-Basic_Or":"或","BI-Basic_And":"且","BI-Conf_Add_Formula":"添加公式","BI-Conf_Add_Condition":"添加条件","BI-Conf_Formula_And":"且公式条件","BI-Conf_Formula_Or":"或公式条件","BI-Conf_Condition_And":"且条件","BI-Conf_Condition_Or":"或条件","BI-Microsoft_YaHei":"微软雅黑","BI-Apple_Light":"苹方-light","BI-Font_Family":"字体","BI-Basic_Please_Input_Content":"请输入内容","BI-Word_Align_Center":"文字居中","BI-Basic_Please_Enter_Number_Between":"请输入{R1}-{R2}的值","BI-More_Than":"大于","BI-More_And_Equal":"大于等于","BI-Please_Enter_SQL":"请输入SQL","BI-Basic_Click_To_Add_Text":'+点击新增"{R1}"',"BI-Basic_Please_Select":"请选择","BI-Basic_Font_Color":"文字颜色","BI-Basic_Background_Color":"背景色","BI-Basic_Underline":"下划线","BI-Basic_Param_Month":"{R1}月","BI-Basic_Param_Day":"{R1}日","BI-Basic_Param_Quarter":"{R1}季度","BI-Basic_Param_Week_Count":"第{R1}周","BI-Basic_Param_Hour":"{R1}时","BI-Basic_Param_Minute":"{R1}分","BI-Basic_Param_Second":"{R1}秒","BI-Basic_Param_Year":"{R1}年","BI-Basic_Date_Day":"日","BI-Basic_Hour_Sin":"时","BI-Basic_Seconds":"秒","BI-Basic_Minute":"分","BI-Basic_Wan":"万","BI-Basic_Million":"百万","BI-Basic_Billion":"亿","BI-Basic_Quarter":"季度","BI-Basic_No_Select":"不选","BI-Basic_Now":"此刻"}}});