|
|
/*! |
|
|
* jQuery JavaScript Library v1.9.1 |
|
|
* http://jquery.com/ |
|
|
* |
|
|
* Includes Sizzle.js |
|
|
* http://sizzlejs.com/ |
|
|
* |
|
|
* Copyright 2005, 2012 jQuery Foundation, Inc. and other contributors |
|
|
* Released under the MIT license |
|
|
* http://jquery.org/license |
|
|
* |
|
|
* Date: 2013-2-4 |
|
|
*/ |
|
|
(function( window, undefined ) { |
|
|
|
|
|
// Can't do this because several apps including ASP.NET trace |
|
|
// the stack via arguments.caller.callee and Firefox dies if |
|
|
// you try to trace through "use strict" call chains. (#13335) |
|
|
// Support: Firefox 18+ |
|
|
//"use strict"; |
|
|
var |
|
|
// The deferred used on DOM ready |
|
|
readyList, |
|
|
|
|
|
// A central reference to the root jQuery(document) |
|
|
rootjQuery, |
|
|
|
|
|
// Support: IE<9 |
|
|
// For `typeof node.method` instead of `node.method !== undefined` |
|
|
core_strundefined = typeof undefined, |
|
|
|
|
|
// Use the correct document accordingly with window argument (sandbox) |
|
|
document = window.document, |
|
|
location = window.location, |
|
|
|
|
|
// Map over jQuery in case of overwrite |
|
|
_jQuery = window.jQuery, |
|
|
|
|
|
// Map over the $ in case of overwrite |
|
|
_$ = window.$, |
|
|
|
|
|
// [[Class]] -> type pairs |
|
|
class2type = {}, |
|
|
|
|
|
// List of deleted data cache ids, so we can reuse them |
|
|
core_deletedIds = [], |
|
|
|
|
|
core_version = "1.9.1", |
|
|
|
|
|
// Save a reference to some core methods |
|
|
core_concat = core_deletedIds.concat, |
|
|
core_push = core_deletedIds.push, |
|
|
core_slice = core_deletedIds.slice, |
|
|
core_indexOf = core_deletedIds.indexOf, |
|
|
core_toString = class2type.toString, |
|
|
core_hasOwn = class2type.hasOwnProperty, |
|
|
core_trim = core_version.trim, |
|
|
|
|
|
// Define a local copy of jQuery |
|
|
jQuery = function( selector, context ) { |
|
|
// The jQuery object is actually just the init constructor 'enhanced' |
|
|
return new jQuery.fn.init( selector, context, rootjQuery ); |
|
|
}, |
|
|
|
|
|
// Used for matching numbers |
|
|
core_pnum = /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source, |
|
|
|
|
|
// Used for splitting on whitespace |
|
|
core_rnotwhite = /\S+/g, |
|
|
|
|
|
// Make sure we trim BOM and NBSP (here's looking at you, Safari 5.0 and IE) |
|
|
rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g, |
|
|
|
|
|
// A simple way to check for HTML strings |
|
|
// Prioritize #id over <tag> to avoid XSS via location.hash (#9521) |
|
|
// Strict HTML recognition (#11290: must start with <) |
|
|
rquickExpr = /^(?:(<[\w\W]+>)[^>]*|#([\w-]*))$/, |
|
|
|
|
|
// Match a standalone tag |
|
|
rsingleTag = /^<(\w+)\s*\/?>(?:<\/\1>|)$/, |
|
|
|
|
|
// JSON RegExp |
|
|
rvalidchars = /^[\],:{}\s]*$/, |
|
|
rvalidbraces = /(?:^|:|,)(?:\s*\[)+/g, |
|
|
rvalidescape = /\\(?:["\\\/bfnrt]|u[\da-fA-F]{4})/g, |
|
|
rvalidtokens = /"[^"\\\r\n]*"|true|false|null|-?(?:\d+\.|)\d+(?:[eE][+-]?\d+|)/g, |
|
|
|
|
|
// Matches dashed string for camelizing |
|
|
rmsPrefix = /^-ms-/, |
|
|
rdashAlpha = /-([\da-z])/gi, |
|
|
|
|
|
// Used by jQuery.camelCase as callback to replace() |
|
|
fcamelCase = function( all, letter ) { |
|
|
return letter.toUpperCase(); |
|
|
}, |
|
|
|
|
|
// The ready event handler |
|
|
completed = function( event ) { |
|
|
|
|
|
// readyState === "complete" is good enough for us to call the dom ready in oldIE |
|
|
if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) { |
|
|
detach(); |
|
|
jQuery.ready(); |
|
|
} |
|
|
}, |
|
|
// Clean-up method for dom ready events |
|
|
detach = function() { |
|
|
if ( document.addEventListener ) { |
|
|
document.removeEventListener( "DOMContentLoaded", completed, false ); |
|
|
window.removeEventListener( "load", completed, false ); |
|
|
|
|
|
} else { |
|
|
document.detachEvent( "onreadystatechange", completed ); |
|
|
window.detachEvent( "onload", completed ); |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.fn = jQuery.prototype = { |
|
|
// The current version of jQuery being used |
|
|
jquery: core_version, |
|
|
|
|
|
constructor: jQuery, |
|
|
init: function( selector, context, rootjQuery ) { |
|
|
var match, elem; |
|
|
|
|
|
// HANDLE: $(""), $(null), $(undefined), $(false) |
|
|
if ( !selector ) { |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Handle HTML strings |
|
|
if ( typeof selector === "string" ) { |
|
|
if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) { |
|
|
// Assume that strings that start and end with <> are HTML and skip the regex check |
|
|
match = [ null, selector, null ]; |
|
|
|
|
|
} else { |
|
|
match = rquickExpr.exec( selector ); |
|
|
} |
|
|
|
|
|
// Match html or make sure no context is specified for #id |
|
|
if ( match && (match[1] || !context) ) { |
|
|
|
|
|
// HANDLE: $(html) -> $(array) |
|
|
if ( match[1] ) { |
|
|
context = context instanceof jQuery ? context[0] : context; |
|
|
|
|
|
// scripts is true for back-compat |
|
|
jQuery.merge( this, jQuery.parseHTML( |
|
|
match[1], |
|
|
context && context.nodeType ? context.ownerDocument || context : document, |
|
|
true |
|
|
) ); |
|
|
|
|
|
// HANDLE: $(html, props) |
|
|
if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) { |
|
|
for ( match in context ) { |
|
|
// Properties of context are called as methods if possible |
|
|
if ( jQuery.isFunction( this[ match ] ) ) { |
|
|
this[ match ]( context[ match ] ); |
|
|
|
|
|
// ...and otherwise set as attributes |
|
|
} else { |
|
|
this.attr( match, context[ match ] ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
|
|
|
// HANDLE: $(#id) |
|
|
} else { |
|
|
elem = document.getElementById( match[2] ); |
|
|
|
|
|
// Check parentNode to catch when Blackberry 4.6 returns |
|
|
// nodes that are no longer in the document #6963 |
|
|
if ( elem && elem.parentNode ) { |
|
|
// Handle the case where IE and Opera return items |
|
|
// by name instead of ID |
|
|
if ( elem.id !== match[2] ) { |
|
|
return rootjQuery.find( selector ); |
|
|
} |
|
|
|
|
|
// Otherwise, we inject the element directly into the jQuery object |
|
|
this.length = 1; |
|
|
this[0] = elem; |
|
|
} |
|
|
|
|
|
this.context = document; |
|
|
this.selector = selector; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// HANDLE: $(expr, $(...)) |
|
|
} else if ( !context || context.jquery ) { |
|
|
return ( context || rootjQuery ).find( selector ); |
|
|
|
|
|
// HANDLE: $(expr, context) |
|
|
// (which is just equivalent to: $(context).find(expr) |
|
|
} else { |
|
|
return this.constructor( context ).find( selector ); |
|
|
} |
|
|
|
|
|
// HANDLE: $(DOMElement) |
|
|
} else if ( selector.nodeType ) { |
|
|
this.context = this[0] = selector; |
|
|
this.length = 1; |
|
|
return this; |
|
|
|
|
|
// HANDLE: $(function) |
|
|
// Shortcut for document ready |
|
|
} else if ( jQuery.isFunction( selector ) ) { |
|
|
return rootjQuery.ready( selector ); |
|
|
} |
|
|
|
|
|
if ( selector.selector !== undefined ) { |
|
|
this.selector = selector.selector; |
|
|
this.context = selector.context; |
|
|
} |
|
|
|
|
|
return jQuery.makeArray( selector, this ); |
|
|
}, |
|
|
|
|
|
// Start with an empty selector |
|
|
selector: "", |
|
|
|
|
|
// The default length of a jQuery object is 0 |
|
|
length: 0, |
|
|
|
|
|
// The number of elements contained in the matched element set |
|
|
size: function() { |
|
|
return this.length; |
|
|
}, |
|
|
|
|
|
toArray: function() { |
|
|
return core_slice.call( this ); |
|
|
}, |
|
|
|
|
|
// Get the Nth element in the matched element set OR |
|
|
// Get the whole matched element set as a clean array |
|
|
get: function( num ) { |
|
|
return num == null ? |
|
|
|
|
|
// Return a 'clean' array |
|
|
this.toArray() : |
|
|
|
|
|
// Return just the object |
|
|
( num < 0 ? this[ this.length + num ] : this[ num ] ); |
|
|
}, |
|
|
|
|
|
// Take an array of elements and push it onto the stack |
|
|
// (returning the new matched element set) |
|
|
pushStack: function( elems ) { |
|
|
|
|
|
// Build a new jQuery matched element set |
|
|
var ret = jQuery.merge( this.constructor(), elems ); |
|
|
|
|
|
// Add the old object onto the stack (as a reference) |
|
|
ret.prevObject = this; |
|
|
ret.context = this.context; |
|
|
|
|
|
// Return the newly-formed element set |
|
|
return ret; |
|
|
}, |
|
|
|
|
|
// Execute a callback for every element in the matched set. |
|
|
// (You can seed the arguments with an array of args, but this is |
|
|
// only used internally.) |
|
|
each: function( callback, args ) { |
|
|
return jQuery.each( this, callback, args ); |
|
|
}, |
|
|
|
|
|
ready: function( fn ) { |
|
|
// Add the callback |
|
|
jQuery.ready.promise().done( fn ); |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
slice: function() { |
|
|
return this.pushStack( core_slice.apply( this, arguments ) ); |
|
|
}, |
|
|
|
|
|
first: function() { |
|
|
return this.eq( 0 ); |
|
|
}, |
|
|
|
|
|
last: function() { |
|
|
return this.eq( -1 ); |
|
|
}, |
|
|
|
|
|
eq: function( i ) { |
|
|
var len = this.length, |
|
|
j = +i + ( i < 0 ? len : 0 ); |
|
|
return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] ); |
|
|
}, |
|
|
|
|
|
map: function( callback ) { |
|
|
return this.pushStack( jQuery.map(this, function( elem, i ) { |
|
|
return callback.call( elem, i, elem ); |
|
|
})); |
|
|
}, |
|
|
|
|
|
end: function() { |
|
|
return this.prevObject || this.constructor(null); |
|
|
}, |
|
|
|
|
|
// For internal use only. |
|
|
// Behaves like an Array's method, not like a jQuery method. |
|
|
push: core_push, |
|
|
sort: [].sort, |
|
|
splice: [].splice |
|
|
}; |
|
|
|
|
|
// Give the init function the jQuery prototype for later instantiation |
|
|
jQuery.fn.init.prototype = jQuery.fn; |
|
|
|
|
|
jQuery.extend = jQuery.fn.extend = function() { |
|
|
var src, copyIsArray, copy, name, options, clone, |
|
|
target = arguments[0] || {}, |
|
|
i = 1, |
|
|
length = arguments.length, |
|
|
deep = false; |
|
|
|
|
|
// Handle a deep copy situation |
|
|
if ( typeof target === "boolean" ) { |
|
|
deep = target; |
|
|
target = arguments[1] || {}; |
|
|
// skip the boolean and the target |
|
|
i = 2; |
|
|
} |
|
|
|
|
|
// Handle case when target is a string or something (possible in deep copy) |
|
|
if ( typeof target !== "object" && !jQuery.isFunction(target) ) { |
|
|
target = {}; |
|
|
} |
|
|
|
|
|
// extend jQuery itself if only one argument is passed |
|
|
if ( length === i ) { |
|
|
target = this; |
|
|
--i; |
|
|
} |
|
|
|
|
|
for ( ; i < length; i++ ) { |
|
|
// Only deal with non-null/undefined values |
|
|
if ( (options = arguments[ i ]) != null ) { |
|
|
// Extend the base object |
|
|
for ( name in options ) { |
|
|
src = target[ name ]; |
|
|
copy = options[ name ]; |
|
|
|
|
|
// Prevent never-ending loop |
|
|
if ( target === copy ) { |
|
|
continue; |
|
|
} |
|
|
|
|
|
// Recurse if we're merging plain objects or arrays |
|
|
if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) { |
|
|
if ( copyIsArray ) { |
|
|
copyIsArray = false; |
|
|
clone = src && jQuery.isArray(src) ? src : []; |
|
|
|
|
|
} else { |
|
|
clone = src && jQuery.isPlainObject(src) ? src : {}; |
|
|
} |
|
|
|
|
|
// Never move original objects, clone them |
|
|
target[ name ] = jQuery.extend( deep, clone, copy ); |
|
|
|
|
|
// Don't bring in undefined values |
|
|
} else if ( copy !== undefined ) { |
|
|
target[ name ] = copy; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Return the modified object |
|
|
return target; |
|
|
}; |
|
|
|
|
|
jQuery.extend({ |
|
|
noConflict: function( deep ) { |
|
|
if ( window.$ === jQuery ) { |
|
|
window.$ = _$; |
|
|
} |
|
|
|
|
|
if ( deep && window.jQuery === jQuery ) { |
|
|
window.jQuery = _jQuery; |
|
|
} |
|
|
|
|
|
return jQuery; |
|
|
}, |
|
|
|
|
|
// Is the DOM ready to be used? Set to true once it occurs. |
|
|
isReady: false, |
|
|
|
|
|
// A counter to track how many items to wait for before |
|
|
// the ready event fires. See #6781 |
|
|
readyWait: 1, |
|
|
|
|
|
// Hold (or release) the ready event |
|
|
holdReady: function( hold ) { |
|
|
if ( hold ) { |
|
|
jQuery.readyWait++; |
|
|
} else { |
|
|
jQuery.ready( true ); |
|
|
} |
|
|
}, |
|
|
|
|
|
// Handle when the DOM is ready |
|
|
ready: function( wait ) { |
|
|
|
|
|
// Abort if there are pending holds or we're already ready |
|
|
if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443). |
|
|
if ( !document.body ) { |
|
|
return setTimeout( jQuery.ready ); |
|
|
} |
|
|
|
|
|
// Remember that the DOM is ready |
|
|
jQuery.isReady = true; |
|
|
|
|
|
// If a normal DOM Ready event fired, decrement, and wait if need be |
|
|
if ( wait !== true && --jQuery.readyWait > 0 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// If there are functions bound, to execute |
|
|
readyList.resolveWith( document, [ jQuery ] ); |
|
|
|
|
|
// Trigger any bound ready events |
|
|
if ( jQuery.fn.trigger ) { |
|
|
jQuery( document ).trigger("ready").off("ready"); |
|
|
} |
|
|
}, |
|
|
|
|
|
// See test/unit/core.js for details concerning isFunction. |
|
|
// Since version 1.3, DOM methods and functions like alert |
|
|
// aren't supported. They return false on IE (#2968). |
|
|
isFunction: function( obj ) { |
|
|
return jQuery.type(obj) === "function"; |
|
|
}, |
|
|
|
|
|
isArray: Array.isArray || function( obj ) { |
|
|
return jQuery.type(obj) === "array"; |
|
|
}, |
|
|
|
|
|
isWindow: function( obj ) { |
|
|
return obj != null && obj == obj.window; |
|
|
}, |
|
|
|
|
|
isNumeric: function( obj ) { |
|
|
return !isNaN( parseFloat(obj) ) && isFinite( obj ); |
|
|
}, |
|
|
|
|
|
type: function( obj ) { |
|
|
if ( obj == null ) { |
|
|
return String( obj ); |
|
|
} |
|
|
return typeof obj === "object" || typeof obj === "function" ? |
|
|
class2type[ core_toString.call(obj) ] || "object" : |
|
|
typeof obj; |
|
|
}, |
|
|
|
|
|
isPlainObject: function( obj ) { |
|
|
// Must be an Object. |
|
|
// Because of IE, we also have to check the presence of the constructor property. |
|
|
// Make sure that DOM nodes and window objects don't pass through, as well |
|
|
if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
try { |
|
|
// Not own constructor property must be Object |
|
|
if ( obj.constructor && |
|
|
!core_hasOwn.call(obj, "constructor") && |
|
|
!core_hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) { |
|
|
return false; |
|
|
} |
|
|
} catch ( e ) { |
|
|
// IE8,9 Will throw exceptions on certain host objects #9897 |
|
|
return false; |
|
|
} |
|
|
|
|
|
// Own properties are enumerated firstly, so to speed up, |
|
|
// if last one is own, then all properties are own. |
|
|
|
|
|
var key; |
|
|
for ( key in obj ) {} |
|
|
|
|
|
return key === undefined || core_hasOwn.call( obj, key ); |
|
|
}, |
|
|
|
|
|
isEmptyObject: function( obj ) { |
|
|
var name; |
|
|
for ( name in obj ) { |
|
|
return false; |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
error: function( msg ) { |
|
|
throw new Error( msg ); |
|
|
}, |
|
|
|
|
|
// data: string of html |
|
|
// context (optional): If specified, the fragment will be created in this context, defaults to document |
|
|
// keepScripts (optional): If true, will include scripts passed in the html string |
|
|
parseHTML: function( data, context, keepScripts ) { |
|
|
if ( !data || typeof data !== "string" ) { |
|
|
return null; |
|
|
} |
|
|
if ( typeof context === "boolean" ) { |
|
|
keepScripts = context; |
|
|
context = false; |
|
|
} |
|
|
context = context || document; |
|
|
|
|
|
var parsed = rsingleTag.exec( data ), |
|
|
scripts = !keepScripts && []; |
|
|
|
|
|
// Single tag |
|
|
if ( parsed ) { |
|
|
return [ context.createElement( parsed[1] ) ]; |
|
|
} |
|
|
|
|
|
parsed = jQuery.buildFragment( [ data ], context, scripts ); |
|
|
if ( scripts ) { |
|
|
jQuery( scripts ).remove(); |
|
|
} |
|
|
return jQuery.merge( [], parsed.childNodes ); |
|
|
}, |
|
|
|
|
|
parseJSON: function( data ) { |
|
|
// Attempt to parse using the native JSON parser first |
|
|
if ( window.JSON && window.JSON.parse ) { |
|
|
return window.JSON.parse( data ); |
|
|
} |
|
|
|
|
|
if ( data === null ) { |
|
|
return data; |
|
|
} |
|
|
|
|
|
if ( typeof data === "string" ) { |
|
|
|
|
|
// Make sure leading/trailing whitespace is removed (IE can't handle it) |
|
|
data = jQuery.trim( data ); |
|
|
|
|
|
if ( data ) { |
|
|
// Make sure the incoming data is actual JSON |
|
|
// Logic borrowed from http://json.org/json2.js |
|
|
if ( rvalidchars.test( data.replace( rvalidescape, "@" ) |
|
|
.replace( rvalidtokens, "]" ) |
|
|
.replace( rvalidbraces, "")) ) { |
|
|
|
|
|
return ( new Function( "return " + data ) )(); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.error( "Invalid JSON: " + data ); |
|
|
}, |
|
|
|
|
|
// Cross-browser xml parsing |
|
|
parseXML: function( data ) { |
|
|
var xml, tmp; |
|
|
if ( !data || typeof data !== "string" ) { |
|
|
return null; |
|
|
} |
|
|
try { |
|
|
if ( window.DOMParser ) { // Standard |
|
|
tmp = new DOMParser(); |
|
|
xml = tmp.parseFromString( data , "text/xml" ); |
|
|
} else { // IE |
|
|
xml = new ActiveXObject( "Microsoft.XMLDOM" ); |
|
|
xml.async = "false"; |
|
|
xml.loadXML( data ); |
|
|
} |
|
|
} catch( e ) { |
|
|
xml = undefined; |
|
|
} |
|
|
if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) { |
|
|
jQuery.error( "Invalid XML: " + data ); |
|
|
} |
|
|
return xml; |
|
|
}, |
|
|
|
|
|
noop: function() {}, |
|
|
|
|
|
// Evaluates a script in a global context |
|
|
// Workarounds based on findings by Jim Driscoll |
|
|
// http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context |
|
|
globalEval: function( data ) { |
|
|
if ( data && jQuery.trim( data ) ) { |
|
|
// We use execScript on Internet Explorer |
|
|
// We use an anonymous function so that context is window |
|
|
// rather than jQuery in Firefox |
|
|
( window.execScript || function( data ) { |
|
|
window[ "eval" ].call( window, data ); |
|
|
} )( data ); |
|
|
} |
|
|
}, |
|
|
|
|
|
// Convert dashed to camelCase; used by the css and data modules |
|
|
// Microsoft forgot to hump their vendor prefix (#9572) |
|
|
camelCase: function( string ) { |
|
|
return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase ); |
|
|
}, |
|
|
|
|
|
nodeName: function( elem, name ) { |
|
|
return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase(); |
|
|
}, |
|
|
|
|
|
// args is for internal usage only |
|
|
each: function( obj, callback, args ) { |
|
|
var value, |
|
|
i = 0, |
|
|
length = obj.length, |
|
|
isArray = isArraylike( obj ); |
|
|
|
|
|
if ( args ) { |
|
|
if ( isArray ) { |
|
|
for ( ; i < length; i++ ) { |
|
|
value = callback.apply( obj[ i ], args ); |
|
|
|
|
|
if ( value === false ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
for ( i in obj ) { |
|
|
value = callback.apply( obj[ i ], args ); |
|
|
|
|
|
if ( value === false ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// A special, fast, case for the most common use of each |
|
|
} else { |
|
|
if ( isArray ) { |
|
|
for ( ; i < length; i++ ) { |
|
|
value = callback.call( obj[ i ], i, obj[ i ] ); |
|
|
|
|
|
if ( value === false ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
for ( i in obj ) { |
|
|
value = callback.call( obj[ i ], i, obj[ i ] ); |
|
|
|
|
|
if ( value === false ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return obj; |
|
|
}, |
|
|
|
|
|
// Use native String.trim function wherever possible |
|
|
trim: core_trim && !core_trim.call("\uFEFF\xA0") ? |
|
|
function( text ) { |
|
|
return text == null ? |
|
|
"" : |
|
|
core_trim.call( text ); |
|
|
} : |
|
|
|
|
|
// Otherwise use our own trimming functionality |
|
|
function( text ) { |
|
|
return text == null ? |
|
|
"" : |
|
|
( text + "" ).replace( rtrim, "" ); |
|
|
}, |
|
|
|
|
|
// results is for internal usage only |
|
|
makeArray: function( arr, results ) { |
|
|
var ret = results || []; |
|
|
|
|
|
if ( arr != null ) { |
|
|
if ( isArraylike( Object(arr) ) ) { |
|
|
jQuery.merge( ret, |
|
|
typeof arr === "string" ? |
|
|
[ arr ] : arr |
|
|
); |
|
|
} else { |
|
|
core_push.call( ret, arr ); |
|
|
} |
|
|
} |
|
|
|
|
|
return ret; |
|
|
}, |
|
|
|
|
|
inArray: function( elem, arr, i ) { |
|
|
var len; |
|
|
|
|
|
if ( arr ) { |
|
|
if ( core_indexOf ) { |
|
|
return core_indexOf.call( arr, elem, i ); |
|
|
} |
|
|
|
|
|
len = arr.length; |
|
|
i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
// Skip accessing in sparse arrays |
|
|
if ( i in arr && arr[ i ] === elem ) { |
|
|
return i; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return -1; |
|
|
}, |
|
|
|
|
|
merge: function( first, second ) { |
|
|
var l = second.length, |
|
|
i = first.length, |
|
|
j = 0; |
|
|
|
|
|
if ( typeof l === "number" ) { |
|
|
for ( ; j < l; j++ ) { |
|
|
first[ i++ ] = second[ j ]; |
|
|
} |
|
|
} else { |
|
|
while ( second[j] !== undefined ) { |
|
|
first[ i++ ] = second[ j++ ]; |
|
|
} |
|
|
} |
|
|
|
|
|
first.length = i; |
|
|
|
|
|
return first; |
|
|
}, |
|
|
|
|
|
grep: function( elems, callback, inv ) { |
|
|
var retVal, |
|
|
ret = [], |
|
|
i = 0, |
|
|
length = elems.length; |
|
|
inv = !!inv; |
|
|
|
|
|
// Go through the array, only saving the items |
|
|
// that pass the validator function |
|
|
for ( ; i < length; i++ ) { |
|
|
retVal = !!callback( elems[ i ], i ); |
|
|
if ( inv !== retVal ) { |
|
|
ret.push( elems[ i ] ); |
|
|
} |
|
|
} |
|
|
|
|
|
return ret; |
|
|
}, |
|
|
|
|
|
// arg is for internal usage only |
|
|
map: function( elems, callback, arg ) { |
|
|
var value, |
|
|
i = 0, |
|
|
length = elems.length, |
|
|
isArray = isArraylike( elems ), |
|
|
ret = []; |
|
|
|
|
|
// Go through the array, translating each of the items to their |
|
|
if ( isArray ) { |
|
|
for ( ; i < length; i++ ) { |
|
|
value = callback( elems[ i ], i, arg ); |
|
|
|
|
|
if ( value != null ) { |
|
|
ret[ ret.length ] = value; |
|
|
} |
|
|
} |
|
|
|
|
|
// Go through every key on the object, |
|
|
} else { |
|
|
for ( i in elems ) { |
|
|
value = callback( elems[ i ], i, arg ); |
|
|
|
|
|
if ( value != null ) { |
|
|
ret[ ret.length ] = value; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Flatten any nested arrays |
|
|
return core_concat.apply( [], ret ); |
|
|
}, |
|
|
|
|
|
// A global GUID counter for objects |
|
|
guid: 1, |
|
|
|
|
|
// Bind a function to a context, optionally partially applying any |
|
|
// arguments. |
|
|
proxy: function( fn, context ) { |
|
|
var args, proxy, tmp; |
|
|
|
|
|
if ( typeof context === "string" ) { |
|
|
tmp = fn[ context ]; |
|
|
context = fn; |
|
|
fn = tmp; |
|
|
} |
|
|
|
|
|
// Quick check to determine if target is callable, in the spec |
|
|
// this throws a TypeError, but we will just return undefined. |
|
|
if ( !jQuery.isFunction( fn ) ) { |
|
|
return undefined; |
|
|
} |
|
|
|
|
|
// Simulated bind |
|
|
args = core_slice.call( arguments, 2 ); |
|
|
proxy = function() { |
|
|
return fn.apply( context || this, args.concat( core_slice.call( arguments ) ) ); |
|
|
}; |
|
|
|
|
|
// Set the guid of unique handler to the same of original handler, so it can be removed |
|
|
proxy.guid = fn.guid = fn.guid || jQuery.guid++; |
|
|
|
|
|
return proxy; |
|
|
}, |
|
|
|
|
|
// Multifunctional method to get and set values of a collection |
|
|
// The value/s can optionally be executed if it's a function |
|
|
access: function( elems, fn, key, value, chainable, emptyGet, raw ) { |
|
|
var i = 0, |
|
|
length = elems.length, |
|
|
bulk = key == null; |
|
|
|
|
|
// Sets many values |
|
|
if ( jQuery.type( key ) === "object" ) { |
|
|
chainable = true; |
|
|
for ( i in key ) { |
|
|
jQuery.access( elems, fn, i, key[i], true, emptyGet, raw ); |
|
|
} |
|
|
|
|
|
// Sets one value |
|
|
} else if ( value !== undefined ) { |
|
|
chainable = true; |
|
|
|
|
|
if ( !jQuery.isFunction( value ) ) { |
|
|
raw = true; |
|
|
} |
|
|
|
|
|
if ( bulk ) { |
|
|
// Bulk operations run against the entire set |
|
|
if ( raw ) { |
|
|
fn.call( elems, value ); |
|
|
fn = null; |
|
|
|
|
|
// ...except when executing function values |
|
|
} else { |
|
|
bulk = fn; |
|
|
fn = function( elem, key, value ) { |
|
|
return bulk.call( jQuery( elem ), value ); |
|
|
}; |
|
|
} |
|
|
} |
|
|
|
|
|
if ( fn ) { |
|
|
for ( ; i < length; i++ ) { |
|
|
fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return chainable ? |
|
|
elems : |
|
|
|
|
|
// Gets |
|
|
bulk ? |
|
|
fn.call( elems ) : |
|
|
length ? fn( elems[0], key ) : emptyGet; |
|
|
}, |
|
|
|
|
|
now: function() { |
|
|
return ( new Date() ).getTime(); |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.ready.promise = function( obj ) { |
|
|
if ( !readyList ) { |
|
|
|
|
|
readyList = jQuery.Deferred(); |
|
|
|
|
|
// Catch cases where $(document).ready() is called after the browser event has already occurred. |
|
|
// we once tried to use readyState "interactive" here, but it caused issues like the one |
|
|
// discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15 |
|
|
if ( document.readyState === "complete" ) { |
|
|
// Handle it asynchronously to allow scripts the opportunity to delay ready |
|
|
setTimeout( jQuery.ready ); |
|
|
|
|
|
// Standards-based browsers support DOMContentLoaded |
|
|
} else if ( document.addEventListener ) { |
|
|
// Use the handy event callback |
|
|
document.addEventListener( "DOMContentLoaded", completed, false ); |
|
|
|
|
|
// A fallback to window.onload, that will always work |
|
|
window.addEventListener( "load", completed, false ); |
|
|
|
|
|
// If IE event model is used |
|
|
} else { |
|
|
// Ensure firing before onload, maybe late but safe also for iframes |
|
|
document.attachEvent( "onreadystatechange", completed ); |
|
|
|
|
|
// A fallback to window.onload, that will always work |
|
|
window.attachEvent( "onload", completed ); |
|
|
|
|
|
// If IE and not a frame |
|
|
// continually check to see if the document is ready |
|
|
var top = false; |
|
|
|
|
|
try { |
|
|
top = window.frameElement == null && document.documentElement; |
|
|
} catch(e) {} |
|
|
|
|
|
if ( top && top.doScroll ) { |
|
|
(function doScrollCheck() { |
|
|
if ( !jQuery.isReady ) { |
|
|
|
|
|
try { |
|
|
// Use the trick by Diego Perini |
|
|
// http://javascript.nwbox.com/IEContentLoaded/ |
|
|
top.doScroll("left"); |
|
|
} catch(e) { |
|
|
return setTimeout( doScrollCheck, 50 ); |
|
|
} |
|
|
|
|
|
// detach all dom ready events |
|
|
detach(); |
|
|
|
|
|
// and execute any waiting functions |
|
|
jQuery.ready(); |
|
|
} |
|
|
})(); |
|
|
} |
|
|
} |
|
|
} |
|
|
return readyList.promise( obj ); |
|
|
}; |
|
|
|
|
|
// Populate the class2type map |
|
|
jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) { |
|
|
class2type[ "[object " + name + "]" ] = name.toLowerCase(); |
|
|
}); |
|
|
|
|
|
function isArraylike( obj ) { |
|
|
var length = obj.length, |
|
|
type = jQuery.type( obj ); |
|
|
|
|
|
if ( jQuery.isWindow( obj ) ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
if ( obj.nodeType === 1 && length ) { |
|
|
return true; |
|
|
} |
|
|
|
|
|
return type === "array" || type !== "function" && |
|
|
( length === 0 || |
|
|
typeof length === "number" && length > 0 && ( length - 1 ) in obj ); |
|
|
} |
|
|
|
|
|
// All jQuery objects should point back to these |
|
|
rootjQuery = jQuery(document); |
|
|
// String to Object options format cache |
|
|
var optionsCache = {}; |
|
|
|
|
|
// Convert String-formatted options into Object-formatted ones and store in cache |
|
|
function createOptions( options ) { |
|
|
var object = optionsCache[ options ] = {}; |
|
|
jQuery.each( options.match( core_rnotwhite ) || [], function( _, flag ) { |
|
|
object[ flag ] = true; |
|
|
}); |
|
|
return object; |
|
|
} |
|
|
|
|
|
/* |
|
|
* Create a callback list using the following parameters: |
|
|
* |
|
|
* options: an optional list of space-separated options that will change how |
|
|
* the callback list behaves or a more traditional option object |
|
|
* |
|
|
* By default a callback list will act like an event callback list and can be |
|
|
* "fired" multiple times. |
|
|
* |
|
|
* Possible options: |
|
|
* |
|
|
* once: will ensure the callback list can only be fired once (like a Deferred) |
|
|
* |
|
|
* memory: will keep track of previous values and will call any callback added |
|
|
* after the list has been fired right away with the latest "memorized" |
|
|
* values (like a Deferred) |
|
|
* |
|
|
* unique: will ensure a callback can only be added once (no duplicate in the list) |
|
|
* |
|
|
* stopOnFalse: interrupt callings when a callback returns false |
|
|
* |
|
|
*/ |
|
|
jQuery.Callbacks = function( options ) { |
|
|
|
|
|
// Convert options from String-formatted to Object-formatted if needed |
|
|
// (we check in cache first) |
|
|
options = typeof options === "string" ? |
|
|
( optionsCache[ options ] || createOptions( options ) ) : |
|
|
jQuery.extend( {}, options ); |
|
|
|
|
|
var // Flag to know if list is currently firing |
|
|
firing, |
|
|
// Last fire value (for non-forgettable lists) |
|
|
memory, |
|
|
// Flag to know if list was already fired |
|
|
fired, |
|
|
// End of the loop when firing |
|
|
firingLength, |
|
|
// Index of currently firing callback (modified by remove if needed) |
|
|
firingIndex, |
|
|
// First callback to fire (used internally by add and fireWith) |
|
|
firingStart, |
|
|
// Actual callback list |
|
|
list = [], |
|
|
// Stack of fire calls for repeatable lists |
|
|
stack = !options.once && [], |
|
|
// Fire callbacks |
|
|
fire = function( data ) { |
|
|
memory = options.memory && data; |
|
|
fired = true; |
|
|
firingIndex = firingStart || 0; |
|
|
firingStart = 0; |
|
|
firingLength = list.length; |
|
|
firing = true; |
|
|
for ( ; list && firingIndex < firingLength; firingIndex++ ) { |
|
|
if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) { |
|
|
memory = false; // To prevent further calls using add |
|
|
break; |
|
|
} |
|
|
} |
|
|
firing = false; |
|
|
if ( list ) { |
|
|
if ( stack ) { |
|
|
if ( stack.length ) { |
|
|
fire( stack.shift() ); |
|
|
} |
|
|
} else if ( memory ) { |
|
|
list = []; |
|
|
} else { |
|
|
self.disable(); |
|
|
} |
|
|
} |
|
|
}, |
|
|
// Actual Callbacks object |
|
|
self = { |
|
|
// Add a callback or a collection of callbacks to the list |
|
|
add: function() { |
|
|
if ( list ) { |
|
|
// First, we save the current length |
|
|
var start = list.length; |
|
|
(function add( args ) { |
|
|
jQuery.each( args, function( _, arg ) { |
|
|
var type = jQuery.type( arg ); |
|
|
if ( type === "function" ) { |
|
|
if ( !options.unique || !self.has( arg ) ) { |
|
|
list.push( arg ); |
|
|
} |
|
|
} else if ( arg && arg.length && type !== "string" ) { |
|
|
// Inspect recursively |
|
|
add( arg ); |
|
|
} |
|
|
}); |
|
|
})( arguments ); |
|
|
// Do we need to add the callbacks to the |
|
|
// current firing batch? |
|
|
if ( firing ) { |
|
|
firingLength = list.length; |
|
|
// With memory, if we're not firing then |
|
|
// we should call right away |
|
|
} else if ( memory ) { |
|
|
firingStart = start; |
|
|
fire( memory ); |
|
|
} |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
// Remove a callback from the list |
|
|
remove: function() { |
|
|
if ( list ) { |
|
|
jQuery.each( arguments, function( _, arg ) { |
|
|
var index; |
|
|
while( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) { |
|
|
list.splice( index, 1 ); |
|
|
// Handle firing indexes |
|
|
if ( firing ) { |
|
|
if ( index <= firingLength ) { |
|
|
firingLength--; |
|
|
} |
|
|
if ( index <= firingIndex ) { |
|
|
firingIndex--; |
|
|
} |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
// Check if a given callback is in the list. |
|
|
// If no argument is given, return whether or not list has callbacks attached. |
|
|
has: function( fn ) { |
|
|
return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length ); |
|
|
}, |
|
|
// Remove all callbacks from the list |
|
|
empty: function() { |
|
|
list = []; |
|
|
return this; |
|
|
}, |
|
|
// Have the list do nothing anymore |
|
|
disable: function() { |
|
|
list = stack = memory = undefined; |
|
|
return this; |
|
|
}, |
|
|
// Is it disabled? |
|
|
disabled: function() { |
|
|
return !list; |
|
|
}, |
|
|
// Lock the list in its current state |
|
|
lock: function() { |
|
|
stack = undefined; |
|
|
if ( !memory ) { |
|
|
self.disable(); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
// Is it locked? |
|
|
locked: function() { |
|
|
return !stack; |
|
|
}, |
|
|
// Call all callbacks with the given context and arguments |
|
|
fireWith: function( context, args ) { |
|
|
args = args || []; |
|
|
args = [ context, args.slice ? args.slice() : args ]; |
|
|
if ( list && ( !fired || stack ) ) { |
|
|
if ( firing ) { |
|
|
stack.push( args ); |
|
|
} else { |
|
|
fire( args ); |
|
|
} |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
// Call all the callbacks with the given arguments |
|
|
fire: function() { |
|
|
self.fireWith( this, arguments ); |
|
|
return this; |
|
|
}, |
|
|
// To know if the callbacks have already been called at least once |
|
|
fired: function() { |
|
|
return !!fired; |
|
|
} |
|
|
}; |
|
|
|
|
|
return self; |
|
|
}; |
|
|
jQuery.extend({ |
|
|
|
|
|
Deferred: function( func ) { |
|
|
var tuples = [ |
|
|
// action, add listener, listener list, final state |
|
|
[ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ], |
|
|
[ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ], |
|
|
[ "notify", "progress", jQuery.Callbacks("memory") ] |
|
|
], |
|
|
state = "pending", |
|
|
promise = { |
|
|
state: function() { |
|
|
return state; |
|
|
}, |
|
|
always: function() { |
|
|
deferred.done( arguments ).fail( arguments ); |
|
|
return this; |
|
|
}, |
|
|
then: function( /* fnDone, fnFail, fnProgress */ ) { |
|
|
var fns = arguments; |
|
|
return jQuery.Deferred(function( newDefer ) { |
|
|
jQuery.each( tuples, function( i, tuple ) { |
|
|
var action = tuple[ 0 ], |
|
|
fn = jQuery.isFunction( fns[ i ] ) && fns[ i ]; |
|
|
// deferred[ done | fail | progress ] for forwarding actions to newDefer |
|
|
deferred[ tuple[1] ](function() { |
|
|
var returned = fn && fn.apply( this, arguments ); |
|
|
if ( returned && jQuery.isFunction( returned.promise ) ) { |
|
|
returned.promise() |
|
|
.done( newDefer.resolve ) |
|
|
.fail( newDefer.reject ) |
|
|
.progress( newDefer.notify ); |
|
|
} else { |
|
|
newDefer[ action + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments ); |
|
|
} |
|
|
}); |
|
|
}); |
|
|
fns = null; |
|
|
}).promise(); |
|
|
}, |
|
|
// Get a promise for this deferred |
|
|
// If obj is provided, the promise aspect is added to the object |
|
|
promise: function( obj ) { |
|
|
return obj != null ? jQuery.extend( obj, promise ) : promise; |
|
|
} |
|
|
}, |
|
|
deferred = {}; |
|
|
|
|
|
// Keep pipe for back-compat |
|
|
promise.pipe = promise.then; |
|
|
|
|
|
// Add list-specific methods |
|
|
jQuery.each( tuples, function( i, tuple ) { |
|
|
var list = tuple[ 2 ], |
|
|
stateString = tuple[ 3 ]; |
|
|
|
|
|
// promise[ done | fail | progress ] = list.add |
|
|
promise[ tuple[1] ] = list.add; |
|
|
|
|
|
// Handle state |
|
|
if ( stateString ) { |
|
|
list.add(function() { |
|
|
// state = [ resolved | rejected ] |
|
|
state = stateString; |
|
|
|
|
|
// [ reject_list | resolve_list ].disable; progress_list.lock |
|
|
}, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock ); |
|
|
} |
|
|
|
|
|
// deferred[ resolve | reject | notify ] |
|
|
deferred[ tuple[0] ] = function() { |
|
|
deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments ); |
|
|
return this; |
|
|
}; |
|
|
deferred[ tuple[0] + "With" ] = list.fireWith; |
|
|
}); |
|
|
|
|
|
// Make the deferred a promise |
|
|
promise.promise( deferred ); |
|
|
|
|
|
// Call given func if any |
|
|
if ( func ) { |
|
|
func.call( deferred, deferred ); |
|
|
} |
|
|
|
|
|
// All done! |
|
|
return deferred; |
|
|
}, |
|
|
|
|
|
// Deferred helper |
|
|
when: function( subordinate /* , ..., subordinateN */ ) { |
|
|
var i = 0, |
|
|
resolveValues = core_slice.call( arguments ), |
|
|
length = resolveValues.length, |
|
|
|
|
|
// the count of uncompleted subordinates |
|
|
remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0, |
|
|
|
|
|
// the master Deferred. If resolveValues consist of only a single Deferred, just use that. |
|
|
deferred = remaining === 1 ? subordinate : jQuery.Deferred(), |
|
|
|
|
|
// Update function for both resolve and progress values |
|
|
updateFunc = function( i, contexts, values ) { |
|
|
return function( value ) { |
|
|
contexts[ i ] = this; |
|
|
values[ i ] = arguments.length > 1 ? core_slice.call( arguments ) : value; |
|
|
if( values === progressValues ) { |
|
|
deferred.notifyWith( contexts, values ); |
|
|
} else if ( !( --remaining ) ) { |
|
|
deferred.resolveWith( contexts, values ); |
|
|
} |
|
|
}; |
|
|
}, |
|
|
|
|
|
progressValues, progressContexts, resolveContexts; |
|
|
|
|
|
// add listeners to Deferred subordinates; treat others as resolved |
|
|
if ( length > 1 ) { |
|
|
progressValues = new Array( length ); |
|
|
progressContexts = new Array( length ); |
|
|
resolveContexts = new Array( length ); |
|
|
for ( ; i < length; i++ ) { |
|
|
if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) { |
|
|
resolveValues[ i ].promise() |
|
|
.done( updateFunc( i, resolveContexts, resolveValues ) ) |
|
|
.fail( deferred.reject ) |
|
|
.progress( updateFunc( i, progressContexts, progressValues ) ); |
|
|
} else { |
|
|
--remaining; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// if we're not waiting on anything, resolve the master |
|
|
if ( !remaining ) { |
|
|
deferred.resolveWith( resolveContexts, resolveValues ); |
|
|
} |
|
|
|
|
|
return deferred.promise(); |
|
|
} |
|
|
}); |
|
|
jQuery.support = (function() { |
|
|
|
|
|
var support, all, a, |
|
|
input, select, fragment, |
|
|
opt, eventName, isSupported, i, |
|
|
div = document.createElement("div"); |
|
|
|
|
|
// Setup |
|
|
div.setAttribute( "className", "t" ); |
|
|
div.innerHTML = " <link/><table></table><a href='/a'>a</a><input type='checkbox'/>"; |
|
|
|
|
|
// Support tests won't run in some limited or non-browser environments |
|
|
all = div.getElementsByTagName("*"); |
|
|
a = div.getElementsByTagName("a")[ 0 ]; |
|
|
if ( !all || !a || !all.length ) { |
|
|
return {}; |
|
|
} |
|
|
|
|
|
// First batch of tests |
|
|
select = document.createElement("select"); |
|
|
opt = select.appendChild( document.createElement("option") ); |
|
|
input = div.getElementsByTagName("input")[ 0 ]; |
|
|
|
|
|
a.style.cssText = "top:1px;float:left;opacity:.5"; |
|
|
support = { |
|
|
// Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7) |
|
|
getSetAttribute: div.className !== "t", |
|
|
|
|
|
// IE strips leading whitespace when .innerHTML is used |
|
|
leadingWhitespace: div.firstChild.nodeType === 3, |
|
|
|
|
|
// Make sure that tbody elements aren't automatically inserted |
|
|
// IE will insert them into empty tables |
|
|
tbody: !div.getElementsByTagName("tbody").length, |
|
|
|
|
|
// Make sure that link elements get serialized correctly by innerHTML |
|
|
// This requires a wrapper element in IE |
|
|
htmlSerialize: !!div.getElementsByTagName("link").length, |
|
|
|
|
|
// Get the style information from getAttribute |
|
|
// (IE uses .cssText instead) |
|
|
style: /top/.test( a.getAttribute("style") ), |
|
|
|
|
|
// Make sure that URLs aren't manipulated |
|
|
// (IE normalizes it by default) |
|
|
hrefNormalized: a.getAttribute("href") === "/a", |
|
|
|
|
|
// Make sure that element opacity exists |
|
|
// (IE uses filter instead) |
|
|
// Use a regex to work around a WebKit issue. See #5145 |
|
|
opacity: /^0.5/.test( a.style.opacity ), |
|
|
|
|
|
// Verify style float existence |
|
|
// (IE uses styleFloat instead of cssFloat) |
|
|
cssFloat: !!a.style.cssFloat, |
|
|
|
|
|
// Check the default checkbox/radio value ("" on WebKit; "on" elsewhere) |
|
|
checkOn: !!input.value, |
|
|
|
|
|
// Make sure that a selected-by-default option has a working selected property. |
|
|
// (WebKit defaults to false instead of true, IE too, if it's in an optgroup) |
|
|
optSelected: opt.selected, |
|
|
|
|
|
// Tests for enctype support on a form (#6743) |
|
|
enctype: !!document.createElement("form").enctype, |
|
|
|
|
|
// Makes sure cloning an html5 element does not cause problems |
|
|
// Where outerHTML is undefined, this still works |
|
|
html5Clone: document.createElement("nav").cloneNode( true ).outerHTML !== "<:nav></:nav>", |
|
|
|
|
|
// jQuery.support.boxModel DEPRECATED in 1.8 since we don't support Quirks Mode |
|
|
boxModel: document.compatMode === "CSS1Compat", |
|
|
|
|
|
// Will be defined later |
|
|
deleteExpando: true, |
|
|
noCloneEvent: true, |
|
|
inlineBlockNeedsLayout: false, |
|
|
shrinkWrapBlocks: false, |
|
|
reliableMarginRight: true, |
|
|
boxSizingReliable: true, |
|
|
pixelPosition: false |
|
|
}; |
|
|
|
|
|
// Make sure checked status is properly cloned |
|
|
input.checked = true; |
|
|
support.noCloneChecked = input.cloneNode( true ).checked; |
|
|
|
|
|
// Make sure that the options inside disabled selects aren't marked as disabled |
|
|
// (WebKit marks them as disabled) |
|
|
select.disabled = true; |
|
|
support.optDisabled = !opt.disabled; |
|
|
|
|
|
// Support: IE<9 |
|
|
try { |
|
|
delete div.test; |
|
|
} catch( e ) { |
|
|
support.deleteExpando = false; |
|
|
} |
|
|
|
|
|
// Check if we can trust getAttribute("value") |
|
|
input = document.createElement("input"); |
|
|
input.setAttribute( "value", "" ); |
|
|
support.input = input.getAttribute( "value" ) === ""; |
|
|
|
|
|
// Check if an input maintains its value after becoming a radio |
|
|
input.value = "t"; |
|
|
input.setAttribute( "type", "radio" ); |
|
|
support.radioValue = input.value === "t"; |
|
|
|
|
|
// #11217 - WebKit loses check when the name is after the checked attribute |
|
|
input.setAttribute( "checked", "t" ); |
|
|
input.setAttribute( "name", "t" ); |
|
|
|
|
|
fragment = document.createDocumentFragment(); |
|
|
fragment.appendChild( input ); |
|
|
|
|
|
// Check if a disconnected checkbox will retain its checked |
|
|
// value of true after appended to the DOM (IE6/7) |
|
|
support.appendChecked = input.checked; |
|
|
|
|
|
// WebKit doesn't clone checked state correctly in fragments |
|
|
support.checkClone = fragment.cloneNode( true ).cloneNode( true ).lastChild.checked; |
|
|
|
|
|
// Support: IE<9 |
|
|
// Opera does not clone events (and typeof div.attachEvent === undefined). |
|
|
// IE9-10 clones events bound via attachEvent, but they don't trigger with .click() |
|
|
if ( div.attachEvent ) { |
|
|
div.attachEvent( "onclick", function() { |
|
|
support.noCloneEvent = false; |
|
|
}); |
|
|
|
|
|
div.cloneNode( true ).click(); |
|
|
} |
|
|
|
|
|
// Support: IE<9 (lack submit/change bubble), Firefox 17+ (lack focusin event) |
|
|
// Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP), test/csp.php |
|
|
for ( i in { submit: true, change: true, focusin: true }) { |
|
|
div.setAttribute( eventName = "on" + i, "t" ); |
|
|
|
|
|
support[ i + "Bubbles" ] = eventName in window || div.attributes[ eventName ].expando === false; |
|
|
} |
|
|
|
|
|
div.style.backgroundClip = "content-box"; |
|
|
div.cloneNode( true ).style.backgroundClip = ""; |
|
|
support.clearCloneStyle = div.style.backgroundClip === "content-box"; |
|
|
|
|
|
// Run tests that need a body at doc ready |
|
|
jQuery(function() { |
|
|
var container, marginDiv, tds, |
|
|
divReset = "padding:0;margin:0;border:0;display:block;box-sizing:content-box;-moz-box-sizing:content-box;-webkit-box-sizing:content-box;", |
|
|
body = document.getElementsByTagName("body")[0]; |
|
|
|
|
|
if ( !body ) { |
|
|
// Return for frameset docs that don't have a body |
|
|
return; |
|
|
} |
|
|
|
|
|
container = document.createElement("div"); |
|
|
container.style.cssText = "border:0;width:0;height:0;position:absolute;top:0;left:-9999px;margin-top:1px"; |
|
|
|
|
|
body.appendChild( container ).appendChild( div ); |
|
|
|
|
|
// Support: IE8 |
|
|
// Check if table cells still have offsetWidth/Height when they are set |
|
|
// to display:none and there are still other visible table cells in a |
|
|
// table row; if so, offsetWidth/Height are not reliable for use when |
|
|
// determining if an element has been hidden directly using |
|
|
// display:none (it is still safe to use offsets if a parent element is |
|
|
// hidden; don safety goggles and see bug #4512 for more information). |
|
|
div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>"; |
|
|
tds = div.getElementsByTagName("td"); |
|
|
tds[ 0 ].style.cssText = "padding:0;margin:0;border:0;display:none"; |
|
|
isSupported = ( tds[ 0 ].offsetHeight === 0 ); |
|
|
|
|
|
tds[ 0 ].style.display = ""; |
|
|
tds[ 1 ].style.display = "none"; |
|
|
|
|
|
// Support: IE8 |
|
|
// Check if empty table cells still have offsetWidth/Height |
|
|
support.reliableHiddenOffsets = isSupported && ( tds[ 0 ].offsetHeight === 0 ); |
|
|
|
|
|
// Check box-sizing and margin behavior |
|
|
div.innerHTML = ""; |
|
|
div.style.cssText = "box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;padding:1px;border:1px;display:block;width:4px;margin-top:1%;position:absolute;top:1%;"; |
|
|
support.boxSizing = ( div.offsetWidth === 4 ); |
|
|
support.doesNotIncludeMarginInBodyOffset = ( body.offsetTop !== 1 ); |
|
|
|
|
|
// Use window.getComputedStyle because jsdom on node.js will break without it. |
|
|
if ( window.getComputedStyle ) { |
|
|
support.pixelPosition = ( window.getComputedStyle( div, null ) || {} ).top !== "1%"; |
|
|
support.boxSizingReliable = ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px"; |
|
|
|
|
|
// Check if div with explicit width and no margin-right incorrectly |
|
|
// gets computed margin-right based on width of container. (#3333) |
|
|
// Fails in WebKit before Feb 2011 nightlies |
|
|
// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right |
|
|
marginDiv = div.appendChild( document.createElement("div") ); |
|
|
marginDiv.style.cssText = div.style.cssText = divReset; |
|
|
marginDiv.style.marginRight = marginDiv.style.width = "0"; |
|
|
div.style.width = "1px"; |
|
|
|
|
|
support.reliableMarginRight = |
|
|
!parseFloat( ( window.getComputedStyle( marginDiv, null ) || {} ).marginRight ); |
|
|
} |
|
|
|
|
|
if ( typeof div.style.zoom !== core_strundefined ) { |
|
|
// Support: IE<8 |
|
|
// Check if natively block-level elements act like inline-block |
|
|
// elements when setting their display to 'inline' and giving |
|
|
// them layout |
|
|
div.innerHTML = ""; |
|
|
div.style.cssText = divReset + "width:1px;padding:1px;display:inline;zoom:1"; |
|
|
support.inlineBlockNeedsLayout = ( div.offsetWidth === 3 ); |
|
|
|
|
|
// Support: IE6 |
|
|
// Check if elements with layout shrink-wrap their children |
|
|
div.style.display = "block"; |
|
|
div.innerHTML = "<div></div>"; |
|
|
div.firstChild.style.width = "5px"; |
|
|
support.shrinkWrapBlocks = ( div.offsetWidth !== 3 ); |
|
|
|
|
|
if ( support.inlineBlockNeedsLayout ) { |
|
|
// Prevent IE 6 from affecting layout for positioned elements #11048 |
|
|
// Prevent IE from shrinking the body in IE 7 mode #12869 |
|
|
// Support: IE<8 |
|
|
body.style.zoom = 1; |
|
|
} |
|
|
} |
|
|
|
|
|
body.removeChild( container ); |
|
|
|
|
|
// Null elements to avoid leaks in IE |
|
|
container = div = tds = marginDiv = null; |
|
|
}); |
|
|
|
|
|
// Null elements to avoid leaks in IE |
|
|
all = select = fragment = opt = a = input = null; |
|
|
|
|
|
return support; |
|
|
})(); |
|
|
|
|
|
var rbrace = /(?:\{[\s\S]*\}|\[[\s\S]*\])$/, |
|
|
rmultiDash = /([A-Z])/g; |
|
|
|
|
|
function internalData( elem, name, data, pvt /* Internal Use Only */ ){ |
|
|
if ( !jQuery.acceptData( elem ) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var thisCache, ret, |
|
|
internalKey = jQuery.expando, |
|
|
getByName = typeof name === "string", |
|
|
|
|
|
// We have to handle DOM nodes and JS objects differently because IE6-7 |
|
|
// can't GC object references properly across the DOM-JS boundary |
|
|
isNode = elem.nodeType, |
|
|
|
|
|
// Only DOM nodes need the global jQuery cache; JS object data is |
|
|
// attached directly to the object so GC can occur automatically |
|
|
cache = isNode ? jQuery.cache : elem, |
|
|
|
|
|
// Only defining an ID for JS objects if its cache already exists allows |
|
|
// the code to shortcut on the same path as a DOM node with no cache |
|
|
id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey; |
|
|
|
|
|
// Avoid doing any more work than we need to when trying to get data on an |
|
|
// object that has no data at all |
|
|
if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && getByName && data === undefined ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
if ( !id ) { |
|
|
// Only DOM nodes need a new unique ID for each element since their data |
|
|
// ends up in the global cache |
|
|
if ( isNode ) { |
|
|
elem[ internalKey ] = id = core_deletedIds.pop() || jQuery.guid++; |
|
|
} else { |
|
|
id = internalKey; |
|
|
} |
|
|
} |
|
|
|
|
|
if ( !cache[ id ] ) { |
|
|
cache[ id ] = {}; |
|
|
|
|
|
// Avoids exposing jQuery metadata on plain JS objects when the object |
|
|
// is serialized using JSON.stringify |
|
|
if ( !isNode ) { |
|
|
cache[ id ].toJSON = jQuery.noop; |
|
|
} |
|
|
} |
|
|
|
|
|
// An object can be passed to jQuery.data instead of a key/value pair; this gets |
|
|
// shallow copied over onto the existing cache |
|
|
if ( typeof name === "object" || typeof name === "function" ) { |
|
|
if ( pvt ) { |
|
|
cache[ id ] = jQuery.extend( cache[ id ], name ); |
|
|
} else { |
|
|
cache[ id ].data = jQuery.extend( cache[ id ].data, name ); |
|
|
} |
|
|
} |
|
|
|
|
|
thisCache = cache[ id ]; |
|
|
|
|
|
// jQuery data() is stored in a separate object inside the object's internal data |
|
|
// cache in order to avoid key collisions between internal data and user-defined |
|
|
// data. |
|
|
if ( !pvt ) { |
|
|
if ( !thisCache.data ) { |
|
|
thisCache.data = {}; |
|
|
} |
|
|
|
|
|
thisCache = thisCache.data; |
|
|
} |
|
|
|
|
|
if ( data !== undefined ) { |
|
|
thisCache[ jQuery.camelCase( name ) ] = data; |
|
|
} |
|
|
|
|
|
// Check for both converted-to-camel and non-converted data property names |
|
|
// If a data property was specified |
|
|
if ( getByName ) { |
|
|
|
|
|
// First Try to find as-is property data |
|
|
ret = thisCache[ name ]; |
|
|
|
|
|
// Test for null|undefined property data |
|
|
if ( ret == null ) { |
|
|
|
|
|
// Try to find the camelCased property |
|
|
ret = thisCache[ jQuery.camelCase( name ) ]; |
|
|
} |
|
|
} else { |
|
|
ret = thisCache; |
|
|
} |
|
|
|
|
|
return ret; |
|
|
} |
|
|
|
|
|
function internalRemoveData( elem, name, pvt ) { |
|
|
if ( !jQuery.acceptData( elem ) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var i, l, thisCache, |
|
|
isNode = elem.nodeType, |
|
|
|
|
|
// See jQuery.data for more information |
|
|
cache = isNode ? jQuery.cache : elem, |
|
|
id = isNode ? elem[ jQuery.expando ] : jQuery.expando; |
|
|
|
|
|
// If there is already no cache entry for this object, there is no |
|
|
// purpose in continuing |
|
|
if ( !cache[ id ] ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
if ( name ) { |
|
|
|
|
|
thisCache = pvt ? cache[ id ] : cache[ id ].data; |
|
|
|
|
|
if ( thisCache ) { |
|
|
|
|
|
// Support array or space separated string names for data keys |
|
|
if ( !jQuery.isArray( name ) ) { |
|
|
|
|
|
// try the string as a key before any manipulation |
|
|
if ( name in thisCache ) { |
|
|
name = [ name ]; |
|
|
} else { |
|
|
|
|
|
// split the camel cased version by spaces unless a key with the spaces exists |
|
|
name = jQuery.camelCase( name ); |
|
|
if ( name in thisCache ) { |
|
|
name = [ name ]; |
|
|
} else { |
|
|
name = name.split(" "); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
// If "name" is an array of keys... |
|
|
// When data is initially created, via ("key", "val") signature, |
|
|
// keys will be converted to camelCase. |
|
|
// Since there is no way to tell _how_ a key was added, remove |
|
|
// both plain key and camelCase key. #12786 |
|
|
// This will only penalize the array argument path. |
|
|
name = name.concat( jQuery.map( name, jQuery.camelCase ) ); |
|
|
} |
|
|
|
|
|
for ( i = 0, l = name.length; i < l; i++ ) { |
|
|
delete thisCache[ name[i] ]; |
|
|
} |
|
|
|
|
|
// If there is no data left in the cache, we want to continue |
|
|
// and let the cache object itself get destroyed |
|
|
if ( !( pvt ? isEmptyDataObject : jQuery.isEmptyObject )( thisCache ) ) { |
|
|
return; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// See jQuery.data for more information |
|
|
if ( !pvt ) { |
|
|
delete cache[ id ].data; |
|
|
|
|
|
// Don't destroy the parent cache unless the internal data object |
|
|
// had been the only thing left in it |
|
|
if ( !isEmptyDataObject( cache[ id ] ) ) { |
|
|
return; |
|
|
} |
|
|
} |
|
|
|
|
|
// Destroy the cache |
|
|
if ( isNode ) { |
|
|
jQuery.cleanData( [ elem ], true ); |
|
|
|
|
|
// Use delete when supported for expandos or `cache` is not a window per isWindow (#10080) |
|
|
} else if ( jQuery.support.deleteExpando || cache != cache.window ) { |
|
|
delete cache[ id ]; |
|
|
|
|
|
// When all else fails, null |
|
|
} else { |
|
|
cache[ id ] = null; |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.extend({ |
|
|
cache: {}, |
|
|
|
|
|
// Unique for each copy of jQuery on the page |
|
|
// Non-digits removed to match rinlinejQuery |
|
|
expando: "jQuery" + ( core_version + Math.random() ).replace( /\D/g, "" ), |
|
|
|
|
|
// The following elements throw uncatchable exceptions if you |
|
|
// attempt to add expando properties to them. |
|
|
noData: { |
|
|
"embed": true, |
|
|
// Ban all objects except for Flash (which handle expandos) |
|
|
"object": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000", |
|
|
"applet": true |
|
|
}, |
|
|
|
|
|
hasData: function( elem ) { |
|
|
elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ]; |
|
|
return !!elem && !isEmptyDataObject( elem ); |
|
|
}, |
|
|
|
|
|
data: function( elem, name, data ) { |
|
|
return internalData( elem, name, data ); |
|
|
}, |
|
|
|
|
|
removeData: function( elem, name ) { |
|
|
return internalRemoveData( elem, name ); |
|
|
}, |
|
|
|
|
|
// For internal use only. |
|
|
_data: function( elem, name, data ) { |
|
|
return internalData( elem, name, data, true ); |
|
|
}, |
|
|
|
|
|
_removeData: function( elem, name ) { |
|
|
return internalRemoveData( elem, name, true ); |
|
|
}, |
|
|
|
|
|
// A method for determining if a DOM node can handle the data expando |
|
|
acceptData: function( elem ) { |
|
|
// Do not set data on non-element because it will not be cleared (#8335). |
|
|
if ( elem.nodeType && elem.nodeType !== 1 && elem.nodeType !== 9 ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
var noData = elem.nodeName && jQuery.noData[ elem.nodeName.toLowerCase() ]; |
|
|
|
|
|
// nodes accept data unless otherwise specified; rejection can be conditional |
|
|
return !noData || noData !== true && elem.getAttribute("classid") === noData; |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
data: function( key, value ) { |
|
|
var attrs, name, |
|
|
elem = this[0], |
|
|
i = 0, |
|
|
data = null; |
|
|
|
|
|
// Gets all values |
|
|
if ( key === undefined ) { |
|
|
if ( this.length ) { |
|
|
data = jQuery.data( elem ); |
|
|
|
|
|
if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) { |
|
|
attrs = elem.attributes; |
|
|
for ( ; i < attrs.length; i++ ) { |
|
|
name = attrs[i].name; |
|
|
|
|
|
if ( !name.indexOf( "data-" ) ) { |
|
|
name = jQuery.camelCase( name.slice(5) ); |
|
|
|
|
|
dataAttr( elem, name, data[ name ] ); |
|
|
} |
|
|
} |
|
|
jQuery._data( elem, "parsedAttrs", true ); |
|
|
} |
|
|
} |
|
|
|
|
|
return data; |
|
|
} |
|
|
|
|
|
// Sets multiple values |
|
|
if ( typeof key === "object" ) { |
|
|
return this.each(function() { |
|
|
jQuery.data( this, key ); |
|
|
}); |
|
|
} |
|
|
|
|
|
return jQuery.access( this, function( value ) { |
|
|
|
|
|
if ( value === undefined ) { |
|
|
// Try to fetch any internally stored data first |
|
|
return elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : null; |
|
|
} |
|
|
|
|
|
this.each(function() { |
|
|
jQuery.data( this, key, value ); |
|
|
}); |
|
|
}, null, value, arguments.length > 1, null, true ); |
|
|
}, |
|
|
|
|
|
removeData: function( key ) { |
|
|
return this.each(function() { |
|
|
jQuery.removeData( this, key ); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
function dataAttr( elem, key, data ) { |
|
|
// If nothing was found internally, try to fetch any |
|
|
// data from the HTML5 data-* attribute |
|
|
if ( data === undefined && elem.nodeType === 1 ) { |
|
|
|
|
|
var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase(); |
|
|
|
|
|
data = elem.getAttribute( name ); |
|
|
|
|
|
if ( typeof data === "string" ) { |
|
|
try { |
|
|
data = data === "true" ? true : |
|
|
data === "false" ? false : |
|
|
data === "null" ? null : |
|
|
// Only convert to a number if it doesn't change the string |
|
|
+data + "" === data ? +data : |
|
|
rbrace.test( data ) ? jQuery.parseJSON( data ) : |
|
|
data; |
|
|
} catch( e ) {} |
|
|
|
|
|
// Make sure we set the data so it isn't changed later |
|
|
jQuery.data( elem, key, data ); |
|
|
|
|
|
} else { |
|
|
data = undefined; |
|
|
} |
|
|
} |
|
|
|
|
|
return data; |
|
|
} |
|
|
|
|
|
// checks a cache object for emptiness |
|
|
function isEmptyDataObject( obj ) { |
|
|
var name; |
|
|
for ( name in obj ) { |
|
|
|
|
|
// if the public data object is empty, the private is still empty |
|
|
if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) { |
|
|
continue; |
|
|
} |
|
|
if ( name !== "toJSON" ) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
|
|
|
return true; |
|
|
} |
|
|
jQuery.extend({ |
|
|
queue: function( elem, type, data ) { |
|
|
var queue; |
|
|
|
|
|
if ( elem ) { |
|
|
type = ( type || "fx" ) + "queue"; |
|
|
queue = jQuery._data( elem, type ); |
|
|
|
|
|
// Speed up dequeue by getting out quickly if this is just a lookup |
|
|
if ( data ) { |
|
|
if ( !queue || jQuery.isArray(data) ) { |
|
|
queue = jQuery._data( elem, type, jQuery.makeArray(data) ); |
|
|
} else { |
|
|
queue.push( data ); |
|
|
} |
|
|
} |
|
|
return queue || []; |
|
|
} |
|
|
}, |
|
|
|
|
|
dequeue: function( elem, type ) { |
|
|
type = type || "fx"; |
|
|
|
|
|
var queue = jQuery.queue( elem, type ), |
|
|
startLength = queue.length, |
|
|
fn = queue.shift(), |
|
|
hooks = jQuery._queueHooks( elem, type ), |
|
|
next = function() { |
|
|
jQuery.dequeue( elem, type ); |
|
|
}; |
|
|
|
|
|
// If the fx queue is dequeued, always remove the progress sentinel |
|
|
if ( fn === "inprogress" ) { |
|
|
fn = queue.shift(); |
|
|
startLength--; |
|
|
} |
|
|
|
|
|
hooks.cur = fn; |
|
|
if ( fn ) { |
|
|
|
|
|
// Add a progress sentinel to prevent the fx queue from being |
|
|
// automatically dequeued |
|
|
if ( type === "fx" ) { |
|
|
queue.unshift( "inprogress" ); |
|
|
} |
|
|
|
|
|
// clear up the last queue stop function |
|
|
delete hooks.stop; |
|
|
fn.call( elem, next, hooks ); |
|
|
} |
|
|
|
|
|
if ( !startLength && hooks ) { |
|
|
hooks.empty.fire(); |
|
|
} |
|
|
}, |
|
|
|
|
|
// not intended for public consumption - generates a queueHooks object, or returns the current one |
|
|
_queueHooks: function( elem, type ) { |
|
|
var key = type + "queueHooks"; |
|
|
return jQuery._data( elem, key ) || jQuery._data( elem, key, { |
|
|
empty: jQuery.Callbacks("once memory").add(function() { |
|
|
jQuery._removeData( elem, type + "queue" ); |
|
|
jQuery._removeData( elem, key ); |
|
|
}) |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
queue: function( type, data ) { |
|
|
var setter = 2; |
|
|
|
|
|
if ( typeof type !== "string" ) { |
|
|
data = type; |
|
|
type = "fx"; |
|
|
setter--; |
|
|
} |
|
|
|
|
|
if ( arguments.length < setter ) { |
|
|
return jQuery.queue( this[0], type ); |
|
|
} |
|
|
|
|
|
return data === undefined ? |
|
|
this : |
|
|
this.each(function() { |
|
|
var queue = jQuery.queue( this, type, data ); |
|
|
|
|
|
// ensure a hooks for this queue |
|
|
jQuery._queueHooks( this, type ); |
|
|
|
|
|
if ( type === "fx" && queue[0] !== "inprogress" ) { |
|
|
jQuery.dequeue( this, type ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
dequeue: function( type ) { |
|
|
return this.each(function() { |
|
|
jQuery.dequeue( this, type ); |
|
|
}); |
|
|
}, |
|
|
// Based off of the plugin by Clint Helfers, with permission. |
|
|
// http://blindsignals.com/index.php/2009/07/jquery-delay/ |
|
|
delay: function( time, type ) { |
|
|
time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time; |
|
|
type = type || "fx"; |
|
|
|
|
|
return this.queue( type, function( next, hooks ) { |
|
|
var timeout = setTimeout( next, time ); |
|
|
hooks.stop = function() { |
|
|
clearTimeout( timeout ); |
|
|
}; |
|
|
}); |
|
|
}, |
|
|
clearQueue: function( type ) { |
|
|
return this.queue( type || "fx", [] ); |
|
|
}, |
|
|
// Get a promise resolved when queues of a certain type |
|
|
// are emptied (fx is the type by default) |
|
|
promise: function( type, obj ) { |
|
|
var tmp, |
|
|
count = 1, |
|
|
defer = jQuery.Deferred(), |
|
|
elements = this, |
|
|
i = this.length, |
|
|
resolve = function() { |
|
|
if ( !( --count ) ) { |
|
|
defer.resolveWith( elements, [ elements ] ); |
|
|
} |
|
|
}; |
|
|
|
|
|
if ( typeof type !== "string" ) { |
|
|
obj = type; |
|
|
type = undefined; |
|
|
} |
|
|
type = type || "fx"; |
|
|
|
|
|
while( i-- ) { |
|
|
tmp = jQuery._data( elements[ i ], type + "queueHooks" ); |
|
|
if ( tmp && tmp.empty ) { |
|
|
count++; |
|
|
tmp.empty.add( resolve ); |
|
|
} |
|
|
} |
|
|
resolve(); |
|
|
return defer.promise( obj ); |
|
|
} |
|
|
}); |
|
|
var nodeHook, boolHook, |
|
|
rclass = /[\t\r\n]/g, |
|
|
rreturn = /\r/g, |
|
|
rfocusable = /^(?:input|select|textarea|button|object)$/i, |
|
|
rclickable = /^(?:a|area)$/i, |
|
|
rboolean = /^(?:checked|selected|autofocus|autoplay|async|controls|defer|disabled|hidden|loop|multiple|open|readonly|required|scoped)$/i, |
|
|
ruseDefault = /^(?:checked|selected)$/i, |
|
|
getSetAttribute = jQuery.support.getSetAttribute, |
|
|
getSetInput = jQuery.support.input; |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
attr: function( name, value ) { |
|
|
return jQuery.access( this, jQuery.attr, name, value, arguments.length > 1 ); |
|
|
}, |
|
|
|
|
|
removeAttr: function( name ) { |
|
|
return this.each(function() { |
|
|
jQuery.removeAttr( this, name ); |
|
|
}); |
|
|
}, |
|
|
|
|
|
prop: function( name, value ) { |
|
|
return jQuery.access( this, jQuery.prop, name, value, arguments.length > 1 ); |
|
|
}, |
|
|
|
|
|
removeProp: function( name ) { |
|
|
name = jQuery.propFix[ name ] || name; |
|
|
return this.each(function() { |
|
|
// try/catch handles cases where IE balks (such as removing a property on window) |
|
|
try { |
|
|
this[ name ] = undefined; |
|
|
delete this[ name ]; |
|
|
} catch( e ) {} |
|
|
}); |
|
|
}, |
|
|
|
|
|
addClass: function( value ) { |
|
|
var classes, elem, cur, clazz, j, |
|
|
i = 0, |
|
|
len = this.length, |
|
|
proceed = typeof value === "string" && value; |
|
|
|
|
|
if ( jQuery.isFunction( value ) ) { |
|
|
return this.each(function( j ) { |
|
|
jQuery( this ).addClass( value.call( this, j, this.className ) ); |
|
|
}); |
|
|
} |
|
|
|
|
|
if ( proceed ) { |
|
|
// The disjunction here is for better compressibility (see removeClass) |
|
|
classes = ( value || "" ).match( core_rnotwhite ) || []; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
elem = this[ i ]; |
|
|
cur = elem.nodeType === 1 && ( elem.className ? |
|
|
( " " + elem.className + " " ).replace( rclass, " " ) : |
|
|
" " |
|
|
); |
|
|
|
|
|
if ( cur ) { |
|
|
j = 0; |
|
|
while ( (clazz = classes[j++]) ) { |
|
|
if ( cur.indexOf( " " + clazz + " " ) < 0 ) { |
|
|
cur += clazz + " "; |
|
|
} |
|
|
} |
|
|
elem.className = jQuery.trim( cur ); |
|
|
|
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
removeClass: function( value ) { |
|
|
var classes, elem, cur, clazz, j, |
|
|
i = 0, |
|
|
len = this.length, |
|
|
proceed = arguments.length === 0 || typeof value === "string" && value; |
|
|
|
|
|
if ( jQuery.isFunction( value ) ) { |
|
|
return this.each(function( j ) { |
|
|
jQuery( this ).removeClass( value.call( this, j, this.className ) ); |
|
|
}); |
|
|
} |
|
|
if ( proceed ) { |
|
|
classes = ( value || "" ).match( core_rnotwhite ) || []; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
elem = this[ i ]; |
|
|
// This expression is here for better compressibility (see addClass) |
|
|
cur = elem.nodeType === 1 && ( elem.className ? |
|
|
( " " + elem.className + " " ).replace( rclass, " " ) : |
|
|
"" |
|
|
); |
|
|
|
|
|
if ( cur ) { |
|
|
j = 0; |
|
|
while ( (clazz = classes[j++]) ) { |
|
|
// Remove *all* instances |
|
|
while ( cur.indexOf( " " + clazz + " " ) >= 0 ) { |
|
|
cur = cur.replace( " " + clazz + " ", " " ); |
|
|
} |
|
|
} |
|
|
elem.className = value ? jQuery.trim( cur ) : ""; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
toggleClass: function( value, stateVal ) { |
|
|
var type = typeof value, |
|
|
isBool = typeof stateVal === "boolean"; |
|
|
|
|
|
if ( jQuery.isFunction( value ) ) { |
|
|
return this.each(function( i ) { |
|
|
jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal ); |
|
|
}); |
|
|
} |
|
|
|
|
|
return this.each(function() { |
|
|
if ( type === "string" ) { |
|
|
// toggle individual class names |
|
|
var className, |
|
|
i = 0, |
|
|
self = jQuery( this ), |
|
|
state = stateVal, |
|
|
classNames = value.match( core_rnotwhite ) || []; |
|
|
|
|
|
while ( (className = classNames[ i++ ]) ) { |
|
|
// check each className given, space separated list |
|
|
state = isBool ? state : !self.hasClass( className ); |
|
|
self[ state ? "addClass" : "removeClass" ]( className ); |
|
|
} |
|
|
|
|
|
// Toggle whole class name |
|
|
} else if ( type === core_strundefined || type === "boolean" ) { |
|
|
if ( this.className ) { |
|
|
// store className if set |
|
|
jQuery._data( this, "__className__", this.className ); |
|
|
} |
|
|
|
|
|
// If the element has a class name or if we're passed "false", |
|
|
// then remove the whole classname (if there was one, the above saved it). |
|
|
// Otherwise bring back whatever was previously saved (if anything), |
|
|
// falling back to the empty string if nothing was stored. |
|
|
this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || ""; |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
hasClass: function( selector ) { |
|
|
var className = " " + selector + " ", |
|
|
i = 0, |
|
|
l = this.length; |
|
|
for ( ; i < l; i++ ) { |
|
|
if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
|
|
|
return false; |
|
|
}, |
|
|
|
|
|
val: function( value ) { |
|
|
var ret, hooks, isFunction, |
|
|
elem = this[0]; |
|
|
|
|
|
if ( !arguments.length ) { |
|
|
if ( elem ) { |
|
|
hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ]; |
|
|
|
|
|
if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) { |
|
|
return ret; |
|
|
} |
|
|
|
|
|
ret = elem.value; |
|
|
|
|
|
return typeof ret === "string" ? |
|
|
// handle most common string cases |
|
|
ret.replace(rreturn, "") : |
|
|
// handle cases where value is null/undef or number |
|
|
ret == null ? "" : ret; |
|
|
} |
|
|
|
|
|
return; |
|
|
} |
|
|
|
|
|
isFunction = jQuery.isFunction( value ); |
|
|
|
|
|
return this.each(function( i ) { |
|
|
var val, |
|
|
self = jQuery(this); |
|
|
|
|
|
if ( this.nodeType !== 1 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
if ( isFunction ) { |
|
|
val = value.call( this, i, self.val() ); |
|
|
} else { |
|
|
val = value; |
|
|
} |
|
|
|
|
|
// Treat null/undefined as ""; convert numbers to string |
|
|
if ( val == null ) { |
|
|
val = ""; |
|
|
} else if ( typeof val === "number" ) { |
|
|
val += ""; |
|
|
} else if ( jQuery.isArray( val ) ) { |
|
|
val = jQuery.map(val, function ( value ) { |
|
|
return value == null ? "" : value + ""; |
|
|
}); |
|
|
} |
|
|
|
|
|
hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ]; |
|
|
|
|
|
// If set returns undefined, fall back to normal setting |
|
|
if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) { |
|
|
this.value = val; |
|
|
} |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.extend({ |
|
|
valHooks: { |
|
|
option: { |
|
|
get: function( elem ) { |
|
|
// attributes.value is undefined in Blackberry 4.7 but |
|
|
// uses .value. See #6932 |
|
|
var val = elem.attributes.value; |
|
|
return !val || val.specified ? elem.value : elem.text; |
|
|
} |
|
|
}, |
|
|
select: { |
|
|
get: function( elem ) { |
|
|
var value, option, |
|
|
options = elem.options, |
|
|
index = elem.selectedIndex, |
|
|
one = elem.type === "select-one" || index < 0, |
|
|
values = one ? null : [], |
|
|
max = one ? index + 1 : options.length, |
|
|
i = index < 0 ? |
|
|
max : |
|
|
one ? index : 0; |
|
|
|
|
|
// Loop through all the selected options |
|
|
for ( ; i < max; i++ ) { |
|
|
option = options[ i ]; |
|
|
|
|
|
// oldIE doesn't update selected after form reset (#2551) |
|
|
if ( ( option.selected || i === index ) && |
|
|
// Don't return options that are disabled or in a disabled optgroup |
|
|
( jQuery.support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) && |
|
|
( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) { |
|
|
|
|
|
// Get the specific value for the option |
|
|
value = jQuery( option ).val(); |
|
|
|
|
|
// We don't need an array for one selects |
|
|
if ( one ) { |
|
|
return value; |
|
|
} |
|
|
|
|
|
// Multi-Selects return an array |
|
|
values.push( value ); |
|
|
} |
|
|
} |
|
|
|
|
|
return values; |
|
|
}, |
|
|
|
|
|
set: function( elem, value ) { |
|
|
var values = jQuery.makeArray( value ); |
|
|
|
|
|
jQuery(elem).find("option").each(function() { |
|
|
this.selected = jQuery.inArray( jQuery(this).val(), values ) >= 0; |
|
|
}); |
|
|
|
|
|
if ( !values.length ) { |
|
|
elem.selectedIndex = -1; |
|
|
} |
|
|
return values; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
attr: function( elem, name, value ) { |
|
|
var hooks, notxml, ret, |
|
|
nType = elem.nodeType; |
|
|
|
|
|
// don't get/set attributes on text, comment and attribute nodes |
|
|
if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Fallback to prop when attributes are not supported |
|
|
if ( typeof elem.getAttribute === core_strundefined ) { |
|
|
return jQuery.prop( elem, name, value ); |
|
|
} |
|
|
|
|
|
notxml = nType !== 1 || !jQuery.isXMLDoc( elem ); |
|
|
|
|
|
// All attributes are lowercase |
|
|
// Grab necessary hook if one is defined |
|
|
if ( notxml ) { |
|
|
name = name.toLowerCase(); |
|
|
hooks = jQuery.attrHooks[ name ] || ( rboolean.test( name ) ? boolHook : nodeHook ); |
|
|
} |
|
|
|
|
|
if ( value !== undefined ) { |
|
|
|
|
|
if ( value === null ) { |
|
|
jQuery.removeAttr( elem, name ); |
|
|
|
|
|
} else if ( hooks && notxml && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) { |
|
|
return ret; |
|
|
|
|
|
} else { |
|
|
elem.setAttribute( name, value + "" ); |
|
|
return value; |
|
|
} |
|
|
|
|
|
} else if ( hooks && notxml && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) { |
|
|
return ret; |
|
|
|
|
|
} else { |
|
|
|
|
|
// In IE9+, Flash objects don't have .getAttribute (#12945) |
|
|
// Support: IE9+ |
|
|
if ( typeof elem.getAttribute !== core_strundefined ) { |
|
|
ret = elem.getAttribute( name ); |
|
|
} |
|
|
|
|
|
// Non-existent attributes return null, we normalize to undefined |
|
|
return ret == null ? |
|
|
undefined : |
|
|
ret; |
|
|
} |
|
|
}, |
|
|
|
|
|
removeAttr: function( elem, value ) { |
|
|
var name, propName, |
|
|
i = 0, |
|
|
attrNames = value && value.match( core_rnotwhite ); |
|
|
|
|
|
if ( attrNames && elem.nodeType === 1 ) { |
|
|
while ( (name = attrNames[i++]) ) { |
|
|
propName = jQuery.propFix[ name ] || name; |
|
|
|
|
|
// Boolean attributes get special treatment (#10870) |
|
|
if ( rboolean.test( name ) ) { |
|
|
// Set corresponding property to false for boolean attributes |
|
|
// Also clear defaultChecked/defaultSelected (if appropriate) for IE<8 |
|
|
if ( !getSetAttribute && ruseDefault.test( name ) ) { |
|
|
elem[ jQuery.camelCase( "default-" + name ) ] = |
|
|
elem[ propName ] = false; |
|
|
} else { |
|
|
elem[ propName ] = false; |
|
|
} |
|
|
|
|
|
// See #9699 for explanation of this approach (setting first, then removal) |
|
|
} else { |
|
|
jQuery.attr( elem, name, "" ); |
|
|
} |
|
|
|
|
|
elem.removeAttribute( getSetAttribute ? name : propName ); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
attrHooks: { |
|
|
type: { |
|
|
set: function( elem, value ) { |
|
|
if ( !jQuery.support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) { |
|
|
// Setting the type on a radio button after the value resets the value in IE6-9 |
|
|
// Reset value to default in case type is set after value during creation |
|
|
var val = elem.value; |
|
|
elem.setAttribute( "type", value ); |
|
|
if ( val ) { |
|
|
elem.value = val; |
|
|
} |
|
|
return value; |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
propFix: { |
|
|
tabindex: "tabIndex", |
|
|
readonly: "readOnly", |
|
|
"for": "htmlFor", |
|
|
"class": "className", |
|
|
maxlength: "maxLength", |
|
|
cellspacing: "cellSpacing", |
|
|
cellpadding: "cellPadding", |
|
|
rowspan: "rowSpan", |
|
|
colspan: "colSpan", |
|
|
usemap: "useMap", |
|
|
frameborder: "frameBorder", |
|
|
contenteditable: "contentEditable" |
|
|
}, |
|
|
|
|
|
prop: function( elem, name, value ) { |
|
|
var ret, hooks, notxml, |
|
|
nType = elem.nodeType; |
|
|
|
|
|
// don't get/set properties on text, comment and attribute nodes |
|
|
if ( !elem || nType === 3 || nType === 8 || nType === 2 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
notxml = nType !== 1 || !jQuery.isXMLDoc( elem ); |
|
|
|
|
|
if ( notxml ) { |
|
|
// Fix name and attach hooks |
|
|
name = jQuery.propFix[ name ] || name; |
|
|
hooks = jQuery.propHooks[ name ]; |
|
|
} |
|
|
|
|
|
if ( value !== undefined ) { |
|
|
if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) { |
|
|
return ret; |
|
|
|
|
|
} else { |
|
|
return ( elem[ name ] = value ); |
|
|
} |
|
|
|
|
|
} else { |
|
|
if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) { |
|
|
return ret; |
|
|
|
|
|
} else { |
|
|
return elem[ name ]; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
propHooks: { |
|
|
tabIndex: { |
|
|
get: function( elem ) { |
|
|
// elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set |
|
|
// http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/ |
|
|
var attributeNode = elem.getAttributeNode("tabindex"); |
|
|
|
|
|
return attributeNode && attributeNode.specified ? |
|
|
parseInt( attributeNode.value, 10 ) : |
|
|
rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ? |
|
|
0 : |
|
|
undefined; |
|
|
} |
|
|
} |
|
|
} |
|
|
}); |
|
|
|
|
|
// Hook for boolean attributes |
|
|
boolHook = { |
|
|
get: function( elem, name ) { |
|
|
var |
|
|
// Use .prop to determine if this attribute is understood as boolean |
|
|
prop = jQuery.prop( elem, name ), |
|
|
|
|
|
// Fetch it accordingly |
|
|
attr = typeof prop === "boolean" && elem.getAttribute( name ), |
|
|
detail = typeof prop === "boolean" ? |
|
|
|
|
|
getSetInput && getSetAttribute ? |
|
|
attr != null : |
|
|
// oldIE fabricates an empty string for missing boolean attributes |
|
|
// and conflates checked/selected into attroperties |
|
|
ruseDefault.test( name ) ? |
|
|
elem[ jQuery.camelCase( "default-" + name ) ] : |
|
|
!!attr : |
|
|
|
|
|
// fetch an attribute node for properties not recognized as boolean |
|
|
elem.getAttributeNode( name ); |
|
|
|
|
|
return detail && detail.value !== false ? |
|
|
name.toLowerCase() : |
|
|
undefined; |
|
|
}, |
|
|
set: function( elem, value, name ) { |
|
|
if ( value === false ) { |
|
|
// Remove boolean attributes when set to false |
|
|
jQuery.removeAttr( elem, name ); |
|
|
} else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) { |
|
|
// IE<8 needs the *property* name |
|
|
elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name ); |
|
|
|
|
|
// Use defaultChecked and defaultSelected for oldIE |
|
|
} else { |
|
|
elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true; |
|
|
} |
|
|
|
|
|
return name; |
|
|
} |
|
|
}; |
|
|
|
|
|
// fix oldIE value attroperty |
|
|
if ( !getSetInput || !getSetAttribute ) { |
|
|
jQuery.attrHooks.value = { |
|
|
get: function( elem, name ) { |
|
|
var ret = elem.getAttributeNode( name ); |
|
|
return jQuery.nodeName( elem, "input" ) ? |
|
|
|
|
|
// Ignore the value *property* by using defaultValue |
|
|
elem.defaultValue : |
|
|
|
|
|
ret && ret.specified ? ret.value : undefined; |
|
|
}, |
|
|
set: function( elem, value, name ) { |
|
|
if ( jQuery.nodeName( elem, "input" ) ) { |
|
|
// Does not return so that setAttribute is also used |
|
|
elem.defaultValue = value; |
|
|
} else { |
|
|
// Use nodeHook if defined (#1954); otherwise setAttribute is fine |
|
|
return nodeHook && nodeHook.set( elem, value, name ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// IE6/7 do not support getting/setting some attributes with get/setAttribute |
|
|
if ( !getSetAttribute ) { |
|
|
|
|
|
// Use this for any attribute in IE6/7 |
|
|
// This fixes almost every IE6/7 issue |
|
|
nodeHook = jQuery.valHooks.button = { |
|
|
get: function( elem, name ) { |
|
|
var ret = elem.getAttributeNode( name ); |
|
|
return ret && ( name === "id" || name === "name" || name === "coords" ? ret.value !== "" : ret.specified ) ? |
|
|
ret.value : |
|
|
undefined; |
|
|
}, |
|
|
set: function( elem, value, name ) { |
|
|
// Set the existing or create a new attribute node |
|
|
var ret = elem.getAttributeNode( name ); |
|
|
if ( !ret ) { |
|
|
elem.setAttributeNode( |
|
|
(ret = elem.ownerDocument.createAttribute( name )) |
|
|
); |
|
|
} |
|
|
|
|
|
ret.value = value += ""; |
|
|
|
|
|
// Break association with cloned elements by also using setAttribute (#9646) |
|
|
return name === "value" || value === elem.getAttribute( name ) ? |
|
|
value : |
|
|
undefined; |
|
|
} |
|
|
}; |
|
|
|
|
|
// Set contenteditable to false on removals(#10429) |
|
|
// Setting to empty string throws an error as an invalid value |
|
|
jQuery.attrHooks.contenteditable = { |
|
|
get: nodeHook.get, |
|
|
set: function( elem, value, name ) { |
|
|
nodeHook.set( elem, value === "" ? false : value, name ); |
|
|
} |
|
|
}; |
|
|
|
|
|
// Set width and height to auto instead of 0 on empty string( Bug #8150 ) |
|
|
// This is for removals |
|
|
jQuery.each([ "width", "height" ], function( i, name ) { |
|
|
jQuery.attrHooks[ name ] = jQuery.extend( jQuery.attrHooks[ name ], { |
|
|
set: function( elem, value ) { |
|
|
if ( value === "" ) { |
|
|
elem.setAttribute( name, "auto" ); |
|
|
return value; |
|
|
} |
|
|
} |
|
|
}); |
|
|
}); |
|
|
} |
|
|
|
|
|
|
|
|
// Some attributes require a special call on IE |
|
|
// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx |
|
|
if ( !jQuery.support.hrefNormalized ) { |
|
|
jQuery.each([ "href", "src", "width", "height" ], function( i, name ) { |
|
|
jQuery.attrHooks[ name ] = jQuery.extend( jQuery.attrHooks[ name ], { |
|
|
get: function( elem ) { |
|
|
var ret = elem.getAttribute( name, 2 ); |
|
|
return ret == null ? undefined : ret; |
|
|
} |
|
|
}); |
|
|
}); |
|
|
|
|
|
// href/src property should get the full normalized URL (#10299/#12915) |
|
|
jQuery.each([ "href", "src" ], function( i, name ) { |
|
|
jQuery.propHooks[ name ] = { |
|
|
get: function( elem ) { |
|
|
return elem.getAttribute( name, 4 ); |
|
|
} |
|
|
}; |
|
|
}); |
|
|
} |
|
|
|
|
|
if ( !jQuery.support.style ) { |
|
|
jQuery.attrHooks.style = { |
|
|
get: function( elem ) { |
|
|
// Return undefined in the case of empty string |
|
|
// Note: IE uppercases css property names, but if we were to .toLowerCase() |
|
|
// .cssText, that would destroy case senstitivity in URL's, like in "background" |
|
|
return elem.style.cssText || undefined; |
|
|
}, |
|
|
set: function( elem, value ) { |
|
|
return ( elem.style.cssText = value + "" ); |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// Safari mis-reports the default selected property of an option |
|
|
// Accessing the parent's selectedIndex property fixes it |
|
|
if ( !jQuery.support.optSelected ) { |
|
|
jQuery.propHooks.selected = jQuery.extend( jQuery.propHooks.selected, { |
|
|
get: function( elem ) { |
|
|
var parent = elem.parentNode; |
|
|
|
|
|
if ( parent ) { |
|
|
parent.selectedIndex; |
|
|
|
|
|
// Make sure that it also works with optgroups, see #5701 |
|
|
if ( parent.parentNode ) { |
|
|
parent.parentNode.selectedIndex; |
|
|
} |
|
|
} |
|
|
return null; |
|
|
} |
|
|
}); |
|
|
} |
|
|
|
|
|
// IE6/7 call enctype encoding |
|
|
if ( !jQuery.support.enctype ) { |
|
|
jQuery.propFix.enctype = "encoding"; |
|
|
} |
|
|
|
|
|
// Radios and checkboxes getter/setter |
|
|
if ( !jQuery.support.checkOn ) { |
|
|
jQuery.each([ "radio", "checkbox" ], function() { |
|
|
jQuery.valHooks[ this ] = { |
|
|
get: function( elem ) { |
|
|
// Handle the case where in Webkit "" is returned instead of "on" if a value isn't specified |
|
|
return elem.getAttribute("value") === null ? "on" : elem.value; |
|
|
} |
|
|
}; |
|
|
}); |
|
|
} |
|
|
jQuery.each([ "radio", "checkbox" ], function() { |
|
|
jQuery.valHooks[ this ] = jQuery.extend( jQuery.valHooks[ this ], { |
|
|
set: function( elem, value ) { |
|
|
if ( jQuery.isArray( value ) ) { |
|
|
return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 ); |
|
|
} |
|
|
} |
|
|
}); |
|
|
}); |
|
|
var rformElems = /^(?:input|select|textarea)$/i, |
|
|
rkeyEvent = /^key/, |
|
|
rmouseEvent = /^(?:mouse|contextmenu)|click/, |
|
|
rfocusMorph = /^(?:focusinfocus|focusoutblur)$/, |
|
|
rtypenamespace = /^([^.]*)(?:\.(.+)|)$/; |
|
|
|
|
|
function returnTrue() { |
|
|
return true; |
|
|
} |
|
|
|
|
|
function returnFalse() { |
|
|
return false; |
|
|
} |
|
|
|
|
|
/* |
|
|
* Helper functions for managing events -- not part of the public interface. |
|
|
* Props to Dean Edwards' addEvent library for many of the ideas. |
|
|
*/ |
|
|
jQuery.event = { |
|
|
|
|
|
global: {}, |
|
|
|
|
|
add: function( elem, types, handler, data, selector ) { |
|
|
var tmp, events, t, handleObjIn, |
|
|
special, eventHandle, handleObj, |
|
|
handlers, type, namespaces, origType, |
|
|
elemData = jQuery._data( elem ); |
|
|
|
|
|
// Don't attach events to noData or text/comment nodes (but allow plain objects) |
|
|
if ( !elemData ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Caller can pass in an object of custom data in lieu of the handler |
|
|
if ( handler.handler ) { |
|
|
handleObjIn = handler; |
|
|
handler = handleObjIn.handler; |
|
|
selector = handleObjIn.selector; |
|
|
} |
|
|
|
|
|
// Make sure that the handler has a unique ID, used to find/remove it later |
|
|
if ( !handler.guid ) { |
|
|
handler.guid = jQuery.guid++; |
|
|
} |
|
|
|
|
|
// Init the element's event structure and main handler, if this is the first |
|
|
if ( !(events = elemData.events) ) { |
|
|
events = elemData.events = {}; |
|
|
} |
|
|
if ( !(eventHandle = elemData.handle) ) { |
|
|
eventHandle = elemData.handle = function( e ) { |
|
|
// Discard the second event of a jQuery.event.trigger() and |
|
|
// when an event is called after a page has unloaded |
|
|
return typeof jQuery !== core_strundefined && (!e || jQuery.event.triggered !== e.type) ? |
|
|
jQuery.event.dispatch.apply( eventHandle.elem, arguments ) : |
|
|
undefined; |
|
|
}; |
|
|
// Add elem as a property of the handle fn to prevent a memory leak with IE non-native events |
|
|
eventHandle.elem = elem; |
|
|
} |
|
|
|
|
|
// Handle multiple events separated by a space |
|
|
// jQuery(...).bind("mouseover mouseout", fn); |
|
|
types = ( types || "" ).match( core_rnotwhite ) || [""]; |
|
|
t = types.length; |
|
|
while ( t-- ) { |
|
|
tmp = rtypenamespace.exec( types[t] ) || []; |
|
|
type = origType = tmp[1]; |
|
|
namespaces = ( tmp[2] || "" ).split( "." ).sort(); |
|
|
|
|
|
// If event changes its type, use the special event handlers for the changed type |
|
|
special = jQuery.event.special[ type ] || {}; |
|
|
|
|
|
// If selector defined, determine special event api type, otherwise given type |
|
|
type = ( selector ? special.delegateType : special.bindType ) || type; |
|
|
|
|
|
// Update special based on newly reset type |
|
|
special = jQuery.event.special[ type ] || {}; |
|
|
|
|
|
// handleObj is passed to all event handlers |
|
|
handleObj = jQuery.extend({ |
|
|
type: type, |
|
|
origType: origType, |
|
|
data: data, |
|
|
handler: handler, |
|
|
guid: handler.guid, |
|
|
selector: selector, |
|
|
needsContext: selector && jQuery.expr.match.needsContext.test( selector ), |
|
|
namespace: namespaces.join(".") |
|
|
}, handleObjIn ); |
|
|
|
|
|
// Init the event handler queue if we're the first |
|
|
if ( !(handlers = events[ type ]) ) { |
|
|
handlers = events[ type ] = []; |
|
|
handlers.delegateCount = 0; |
|
|
|
|
|
// Only use addEventListener/attachEvent if the special events handler returns false |
|
|
if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) { |
|
|
// Bind the global event handler to the element |
|
|
if ( elem.addEventListener ) { |
|
|
elem.addEventListener( type, eventHandle, false ); |
|
|
|
|
|
} else if ( elem.attachEvent ) { |
|
|
elem.attachEvent( "on" + type, eventHandle ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
if ( special.add ) { |
|
|
special.add.call( elem, handleObj ); |
|
|
|
|
|
if ( !handleObj.handler.guid ) { |
|
|
handleObj.handler.guid = handler.guid; |
|
|
} |
|
|
} |
|
|
|
|
|
// Add to the element's handler list, delegates in front |
|
|
if ( selector ) { |
|
|
handlers.splice( handlers.delegateCount++, 0, handleObj ); |
|
|
} else { |
|
|
handlers.push( handleObj ); |
|
|
} |
|
|
|
|
|
// Keep track of which events have ever been used, for event optimization |
|
|
jQuery.event.global[ type ] = true; |
|
|
} |
|
|
|
|
|
// Nullify elem to prevent memory leaks in IE |
|
|
elem = null; |
|
|
}, |
|
|
|
|
|
// Detach an event or set of events from an element |
|
|
remove: function( elem, types, handler, selector, mappedTypes ) { |
|
|
var j, handleObj, tmp, |
|
|
origCount, t, events, |
|
|
special, handlers, type, |
|
|
namespaces, origType, |
|
|
elemData = jQuery.hasData( elem ) && jQuery._data( elem ); |
|
|
|
|
|
if ( !elemData || !(events = elemData.events) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Once for each type.namespace in types; type may be omitted |
|
|
types = ( types || "" ).match( core_rnotwhite ) || [""]; |
|
|
t = types.length; |
|
|
while ( t-- ) { |
|
|
tmp = rtypenamespace.exec( types[t] ) || []; |
|
|
type = origType = tmp[1]; |
|
|
namespaces = ( tmp[2] || "" ).split( "." ).sort(); |
|
|
|
|
|
// Unbind all events (on this namespace, if provided) for the element |
|
|
if ( !type ) { |
|
|
for ( type in events ) { |
|
|
jQuery.event.remove( elem, type + types[ t ], handler, selector, true ); |
|
|
} |
|
|
continue; |
|
|
} |
|
|
|
|
|
special = jQuery.event.special[ type ] || {}; |
|
|
type = ( selector ? special.delegateType : special.bindType ) || type; |
|
|
handlers = events[ type ] || []; |
|
|
tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ); |
|
|
|
|
|
// Remove matching events |
|
|
origCount = j = handlers.length; |
|
|
while ( j-- ) { |
|
|
handleObj = handlers[ j ]; |
|
|
|
|
|
if ( ( mappedTypes || origType === handleObj.origType ) && |
|
|
( !handler || handler.guid === handleObj.guid ) && |
|
|
( !tmp || tmp.test( handleObj.namespace ) ) && |
|
|
( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) { |
|
|
handlers.splice( j, 1 ); |
|
|
|
|
|
if ( handleObj.selector ) { |
|
|
handlers.delegateCount--; |
|
|
} |
|
|
if ( special.remove ) { |
|
|
special.remove.call( elem, handleObj ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Remove generic event handler if we removed something and no more handlers exist |
|
|
// (avoids potential for endless recursion during removal of special event handlers) |
|
|
if ( origCount && !handlers.length ) { |
|
|
if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) { |
|
|
jQuery.removeEvent( elem, type, elemData.handle ); |
|
|
} |
|
|
|
|
|
delete events[ type ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// Remove the expando if it's no longer used |
|
|
if ( jQuery.isEmptyObject( events ) ) { |
|
|
delete elemData.handle; |
|
|
|
|
|
// removeData also checks for emptiness and clears the expando if empty |
|
|
// so use it instead of delete |
|
|
jQuery._removeData( elem, "events" ); |
|
|
} |
|
|
}, |
|
|
|
|
|
trigger: function( event, data, elem, onlyHandlers ) { |
|
|
var handle, ontype, cur, |
|
|
bubbleType, special, tmp, i, |
|
|
eventPath = [ elem || document ], |
|
|
type = core_hasOwn.call( event, "type" ) ? event.type : event, |
|
|
namespaces = core_hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : []; |
|
|
|
|
|
cur = tmp = elem = elem || document; |
|
|
|
|
|
// Don't do events on text and comment nodes |
|
|
if ( elem.nodeType === 3 || elem.nodeType === 8 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// focus/blur morphs to focusin/out; ensure we're not firing them right now |
|
|
if ( rfocusMorph.test( type + jQuery.event.triggered ) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
if ( type.indexOf(".") >= 0 ) { |
|
|
// Namespaced trigger; create a regexp to match event type in handle() |
|
|
namespaces = type.split("."); |
|
|
type = namespaces.shift(); |
|
|
namespaces.sort(); |
|
|
} |
|
|
ontype = type.indexOf(":") < 0 && "on" + type; |
|
|
|
|
|
// Caller can pass in a jQuery.Event object, Object, or just an event type string |
|
|
event = event[ jQuery.expando ] ? |
|
|
event : |
|
|
new jQuery.Event( type, typeof event === "object" && event ); |
|
|
|
|
|
event.isTrigger = true; |
|
|
event.namespace = namespaces.join("."); |
|
|
event.namespace_re = event.namespace ? |
|
|
new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) : |
|
|
null; |
|
|
|
|
|
// Clean up the event in case it is being reused |
|
|
event.result = undefined; |
|
|
if ( !event.target ) { |
|
|
event.target = elem; |
|
|
} |
|
|
|
|
|
// Clone any incoming data and prepend the event, creating the handler arg list |
|
|
data = data == null ? |
|
|
[ event ] : |
|
|
jQuery.makeArray( data, [ event ] ); |
|
|
|
|
|
// Allow special events to draw outside the lines |
|
|
special = jQuery.event.special[ type ] || {}; |
|
|
if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Determine event propagation path in advance, per W3C events spec (#9951) |
|
|
// Bubble up to document, then to window; watch for a global ownerDocument var (#9724) |
|
|
if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) { |
|
|
|
|
|
bubbleType = special.delegateType || type; |
|
|
if ( !rfocusMorph.test( bubbleType + type ) ) { |
|
|
cur = cur.parentNode; |
|
|
} |
|
|
for ( ; cur; cur = cur.parentNode ) { |
|
|
eventPath.push( cur ); |
|
|
tmp = cur; |
|
|
} |
|
|
|
|
|
// Only add window if we got to document (e.g., not plain obj or detached DOM) |
|
|
if ( tmp === (elem.ownerDocument || document) ) { |
|
|
eventPath.push( tmp.defaultView || tmp.parentWindow || window ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Fire handlers on the event path |
|
|
i = 0; |
|
|
while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) { |
|
|
|
|
|
event.type = i > 1 ? |
|
|
bubbleType : |
|
|
special.bindType || type; |
|
|
|
|
|
// jQuery handler |
|
|
handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" ); |
|
|
if ( handle ) { |
|
|
handle.apply( cur, data ); |
|
|
} |
|
|
|
|
|
// Native handler |
|
|
handle = ontype && cur[ ontype ]; |
|
|
if ( handle && jQuery.acceptData( cur ) && handle.apply && handle.apply( cur, data ) === false ) { |
|
|
event.preventDefault(); |
|
|
} |
|
|
} |
|
|
event.type = type; |
|
|
|
|
|
// If nobody prevented the default action, do it now |
|
|
if ( !onlyHandlers && !event.isDefaultPrevented() ) { |
|
|
|
|
|
if ( (!special._default || special._default.apply( elem.ownerDocument, data ) === false) && |
|
|
!(type === "click" && jQuery.nodeName( elem, "a" )) && jQuery.acceptData( elem ) ) { |
|
|
|
|
|
// Call a native DOM method on the target with the same name name as the event. |
|
|
// Can't use an .isFunction() check here because IE6/7 fails that test. |
|
|
// Don't do default actions on window, that's where global variables be (#6170) |
|
|
if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) { |
|
|
|
|
|
// Don't re-trigger an onFOO event when we call its FOO() method |
|
|
tmp = elem[ ontype ]; |
|
|
|
|
|
if ( tmp ) { |
|
|
elem[ ontype ] = null; |
|
|
} |
|
|
|
|
|
// Prevent re-triggering of the same event, since we already bubbled it above |
|
|
jQuery.event.triggered = type; |
|
|
try { |
|
|
elem[ type ](); |
|
|
} catch ( e ) { |
|
|
// IE<9 dies on focus/blur to hidden element (#1486,#12518) |
|
|
// only reproducible on winXP IE8 native, not IE9 in IE8 mode |
|
|
} |
|
|
jQuery.event.triggered = undefined; |
|
|
|
|
|
if ( tmp ) { |
|
|
elem[ ontype ] = tmp; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return event.result; |
|
|
}, |
|
|
|
|
|
dispatch: function( event ) { |
|
|
|
|
|
// Make a writable jQuery.Event from the native event object |
|
|
event = jQuery.event.fix( event ); |
|
|
|
|
|
var i, ret, handleObj, matched, j, |
|
|
handlerQueue = [], |
|
|
args = core_slice.call( arguments ), |
|
|
handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [], |
|
|
special = jQuery.event.special[ event.type ] || {}; |
|
|
|
|
|
// Use the fix-ed jQuery.Event rather than the (read-only) native event |
|
|
args[0] = event; |
|
|
event.delegateTarget = this; |
|
|
|
|
|
// Call the preDispatch hook for the mapped type, and let it bail if desired |
|
|
if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Determine handlers |
|
|
handlerQueue = jQuery.event.handlers.call( this, event, handlers ); |
|
|
|
|
|
// Run delegates first; they may want to stop propagation beneath us |
|
|
i = 0; |
|
|
while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) { |
|
|
event.currentTarget = matched.elem; |
|
|
|
|
|
j = 0; |
|
|
while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) { |
|
|
|
|
|
// Triggered event must either 1) have no namespace, or |
|
|
// 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace). |
|
|
if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) { |
|
|
|
|
|
event.handleObj = handleObj; |
|
|
event.data = handleObj.data; |
|
|
|
|
|
var obj = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler ); |
|
|
if(obj.apply){ |
|
|
ret = obj.apply( matched.elem, args ); |
|
|
} |
|
|
|
|
|
if ( ret !== undefined ) { |
|
|
if ( (event.result = ret) === false ) { |
|
|
event.preventDefault(); |
|
|
event.stopPropagation(); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Call the postDispatch hook for the mapped type |
|
|
if ( special.postDispatch ) { |
|
|
special.postDispatch.call( this, event ); |
|
|
} |
|
|
|
|
|
return event.result; |
|
|
}, |
|
|
|
|
|
handlers: function( event, handlers ) { |
|
|
var sel, handleObj, matches, i, |
|
|
handlerQueue = [], |
|
|
delegateCount = handlers.delegateCount, |
|
|
cur = event.target; |
|
|
|
|
|
// Find delegate handlers |
|
|
// Black-hole SVG <use> instance trees (#13180) |
|
|
// Avoid non-left-click bubbling in Firefox (#3861) |
|
|
if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) { |
|
|
|
|
|
for ( ; cur != this; cur = cur.parentNode || this ) { |
|
|
|
|
|
// Don't check non-elements (#13208) |
|
|
// Don't process clicks on disabled elements (#6911, #8165, #11382, #11764) |
|
|
if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) { |
|
|
matches = []; |
|
|
for ( i = 0; i < delegateCount; i++ ) { |
|
|
handleObj = handlers[ i ]; |
|
|
|
|
|
// Don't conflict with Object.prototype properties (#13203) |
|
|
sel = handleObj.selector + " "; |
|
|
|
|
|
if ( matches[ sel ] === undefined ) { |
|
|
matches[ sel ] = handleObj.needsContext ? |
|
|
jQuery( sel, this ).index( cur ) >= 0 : |
|
|
jQuery.find( sel, this, null, [ cur ] ).length; |
|
|
} |
|
|
if ( matches[ sel ] ) { |
|
|
matches.push( handleObj ); |
|
|
} |
|
|
} |
|
|
if ( matches.length ) { |
|
|
handlerQueue.push({ elem: cur, handlers: matches }); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Add the remaining (directly-bound) handlers |
|
|
if ( delegateCount < handlers.length ) { |
|
|
handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) }); |
|
|
} |
|
|
|
|
|
return handlerQueue; |
|
|
}, |
|
|
|
|
|
fix: function( event ) { |
|
|
if ( event[ jQuery.expando ] ) { |
|
|
return event; |
|
|
} |
|
|
|
|
|
// Create a writable copy of the event object and normalize some properties |
|
|
var i, prop, copy, |
|
|
type = event.type, |
|
|
originalEvent = event, |
|
|
fixHook = this.fixHooks[ type ]; |
|
|
|
|
|
if ( !fixHook ) { |
|
|
this.fixHooks[ type ] = fixHook = |
|
|
rmouseEvent.test( type ) ? this.mouseHooks : |
|
|
rkeyEvent.test( type ) ? this.keyHooks : |
|
|
{}; |
|
|
} |
|
|
copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props; |
|
|
|
|
|
event = new jQuery.Event( originalEvent ); |
|
|
|
|
|
i = copy.length; |
|
|
while ( i-- ) { |
|
|
prop = copy[ i ]; |
|
|
event[ prop ] = originalEvent[ prop ]; |
|
|
} |
|
|
|
|
|
// Support: IE<9 |
|
|
// Fix target property (#1925) |
|
|
if ( !event.target ) { |
|
|
event.target = originalEvent.srcElement || document; |
|
|
} |
|
|
|
|
|
// Support: Chrome 23+, Safari? |
|
|
// Target should not be a text node (#504, #13143) |
|
|
if ( event.target.nodeType === 3 ) { |
|
|
event.target = event.target.parentNode; |
|
|
} |
|
|
|
|
|
// Support: IE<9 |
|
|
// For mouse/key events, metaKey==false if it's undefined (#3368, #11328) |
|
|
event.metaKey = !!event.metaKey; |
|
|
|
|
|
return fixHook.filter ? fixHook.filter( event, originalEvent ) : event; |
|
|
}, |
|
|
|
|
|
// Includes some event props shared by KeyEvent and MouseEvent |
|
|
props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "), |
|
|
|
|
|
fixHooks: {}, |
|
|
|
|
|
keyHooks: { |
|
|
props: "char charCode key keyCode".split(" "), |
|
|
filter: function( event, original ) { |
|
|
|
|
|
// Add which for key events |
|
|
if ( event.which == null ) { |
|
|
event.which = original.charCode != null ? original.charCode : original.keyCode; |
|
|
} |
|
|
|
|
|
return event; |
|
|
} |
|
|
}, |
|
|
|
|
|
mouseHooks: { |
|
|
props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "), |
|
|
filter: function( event, original ) { |
|
|
var body, eventDoc, doc, |
|
|
button = original.button, |
|
|
fromElement = original.fromElement; |
|
|
|
|
|
// Calculate pageX/Y if missing and clientX/Y available |
|
|
if ( event.pageX == null && original.clientX != null ) { |
|
|
eventDoc = event.target.ownerDocument || document; |
|
|
doc = eventDoc.documentElement; |
|
|
body = eventDoc.body; |
|
|
|
|
|
event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 ); |
|
|
event.pageY = original.clientY + ( doc && doc.scrollTop || body && body.scrollTop || 0 ) - ( doc && doc.clientTop || body && body.clientTop || 0 ); |
|
|
} |
|
|
|
|
|
// Add relatedTarget, if necessary |
|
|
if ( !event.relatedTarget && fromElement ) { |
|
|
event.relatedTarget = fromElement === event.target ? original.toElement : fromElement; |
|
|
} |
|
|
|
|
|
// Add which for click: 1 === left; 2 === middle; 3 === right |
|
|
// Note: button is not normalized, so don't use it |
|
|
if ( !event.which && button !== undefined ) { |
|
|
event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) ); |
|
|
} |
|
|
|
|
|
return event; |
|
|
} |
|
|
}, |
|
|
|
|
|
special: { |
|
|
load: { |
|
|
// Prevent triggered image.load events from bubbling to window.load |
|
|
noBubble: true |
|
|
}, |
|
|
click: { |
|
|
// For checkbox, fire native event so checked state will be right |
|
|
trigger: function() { |
|
|
if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) { |
|
|
this.click(); |
|
|
return false; |
|
|
} |
|
|
} |
|
|
}, |
|
|
focus: { |
|
|
// Fire native event if possible so blur/focus sequence is correct |
|
|
trigger: function() { |
|
|
if ( this !== document.activeElement && this.focus ) { |
|
|
try { |
|
|
this.focus(); |
|
|
return false; |
|
|
} catch ( e ) { |
|
|
// Support: IE<9 |
|
|
// If we error on focus to hidden element (#1486, #12518), |
|
|
// let .trigger() run the handlers |
|
|
} |
|
|
} |
|
|
}, |
|
|
delegateType: "focusin" |
|
|
}, |
|
|
blur: { |
|
|
trigger: function() { |
|
|
if ( this === document.activeElement && this.blur ) { |
|
|
this.blur(); |
|
|
return false; |
|
|
} |
|
|
}, |
|
|
delegateType: "focusout" |
|
|
}, |
|
|
|
|
|
beforeunload: { |
|
|
postDispatch: function( event ) { |
|
|
|
|
|
// Even when returnValue equals to undefined Firefox will still show alert |
|
|
if ( event.result !== undefined ) { |
|
|
event.originalEvent.returnValue = event.result; |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
simulate: function( type, elem, event, bubble ) { |
|
|
// Piggyback on a donor event to simulate a different one. |
|
|
// Fake originalEvent to avoid donor's stopPropagation, but if the |
|
|
// simulated event prevents default then we do the same on the donor. |
|
|
var e = jQuery.extend( |
|
|
new jQuery.Event(), |
|
|
event, |
|
|
{ type: type, |
|
|
isSimulated: true, |
|
|
originalEvent: {} |
|
|
} |
|
|
); |
|
|
if ( bubble ) { |
|
|
jQuery.event.trigger( e, null, elem ); |
|
|
} else { |
|
|
jQuery.event.dispatch.call( elem, e ); |
|
|
} |
|
|
if ( e.isDefaultPrevented() ) { |
|
|
event.preventDefault(); |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.removeEvent = document.removeEventListener ? |
|
|
function( elem, type, handle ) { |
|
|
if ( elem.removeEventListener ) { |
|
|
elem.removeEventListener( type, handle, false ); |
|
|
} |
|
|
} : |
|
|
function( elem, type, handle ) { |
|
|
var name = "on" + type; |
|
|
|
|
|
if ( elem.detachEvent ) { |
|
|
|
|
|
// #8545, #7054, preventing memory leaks for custom events in IE6-8 |
|
|
// detachEvent needed property on element, by name of that event, to properly expose it to GC |
|
|
if ( typeof elem[ name ] === core_strundefined ) { |
|
|
elem[ name ] = null; |
|
|
} |
|
|
|
|
|
elem.detachEvent( name, handle ); |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.Event = function( src, props ) { |
|
|
// Allow instantiation without the 'new' keyword |
|
|
if ( !(this instanceof jQuery.Event) ) { |
|
|
return new jQuery.Event( src, props ); |
|
|
} |
|
|
|
|
|
// Event object |
|
|
if ( src && src.type ) { |
|
|
this.originalEvent = src; |
|
|
this.type = src.type; |
|
|
|
|
|
// Events bubbling up the document may have been marked as prevented |
|
|
// by a handler lower down the tree; reflect the correct value. |
|
|
this.isDefaultPrevented = ( src.defaultPrevented || src.returnValue === false || |
|
|
src.getPreventDefault && src.getPreventDefault() ) ? returnTrue : returnFalse; |
|
|
|
|
|
// Event type |
|
|
} else { |
|
|
this.type = src; |
|
|
} |
|
|
|
|
|
// Put explicitly provided properties onto the event object |
|
|
if ( props ) { |
|
|
jQuery.extend( this, props ); |
|
|
} |
|
|
|
|
|
// Create a timestamp if incoming event doesn't have one |
|
|
this.timeStamp = src && src.timeStamp || jQuery.now(); |
|
|
|
|
|
// Mark it as fixed |
|
|
this[ jQuery.expando ] = true; |
|
|
}; |
|
|
|
|
|
// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding |
|
|
// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html |
|
|
jQuery.Event.prototype = { |
|
|
isDefaultPrevented: returnFalse, |
|
|
isPropagationStopped: returnFalse, |
|
|
isImmediatePropagationStopped: returnFalse, |
|
|
|
|
|
preventDefault: function() { |
|
|
var e = this.originalEvent; |
|
|
|
|
|
this.isDefaultPrevented = returnTrue; |
|
|
if ( !e ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// If preventDefault exists, run it on the original event |
|
|
if ( e.preventDefault ) { |
|
|
e.preventDefault(); |
|
|
|
|
|
// Support: IE |
|
|
// Otherwise set the returnValue property of the original event to false |
|
|
} else { |
|
|
e.returnValue = false; |
|
|
} |
|
|
}, |
|
|
stopPropagation: function() { |
|
|
var e = this.originalEvent; |
|
|
|
|
|
this.isPropagationStopped = returnTrue; |
|
|
if ( !e ) { |
|
|
return; |
|
|
} |
|
|
// If stopPropagation exists, run it on the original event |
|
|
if ( e.stopPropagation ) { |
|
|
e.stopPropagation(); |
|
|
} |
|
|
|
|
|
// Support: IE |
|
|
// Set the cancelBubble property of the original event to true |
|
|
e.cancelBubble = true; |
|
|
}, |
|
|
stopImmediatePropagation: function() { |
|
|
this.isImmediatePropagationStopped = returnTrue; |
|
|
this.stopPropagation(); |
|
|
} |
|
|
}; |
|
|
|
|
|
// Create mouseenter/leave events using mouseover/out and event-time checks |
|
|
jQuery.each({ |
|
|
mouseenter: "mouseover", |
|
|
mouseleave: "mouseout" |
|
|
}, function( orig, fix ) { |
|
|
jQuery.event.special[ orig ] = { |
|
|
delegateType: fix, |
|
|
bindType: fix, |
|
|
|
|
|
handle: function( event ) { |
|
|
var ret, |
|
|
target = this, |
|
|
related = event.relatedTarget, |
|
|
handleObj = event.handleObj; |
|
|
|
|
|
// For mousenter/leave call the handler if related is outside the target. |
|
|
// NB: No relatedTarget if the mouse left/entered the browser window |
|
|
if ( !related || (related !== target && !jQuery.contains( target, related )) ) { |
|
|
event.type = handleObj.origType; |
|
|
ret = handleObj.handler.apply( this, arguments ); |
|
|
event.type = fix; |
|
|
} |
|
|
return ret; |
|
|
} |
|
|
}; |
|
|
}); |
|
|
|
|
|
// IE submit delegation |
|
|
if ( !jQuery.support.submitBubbles ) { |
|
|
|
|
|
jQuery.event.special.submit = { |
|
|
setup: function() { |
|
|
// Only need this for delegated form submit events |
|
|
if ( jQuery.nodeName( this, "form" ) ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
// Lazy-add a submit handler when a descendant form may potentially be submitted |
|
|
jQuery.event.add( this, "click._submit keypress._submit", function( e ) { |
|
|
// Node name check avoids a VML-related crash in IE (#9807) |
|
|
var elem = e.target, |
|
|
form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined; |
|
|
if ( form && !jQuery._data( form, "submitBubbles" ) ) { |
|
|
jQuery.event.add( form, "submit._submit", function( event ) { |
|
|
event._submit_bubble = true; |
|
|
}); |
|
|
jQuery._data( form, "submitBubbles", true ); |
|
|
} |
|
|
}); |
|
|
// return undefined since we don't need an event listener |
|
|
}, |
|
|
|
|
|
postDispatch: function( event ) { |
|
|
// If form was submitted by the user, bubble the event up the tree |
|
|
if ( event._submit_bubble ) { |
|
|
delete event._submit_bubble; |
|
|
if ( this.parentNode && !event.isTrigger ) { |
|
|
jQuery.event.simulate( "submit", this.parentNode, event, true ); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
teardown: function() { |
|
|
// Only need this for delegated form submit events |
|
|
if ( jQuery.nodeName( this, "form" ) ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
// Remove delegated handlers; cleanData eventually reaps submit handlers attached above |
|
|
jQuery.event.remove( this, "._submit" ); |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// IE change delegation and checkbox/radio fix |
|
|
if ( !jQuery.support.changeBubbles ) { |
|
|
|
|
|
jQuery.event.special.change = { |
|
|
|
|
|
setup: function() { |
|
|
|
|
|
if ( rformElems.test( this.nodeName ) ) { |
|
|
// IE doesn't fire change on a check/radio until blur; trigger it on click |
|
|
// after a propertychange. Eat the blur-change in special.change.handle. |
|
|
// This still fires onchange a second time for check/radio after blur. |
|
|
if ( this.type === "checkbox" || this.type === "radio" ) { |
|
|
jQuery.event.add( this, "propertychange._change", function( event ) { |
|
|
if ( event.originalEvent.propertyName === "checked" ) { |
|
|
this._just_changed = true; |
|
|
} |
|
|
}); |
|
|
jQuery.event.add( this, "click._change", function( event ) { |
|
|
if ( this._just_changed && !event.isTrigger ) { |
|
|
this._just_changed = false; |
|
|
} |
|
|
// Allow triggered, simulated change events (#11500) |
|
|
jQuery.event.simulate( "change", this, event, true ); |
|
|
}); |
|
|
} |
|
|
return false; |
|
|
} |
|
|
// Delegated event; lazy-add a change handler on descendant inputs |
|
|
jQuery.event.add( this, "beforeactivate._change", function( e ) { |
|
|
var elem = e.target; |
|
|
|
|
|
if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) { |
|
|
jQuery.event.add( elem, "change._change", function( event ) { |
|
|
if ( this.parentNode && !event.isSimulated && !event.isTrigger ) { |
|
|
jQuery.event.simulate( "change", this.parentNode, event, true ); |
|
|
} |
|
|
}); |
|
|
jQuery._data( elem, "changeBubbles", true ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
handle: function( event ) { |
|
|
var elem = event.target; |
|
|
|
|
|
// Swallow native change events from checkbox/radio, we already triggered them above |
|
|
if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) { |
|
|
return event.handleObj.handler.apply( this, arguments ); |
|
|
} |
|
|
}, |
|
|
|
|
|
teardown: function() { |
|
|
jQuery.event.remove( this, "._change" ); |
|
|
|
|
|
return !rformElems.test( this.nodeName ); |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// Create "bubbling" focus and blur events |
|
|
if ( !jQuery.support.focusinBubbles ) { |
|
|
jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) { |
|
|
|
|
|
// Attach a single capturing handler while someone wants focusin/focusout |
|
|
var attaches = 0, |
|
|
handler = function( event ) { |
|
|
jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true ); |
|
|
}; |
|
|
|
|
|
jQuery.event.special[ fix ] = { |
|
|
setup: function() { |
|
|
if ( attaches++ === 0 ) { |
|
|
document.addEventListener( orig, handler, true ); |
|
|
} |
|
|
}, |
|
|
teardown: function() { |
|
|
if ( --attaches === 0 ) { |
|
|
document.removeEventListener( orig, handler, true ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
}); |
|
|
} |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
|
|
|
on: function( types, selector, data, fn, /*INTERNAL*/ one ) { |
|
|
var type, origFn; |
|
|
|
|
|
// Types can be a map of types/handlers |
|
|
if ( typeof types === "object" ) { |
|
|
// ( types-Object, selector, data ) |
|
|
if ( typeof selector !== "string" ) { |
|
|
// ( types-Object, data ) |
|
|
data = data || selector; |
|
|
selector = undefined; |
|
|
} |
|
|
for ( type in types ) { |
|
|
this.on( type, selector, data, types[ type ], one ); |
|
|
} |
|
|
return this; |
|
|
} |
|
|
|
|
|
if ( data == null && fn == null ) { |
|
|
// ( types, fn ) |
|
|
fn = selector; |
|
|
data = selector = undefined; |
|
|
} else if ( fn == null ) { |
|
|
if ( typeof selector === "string" ) { |
|
|
// ( types, selector, fn ) |
|
|
fn = data; |
|
|
data = undefined; |
|
|
} else { |
|
|
// ( types, data, fn ) |
|
|
fn = data; |
|
|
data = selector; |
|
|
selector = undefined; |
|
|
} |
|
|
} |
|
|
if ( fn === false ) { |
|
|
fn = returnFalse; |
|
|
} else if ( !fn ) { |
|
|
return this; |
|
|
} |
|
|
|
|
|
if ( one === 1 ) { |
|
|
origFn = fn; |
|
|
fn = function( event ) { |
|
|
// Can use an empty set, since event contains the info |
|
|
jQuery().off( event ); |
|
|
return origFn.apply( this, arguments ); |
|
|
}; |
|
|
// Use same guid so caller can remove using origFn |
|
|
fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ ); |
|
|
} |
|
|
return this.each( function() { |
|
|
jQuery.event.add( this, types, fn, data, selector ); |
|
|
}); |
|
|
}, |
|
|
one: function( types, selector, data, fn ) { |
|
|
return this.on( types, selector, data, fn, 1 ); |
|
|
}, |
|
|
off: function( types, selector, fn ) { |
|
|
var handleObj, type; |
|
|
if ( types && types.preventDefault && types.handleObj ) { |
|
|
// ( event ) dispatched jQuery.Event |
|
|
handleObj = types.handleObj; |
|
|
jQuery( types.delegateTarget ).off( |
|
|
handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType, |
|
|
handleObj.selector, |
|
|
handleObj.handler |
|
|
); |
|
|
return this; |
|
|
} |
|
|
if ( typeof types === "object" ) { |
|
|
// ( types-object [, selector] ) |
|
|
for ( type in types ) { |
|
|
this.off( type, selector, types[ type ] ); |
|
|
} |
|
|
return this; |
|
|
} |
|
|
if ( selector === false || typeof selector === "function" ) { |
|
|
// ( types [, fn] ) |
|
|
fn = selector; |
|
|
selector = undefined; |
|
|
} |
|
|
if ( fn === false ) { |
|
|
fn = returnFalse; |
|
|
} |
|
|
return this.each(function() { |
|
|
jQuery.event.remove( this, types, fn, selector ); |
|
|
}); |
|
|
}, |
|
|
|
|
|
bind: function( types, data, fn ) { |
|
|
return this.on( types, null, data, fn ); |
|
|
}, |
|
|
unbind: function( types, fn ) { |
|
|
return this.off( types, null, fn ); |
|
|
}, |
|
|
|
|
|
delegate: function( selector, types, data, fn ) { |
|
|
return this.on( types, selector, data, fn ); |
|
|
}, |
|
|
undelegate: function( selector, types, fn ) { |
|
|
// ( namespace ) or ( selector, types [, fn] ) |
|
|
return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn ); |
|
|
}, |
|
|
|
|
|
trigger: function( type, data ) { |
|
|
return this.each(function() { |
|
|
jQuery.event.trigger( type, data, this ); |
|
|
}); |
|
|
}, |
|
|
triggerHandler: function( type, data ) { |
|
|
var elem = this[0]; |
|
|
if ( elem ) { |
|
|
return jQuery.event.trigger( type, data, elem, true ); |
|
|
} |
|
|
} |
|
|
}); |
|
|
/*! |
|
|
* Sizzle CSS Selector Engine |
|
|
* Copyright 2012 jQuery Foundation and other contributors |
|
|
* Released under the MIT license |
|
|
* http://sizzlejs.com/ |
|
|
*/ |
|
|
(function( window, undefined ) { |
|
|
|
|
|
var i, |
|
|
cachedruns, |
|
|
Expr, |
|
|
getText, |
|
|
isXML, |
|
|
compile, |
|
|
hasDuplicate, |
|
|
outermostContext, |
|
|
|
|
|
// Local document vars |
|
|
setDocument, |
|
|
document, |
|
|
docElem, |
|
|
documentIsXML, |
|
|
rbuggyQSA, |
|
|
rbuggyMatches, |
|
|
matches, |
|
|
contains, |
|
|
sortOrder, |
|
|
|
|
|
// Instance-specific data |
|
|
expando = "sizzle" + -(new Date()), |
|
|
preferredDoc = window.document, |
|
|
support = {}, |
|
|
dirruns = 0, |
|
|
done = 0, |
|
|
classCache = createCache(), |
|
|
tokenCache = createCache(), |
|
|
compilerCache = createCache(), |
|
|
|
|
|
// General-purpose constants |
|
|
strundefined = typeof undefined, |
|
|
MAX_NEGATIVE = 1 << 31, |
|
|
|
|
|
// Array methods |
|
|
arr = [], |
|
|
pop = arr.pop, |
|
|
push = arr.push, |
|
|
slice = arr.slice, |
|
|
// Use a stripped-down indexOf if we can't use a native one |
|
|
indexOf = arr.indexOf || function( elem ) { |
|
|
var i = 0, |
|
|
len = this.length; |
|
|
for ( ; i < len; i++ ) { |
|
|
if ( this[i] === elem ) { |
|
|
return i; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
}, |
|
|
|
|
|
|
|
|
// Regular expressions |
|
|
|
|
|
// Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace |
|
|
whitespace = "[\\x20\\t\\r\\n\\f]", |
|
|
// http://www.w3.org/TR/css3-syntax/#characters |
|
|
characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+", |
|
|
|
|
|
// Loosely modeled on CSS identifier characters |
|
|
// An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors |
|
|
// Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier |
|
|
identifier = characterEncoding.replace( "w", "w#" ), |
|
|
|
|
|
// Acceptable operators http://www.w3.org/TR/selectors/#attribute-selectors |
|
|
operators = "([*^$|!~]?=)", |
|
|
attributes = "\\[" + whitespace + "*(" + characterEncoding + ")" + whitespace + |
|
|
"*(?:" + operators + whitespace + "*(?:(['\"])((?:\\\\.|[^\\\\])*?)\\3|(" + identifier + ")|)|)" + whitespace + "*\\]", |
|
|
|
|
|
// Prefer arguments quoted, |
|
|
// then not containing pseudos/brackets, |
|
|
// then attribute selectors/non-parenthetical expressions, |
|
|
// then anything else |
|
|
// These preferences are here to reduce the number of selectors |
|
|
// needing tokenize in the PSEUDO preFilter |
|
|
pseudos = ":(" + characterEncoding + ")(?:\\(((['\"])((?:\\\\.|[^\\\\])*?)\\3|((?:\\\\.|[^\\\\()[\\]]|" + attributes.replace( 3, 8 ) + ")*)|.*)\\)|)", |
|
|
|
|
|
// Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter |
|
|
rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ), |
|
|
|
|
|
rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ), |
|
|
rcombinators = new RegExp( "^" + whitespace + "*([\\x20\\t\\r\\n\\f>+~])" + whitespace + "*" ), |
|
|
rpseudo = new RegExp( pseudos ), |
|
|
ridentifier = new RegExp( "^" + identifier + "$" ), |
|
|
|
|
|
matchExpr = { |
|
|
"ID": new RegExp( "^#(" + characterEncoding + ")" ), |
|
|
"CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ), |
|
|
"NAME": new RegExp( "^\\[name=['\"]?(" + characterEncoding + ")['\"]?\\]" ), |
|
|
"TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ), |
|
|
"ATTR": new RegExp( "^" + attributes ), |
|
|
"PSEUDO": new RegExp( "^" + pseudos ), |
|
|
"CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace + |
|
|
"*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace + |
|
|
"*(\\d+)|))" + whitespace + "*\\)|)", "i" ), |
|
|
// For use in libraries implementing .is() |
|
|
// We use this for POS matching in `select` |
|
|
"needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" + |
|
|
whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" ) |
|
|
}, |
|
|
|
|
|
rsibling = /[\x20\t\r\n\f]*[+~]/, |
|
|
|
|
|
rnative = /^[^{]+\{\s*\[native code/, |
|
|
|
|
|
// Easily-parseable/retrievable ID or TAG or CLASS selectors |
|
|
rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/, |
|
|
|
|
|
rinputs = /^(?:input|select|textarea|button)$/i, |
|
|
rheader = /^h\d$/i, |
|
|
|
|
|
rescape = /'|\\/g, |
|
|
rattributeQuotes = /\=[\x20\t\r\n\f]*([^'"\]]*)[\x20\t\r\n\f]*\]/g, |
|
|
|
|
|
// CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters |
|
|
runescape = /\\([\da-fA-F]{1,6}[\x20\t\r\n\f]?|.)/g, |
|
|
funescape = function( _, escaped ) { |
|
|
var high = "0x" + escaped - 0x10000; |
|
|
// NaN means non-codepoint |
|
|
return high !== high ? |
|
|
escaped : |
|
|
// BMP codepoint |
|
|
high < 0 ? |
|
|
String.fromCharCode( high + 0x10000 ) : |
|
|
// Supplemental Plane codepoint (surrogate pair) |
|
|
String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 ); |
|
|
}; |
|
|
|
|
|
// Use a stripped-down slice if we can't use a native one |
|
|
try { |
|
|
slice.call( preferredDoc.documentElement.childNodes, 0 )[0].nodeType; |
|
|
} catch ( e ) { |
|
|
slice = function( i ) { |
|
|
var elem, |
|
|
results = []; |
|
|
while ( (elem = this[i++]) ) { |
|
|
results.push( elem ); |
|
|
} |
|
|
return results; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* For feature detection |
|
|
* @param {Function} fn The function to test for native support |
|
|
*/ |
|
|
function isNative( fn ) { |
|
|
return rnative.test( fn + "" ); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Create key-value caches of limited size |
|
|
* @returns {Function(string, Object)} Returns the Object data after storing it on itself with |
|
|
* property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength) |
|
|
* deleting the oldest entry |
|
|
*/ |
|
|
function createCache() { |
|
|
var cache, |
|
|
keys = []; |
|
|
|
|
|
return (cache = function( key, value ) { |
|
|
// Use (key + " ") to avoid collision with native prototype properties (see Issue #157) |
|
|
if ( keys.push( key += " " ) > Expr.cacheLength ) { |
|
|
// Only keep the most recent entries |
|
|
delete cache[ keys.shift() ]; |
|
|
} |
|
|
return (cache[ key ] = value); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Mark a function for special use by Sizzle |
|
|
* @param {Function} fn The function to mark |
|
|
*/ |
|
|
function markFunction( fn ) { |
|
|
fn[ expando ] = true; |
|
|
return fn; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Support testing using an element |
|
|
* @param {Function} fn Passed the created div and expects a boolean result |
|
|
*/ |
|
|
function assert( fn ) { |
|
|
var div = document.createElement("div"); |
|
|
|
|
|
try { |
|
|
return fn( div ); |
|
|
} catch (e) { |
|
|
return false; |
|
|
} finally { |
|
|
// release memory in IE |
|
|
div = null; |
|
|
} |
|
|
} |
|
|
|
|
|
function Sizzle( selector, context, results, seed ) { |
|
|
var match, elem, m, nodeType, |
|
|
// QSA vars |
|
|
i, groups, old, nid, newContext, newSelector; |
|
|
|
|
|
if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) { |
|
|
setDocument( context ); |
|
|
} |
|
|
|
|
|
context = context || document; |
|
|
results = results || []; |
|
|
|
|
|
if ( !selector || typeof selector !== "string" ) { |
|
|
return results; |
|
|
} |
|
|
|
|
|
if ( (nodeType = context.nodeType) !== 1 && nodeType !== 9 ) { |
|
|
return []; |
|
|
} |
|
|
|
|
|
if ( !documentIsXML && !seed ) { |
|
|
|
|
|
// Shortcuts |
|
|
if ( (match = rquickExpr.exec( selector )) ) { |
|
|
// Speed-up: Sizzle("#ID") |
|
|
if ( (m = match[1]) ) { |
|
|
if ( nodeType === 9 ) { |
|
|
elem = context.getElementById( m ); |
|
|
// Check parentNode to catch when Blackberry 4.6 returns |
|
|
// nodes that are no longer in the document #6963 |
|
|
if ( elem && elem.parentNode ) { |
|
|
// Handle the case where IE, Opera, and Webkit return items |
|
|
// by name instead of ID |
|
|
if ( elem.id === m ) { |
|
|
results.push( elem ); |
|
|
return results; |
|
|
} |
|
|
} else { |
|
|
return results; |
|
|
} |
|
|
} else { |
|
|
// Context is not a document |
|
|
if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) && |
|
|
contains( context, elem ) && elem.id === m ) { |
|
|
results.push( elem ); |
|
|
return results; |
|
|
} |
|
|
} |
|
|
|
|
|
// Speed-up: Sizzle("TAG") |
|
|
} else if ( match[2] ) { |
|
|
push.apply( results, slice.call(context.getElementsByTagName( selector ), 0) ); |
|
|
return results; |
|
|
|
|
|
// Speed-up: Sizzle(".CLASS") |
|
|
} else if ( (m = match[3]) && support.getByClassName && context.getElementsByClassName ) { |
|
|
push.apply( results, slice.call(context.getElementsByClassName( m ), 0) ); |
|
|
return results; |
|
|
} |
|
|
} |
|
|
|
|
|
// QSA path |
|
|
if ( support.qsa && !rbuggyQSA.test(selector) ) { |
|
|
old = true; |
|
|
nid = expando; |
|
|
newContext = context; |
|
|
newSelector = nodeType === 9 && selector; |
|
|
|
|
|
// qSA works strangely on Element-rooted queries |
|
|
// We can work around this by specifying an extra ID on the root |
|
|
// and working up from there (Thanks to Andrew Dupont for the technique) |
|
|
// IE 8 doesn't work on object elements |
|
|
if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) { |
|
|
groups = tokenize( selector ); |
|
|
|
|
|
if ( (old = context.getAttribute("id")) ) { |
|
|
nid = old.replace( rescape, "\\$&" ); |
|
|
} else { |
|
|
context.setAttribute( "id", nid ); |
|
|
} |
|
|
nid = "[id='" + nid + "'] "; |
|
|
|
|
|
i = groups.length; |
|
|
while ( i-- ) { |
|
|
groups[i] = nid + toSelector( groups[i] ); |
|
|
} |
|
|
newContext = rsibling.test( selector ) && context.parentNode || context; |
|
|
newSelector = groups.join(","); |
|
|
} |
|
|
|
|
|
if ( newSelector ) { |
|
|
try { |
|
|
push.apply( results, slice.call( newContext.querySelectorAll( |
|
|
newSelector |
|
|
), 0 ) ); |
|
|
return results; |
|
|
} catch(qsaError) { |
|
|
} finally { |
|
|
if ( !old ) { |
|
|
context.removeAttribute("id"); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// All others |
|
|
return select( selector.replace( rtrim, "$1" ), context, results, seed ); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Detect xml |
|
|
* @param {Element|Object} elem An element or a document |
|
|
*/ |
|
|
isXML = Sizzle.isXML = function( elem ) { |
|
|
// documentElement is verified for cases where it doesn't yet exist |
|
|
// (such as loading iframes in IE - #4833) |
|
|
var documentElement = elem && (elem.ownerDocument || elem).documentElement; |
|
|
return documentElement ? documentElement.nodeName !== "HTML" : false; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Sets document-related variables once based on the current document |
|
|
* @param {Element|Object} [doc] An element or document object to use to set the document |
|
|
* @returns {Object} Returns the current document |
|
|
*/ |
|
|
setDocument = Sizzle.setDocument = function( node ) { |
|
|
var doc = node ? node.ownerDocument || node : preferredDoc; |
|
|
|
|
|
// If no document and documentElement is available, return |
|
|
if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) { |
|
|
return document; |
|
|
} |
|
|
|
|
|
// Set our document |
|
|
document = doc; |
|
|
docElem = doc.documentElement; |
|
|
|
|
|
// Support tests |
|
|
documentIsXML = isXML( doc ); |
|
|
|
|
|
// Check if getElementsByTagName("*") returns only elements |
|
|
support.tagNameNoComments = assert(function( div ) { |
|
|
div.appendChild( doc.createComment("") ); |
|
|
return !div.getElementsByTagName("*").length; |
|
|
}); |
|
|
|
|
|
// Check if attributes should be retrieved by attribute nodes |
|
|
support.attributes = assert(function( div ) { |
|
|
div.innerHTML = "<select></select>"; |
|
|
var type = typeof div.lastChild.getAttribute("multiple"); |
|
|
// IE8 returns a string for some attributes even when not present |
|
|
return type !== "boolean" && type !== "string"; |
|
|
}); |
|
|
|
|
|
// Check if getElementsByClassName can be trusted |
|
|
support.getByClassName = assert(function( div ) { |
|
|
// Opera can't find a second classname (in 9.6) |
|
|
div.innerHTML = "<div class='hidden e'></div><div class='hidden'></div>"; |
|
|
if ( !div.getElementsByClassName || !div.getElementsByClassName("e").length ) { |
|
|
return false; |
|
|
} |
|
|
|
|
|
// Safari 3.2 caches class attributes and doesn't catch changes |
|
|
div.lastChild.className = "e"; |
|
|
return div.getElementsByClassName("e").length === 2; |
|
|
}); |
|
|
|
|
|
// Check if getElementById returns elements by name |
|
|
// Check if getElementsByName privileges form controls or returns elements by ID |
|
|
support.getByName = assert(function( div ) { |
|
|
// Inject content |
|
|
div.id = expando + 0; |
|
|
div.innerHTML = "<a name='" + expando + "'></a><div name='" + expando + "'></div>"; |
|
|
docElem.insertBefore( div, docElem.firstChild ); |
|
|
|
|
|
// Test |
|
|
var pass = doc.getElementsByName && |
|
|
// buggy browsers will return fewer than the correct 2 |
|
|
doc.getElementsByName( expando ).length === 2 + |
|
|
// buggy browsers will return more than the correct 0 |
|
|
doc.getElementsByName( expando + 0 ).length; |
|
|
support.getIdNotName = !doc.getElementById( expando ); |
|
|
|
|
|
// Cleanup |
|
|
docElem.removeChild( div ); |
|
|
|
|
|
return pass; |
|
|
}); |
|
|
|
|
|
// IE6/7 return modified attributes |
|
|
Expr.attrHandle = assert(function( div ) { |
|
|
div.innerHTML = "<a href='#'></a>"; |
|
|
return div.firstChild && typeof div.firstChild.getAttribute !== strundefined && |
|
|
div.firstChild.getAttribute("href") === "#"; |
|
|
}) ? |
|
|
{} : |
|
|
{ |
|
|
"href": function( elem ) { |
|
|
return elem.getAttribute( "href", 2 ); |
|
|
}, |
|
|
"type": function( elem ) { |
|
|
return elem.getAttribute("type"); |
|
|
} |
|
|
}; |
|
|
|
|
|
// ID find and filter |
|
|
if ( support.getIdNotName ) { |
|
|
Expr.find["ID"] = function( id, context ) { |
|
|
if ( typeof context.getElementById !== strundefined && !documentIsXML ) { |
|
|
var m = context.getElementById( id ); |
|
|
// Check parentNode to catch when Blackberry 4.6 returns |
|
|
// nodes that are no longer in the document #6963 |
|
|
return m && m.parentNode ? [m] : []; |
|
|
} |
|
|
}; |
|
|
Expr.filter["ID"] = function( id ) { |
|
|
var attrId = id.replace( runescape, funescape ); |
|
|
return function( elem ) { |
|
|
return elem.getAttribute("id") === attrId; |
|
|
}; |
|
|
}; |
|
|
} else { |
|
|
Expr.find["ID"] = function( id, context ) { |
|
|
if ( typeof context.getElementById !== strundefined && !documentIsXML ) { |
|
|
var m = context.getElementById( id ); |
|
|
|
|
|
return m ? |
|
|
m.id === id || typeof m.getAttributeNode !== strundefined && m.getAttributeNode("id").value === id ? |
|
|
[m] : |
|
|
undefined : |
|
|
[]; |
|
|
} |
|
|
}; |
|
|
Expr.filter["ID"] = function( id ) { |
|
|
var attrId = id.replace( runescape, funescape ); |
|
|
return function( elem ) { |
|
|
var node = typeof elem.getAttributeNode !== strundefined && elem.getAttributeNode("id"); |
|
|
return node && node.value === attrId; |
|
|
}; |
|
|
}; |
|
|
} |
|
|
|
|
|
// Tag |
|
|
Expr.find["TAG"] = support.tagNameNoComments ? |
|
|
function( tag, context ) { |
|
|
if ( typeof context.getElementsByTagName !== strundefined ) { |
|
|
return context.getElementsByTagName( tag ); |
|
|
} |
|
|
} : |
|
|
function( tag, context ) { |
|
|
var elem, |
|
|
tmp = [], |
|
|
i = 0, |
|
|
results = context.getElementsByTagName( tag ); |
|
|
|
|
|
// Filter out possible comments |
|
|
if ( tag === "*" ) { |
|
|
while ( (elem = results[i++]) ) { |
|
|
if ( elem.nodeType === 1 ) { |
|
|
tmp.push( elem ); |
|
|
} |
|
|
} |
|
|
|
|
|
return tmp; |
|
|
} |
|
|
return results; |
|
|
}; |
|
|
|
|
|
// Name |
|
|
Expr.find["NAME"] = support.getByName && function( tag, context ) { |
|
|
if ( typeof context.getElementsByName !== strundefined ) { |
|
|
return context.getElementsByName( name ); |
|
|
} |
|
|
}; |
|
|
|
|
|
// Class |
|
|
Expr.find["CLASS"] = support.getByClassName && function( className, context ) { |
|
|
if ( typeof context.getElementsByClassName !== strundefined && !documentIsXML ) { |
|
|
return context.getElementsByClassName( className ); |
|
|
} |
|
|
}; |
|
|
|
|
|
// QSA and matchesSelector support |
|
|
|
|
|
// matchesSelector(:active) reports false when true (IE9/Opera 11.5) |
|
|
rbuggyMatches = []; |
|
|
|
|
|
// qSa(:focus) reports false when true (Chrome 21), |
|
|
// no need to also add to buggyMatches since matches checks buggyQSA |
|
|
// A support test would require too much code (would include document ready) |
|
|
rbuggyQSA = [ ":focus" ]; |
|
|
|
|
|
if ( (support.qsa = isNative(doc.querySelectorAll)) ) { |
|
|
// Build QSA regex |
|
|
// Regex strategy adopted from Diego Perini |
|
|
assert(function( div ) { |
|
|
// Select is set to empty string on purpose |
|
|
// This is to test IE's treatment of not explictly |
|
|
// setting a boolean content attribute, |
|
|
// since its presence should be enough |
|
|
// http://bugs.jquery.com/ticket/12359 |
|
|
div.innerHTML = "<select><option selected=''></option></select>"; |
|
|
|
|
|
// IE8 - Some boolean attributes are not treated correctly |
|
|
if ( !div.querySelectorAll("[selected]").length ) { |
|
|
rbuggyQSA.push( "\\[" + whitespace + "*(?:checked|disabled|ismap|multiple|readonly|selected|value)" ); |
|
|
} |
|
|
|
|
|
// Webkit/Opera - :checked should return selected option elements |
|
|
// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked |
|
|
// IE8 throws error here and will not see later tests |
|
|
if ( !div.querySelectorAll(":checked").length ) { |
|
|
rbuggyQSA.push(":checked"); |
|
|
} |
|
|
}); |
|
|
|
|
|
assert(function( div ) { |
|
|
|
|
|
// Opera 10-12/IE8 - ^= $= *= and empty values |
|
|
// Should not select anything |
|
|
div.innerHTML = "<input type='hidden' i=''/>"; |
|
|
if ( div.querySelectorAll("[i^='']").length ) { |
|
|
rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:\"\"|'')" ); |
|
|
} |
|
|
|
|
|
// FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled) |
|
|
// IE8 throws error here and will not see later tests |
|
|
if ( !div.querySelectorAll(":enabled").length ) { |
|
|
rbuggyQSA.push( ":enabled", ":disabled" ); |
|
|
} |
|
|
|
|
|
// Opera 10-11 does not throw on post-comma invalid pseudos |
|
|
div.querySelectorAll("*,:x"); |
|
|
rbuggyQSA.push(",.*:"); |
|
|
}); |
|
|
} |
|
|
|
|
|
if ( (support.matchesSelector = isNative( (matches = docElem.matchesSelector || |
|
|
docElem.mozMatchesSelector || |
|
|
docElem.webkitMatchesSelector || |
|
|
docElem.oMatchesSelector || |
|
|
docElem.msMatchesSelector) )) ) { |
|
|
|
|
|
assert(function( div ) { |
|
|
// Check to see if it's possible to do matchesSelector |
|
|
// on a disconnected node (IE 9) |
|
|
support.disconnectedMatch = matches.call( div, "div" ); |
|
|
|
|
|
// This should fail with an exception |
|
|
// Gecko does not error, returns false instead |
|
|
matches.call( div, "[s!='']:x" ); |
|
|
rbuggyMatches.push( "!=", pseudos ); |
|
|
}); |
|
|
} |
|
|
|
|
|
rbuggyQSA = new RegExp( rbuggyQSA.join("|") ); |
|
|
rbuggyMatches = new RegExp( rbuggyMatches.join("|") ); |
|
|
|
|
|
// Element contains another |
|
|
// Purposefully does not implement inclusive descendent |
|
|
// As in, an element does not contain itself |
|
|
contains = isNative(docElem.contains) || docElem.compareDocumentPosition ? |
|
|
function( a, b ) { |
|
|
var adown = a.nodeType === 9 ? a.documentElement : a, |
|
|
bup = b && b.parentNode; |
|
|
return a === bup || !!( bup && bup.nodeType === 1 && ( |
|
|
adown.contains ? |
|
|
adown.contains( bup ) : |
|
|
a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16 |
|
|
)); |
|
|
} : |
|
|
function( a, b ) { |
|
|
if ( b ) { |
|
|
while ( (b = b.parentNode) ) { |
|
|
if ( b === a ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
} |
|
|
return false; |
|
|
}; |
|
|
|
|
|
// Document order sorting |
|
|
sortOrder = docElem.compareDocumentPosition ? |
|
|
function( a, b ) { |
|
|
var compare; |
|
|
|
|
|
if ( a === b ) { |
|
|
hasDuplicate = true; |
|
|
return 0; |
|
|
} |
|
|
|
|
|
if ( (compare = b.compareDocumentPosition && a.compareDocumentPosition && a.compareDocumentPosition( b )) ) { |
|
|
if ( compare & 1 || a.parentNode && a.parentNode.nodeType === 11 ) { |
|
|
if ( a === doc || contains( preferredDoc, a ) ) { |
|
|
return -1; |
|
|
} |
|
|
if ( b === doc || contains( preferredDoc, b ) ) { |
|
|
return 1; |
|
|
} |
|
|
return 0; |
|
|
} |
|
|
return compare & 4 ? -1 : 1; |
|
|
} |
|
|
|
|
|
return a.compareDocumentPosition ? -1 : 1; |
|
|
} : |
|
|
function( a, b ) { |
|
|
var cur, |
|
|
i = 0, |
|
|
aup = a.parentNode, |
|
|
bup = b.parentNode, |
|
|
ap = [ a ], |
|
|
bp = [ b ]; |
|
|
|
|
|
// Exit early if the nodes are identical |
|
|
if ( a === b ) { |
|
|
hasDuplicate = true; |
|
|
return 0; |
|
|
|
|
|
// Parentless nodes are either documents or disconnected |
|
|
} else if ( !aup || !bup ) { |
|
|
return a === doc ? -1 : |
|
|
b === doc ? 1 : |
|
|
aup ? -1 : |
|
|
bup ? 1 : |
|
|
0; |
|
|
|
|
|
// If the nodes are siblings, we can do a quick check |
|
|
} else if ( aup === bup ) { |
|
|
return siblingCheck( a, b ); |
|
|
} |
|
|
|
|
|
// Otherwise we need full lists of their ancestors for comparison |
|
|
cur = a; |
|
|
while ( (cur = cur.parentNode) ) { |
|
|
ap.unshift( cur ); |
|
|
} |
|
|
cur = b; |
|
|
while ( (cur = cur.parentNode) ) { |
|
|
bp.unshift( cur ); |
|
|
} |
|
|
|
|
|
// Walk down the tree looking for a discrepancy |
|
|
while ( ap[i] === bp[i] ) { |
|
|
i++; |
|
|
} |
|
|
|
|
|
return i ? |
|
|
// Do a sibling check if the nodes have a common ancestor |
|
|
siblingCheck( ap[i], bp[i] ) : |
|
|
|
|
|
// Otherwise nodes in our document sort first |
|
|
ap[i] === preferredDoc ? -1 : |
|
|
bp[i] === preferredDoc ? 1 : |
|
|
0; |
|
|
}; |
|
|
|
|
|
// Always assume the presence of duplicates if sort doesn't |
|
|
// pass them to our comparison function (as in Google Chrome). |
|
|
hasDuplicate = false; |
|
|
[0, 0].sort( sortOrder ); |
|
|
support.detectDuplicates = hasDuplicate; |
|
|
|
|
|
return document; |
|
|
}; |
|
|
|
|
|
Sizzle.matches = function( expr, elements ) { |
|
|
return Sizzle( expr, null, null, elements ); |
|
|
}; |
|
|
|
|
|
Sizzle.matchesSelector = function( elem, expr ) { |
|
|
// Set document vars if needed |
|
|
if ( ( elem.ownerDocument || elem ) !== document ) { |
|
|
setDocument( elem ); |
|
|
} |
|
|
|
|
|
// Make sure that attribute selectors are quoted |
|
|
expr = expr.replace( rattributeQuotes, "='$1']" ); |
|
|
|
|
|
// rbuggyQSA always contains :focus, so no need for an existence check |
|
|
if ( support.matchesSelector && !documentIsXML && (!rbuggyMatches || !rbuggyMatches.test(expr)) && !rbuggyQSA.test(expr) ) { |
|
|
try { |
|
|
var ret = matches.call( elem, expr ); |
|
|
|
|
|
// IE 9's matchesSelector returns false on disconnected nodes |
|
|
if ( ret || support.disconnectedMatch || |
|
|
// As well, disconnected nodes are said to be in a document |
|
|
// fragment in IE 9 |
|
|
elem.document && elem.document.nodeType !== 11 ) { |
|
|
return ret; |
|
|
} |
|
|
} catch(e) {} |
|
|
} |
|
|
|
|
|
return Sizzle( expr, document, null, [elem] ).length > 0; |
|
|
}; |
|
|
|
|
|
Sizzle.contains = function( context, elem ) { |
|
|
// Set document vars if needed |
|
|
if ( ( context.ownerDocument || context ) !== document ) { |
|
|
setDocument( context ); |
|
|
} |
|
|
return contains( context, elem ); |
|
|
}; |
|
|
|
|
|
Sizzle.attr = function( elem, name ) { |
|
|
var val; |
|
|
|
|
|
// Set document vars if needed |
|
|
if ( ( elem.ownerDocument || elem ) !== document ) { |
|
|
setDocument( elem ); |
|
|
} |
|
|
|
|
|
if ( !documentIsXML ) { |
|
|
name = name.toLowerCase(); |
|
|
} |
|
|
if ( (val = Expr.attrHandle[ name ]) ) { |
|
|
return val( elem ); |
|
|
} |
|
|
if ( documentIsXML || support.attributes ) { |
|
|
return elem.getAttribute( name ); |
|
|
} |
|
|
return ( (val = elem.getAttributeNode( name )) || elem.getAttribute( name ) ) && elem[ name ] === true ? |
|
|
name : |
|
|
val && val.specified ? val.value : null; |
|
|
}; |
|
|
|
|
|
Sizzle.error = function( msg ) { |
|
|
throw new Error( "Syntax error, unrecognized expression: " + msg ); |
|
|
}; |
|
|
|
|
|
// Document sorting and removing duplicates |
|
|
Sizzle.uniqueSort = function( results ) { |
|
|
var elem, |
|
|
duplicates = [], |
|
|
i = 1, |
|
|
j = 0; |
|
|
|
|
|
// Unless we *know* we can detect duplicates, assume their presence |
|
|
hasDuplicate = !support.detectDuplicates; |
|
|
results.sort( sortOrder ); |
|
|
|
|
|
if ( hasDuplicate ) { |
|
|
for ( ; (elem = results[i]); i++ ) { |
|
|
if ( elem === results[ i - 1 ] ) { |
|
|
j = duplicates.push( i ); |
|
|
} |
|
|
} |
|
|
while ( j-- ) { |
|
|
results.splice( duplicates[ j ], 1 ); |
|
|
} |
|
|
} |
|
|
|
|
|
return results; |
|
|
}; |
|
|
|
|
|
function siblingCheck( a, b ) { |
|
|
var cur = b && a, |
|
|
diff = cur && ( ~b.sourceIndex || MAX_NEGATIVE ) - ( ~a.sourceIndex || MAX_NEGATIVE ); |
|
|
|
|
|
// Use IE sourceIndex if available on both nodes |
|
|
if ( diff ) { |
|
|
return diff; |
|
|
} |
|
|
|
|
|
// Check if b follows a |
|
|
if ( cur ) { |
|
|
while ( (cur = cur.nextSibling) ) { |
|
|
if ( cur === b ) { |
|
|
return -1; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return a ? 1 : -1; |
|
|
} |
|
|
|
|
|
// Returns a function to use in pseudos for input types |
|
|
function createInputPseudo( type ) { |
|
|
return function( elem ) { |
|
|
var name = elem.nodeName.toLowerCase(); |
|
|
return name === "input" && elem.type === type; |
|
|
}; |
|
|
} |
|
|
|
|
|
// Returns a function to use in pseudos for buttons |
|
|
function createButtonPseudo( type ) { |
|
|
return function( elem ) { |
|
|
var name = elem.nodeName.toLowerCase(); |
|
|
return (name === "input" || name === "button") && elem.type === type; |
|
|
}; |
|
|
} |
|
|
|
|
|
// Returns a function to use in pseudos for positionals |
|
|
function createPositionalPseudo( fn ) { |
|
|
return markFunction(function( argument ) { |
|
|
argument = +argument; |
|
|
return markFunction(function( seed, matches ) { |
|
|
var j, |
|
|
matchIndexes = fn( [], seed.length, argument ), |
|
|
i = matchIndexes.length; |
|
|
|
|
|
// Match elements found at the specified indexes |
|
|
while ( i-- ) { |
|
|
if ( seed[ (j = matchIndexes[i]) ] ) { |
|
|
seed[j] = !(matches[j] = seed[j]); |
|
|
} |
|
|
} |
|
|
}); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Utility function for retrieving the text value of an array of DOM nodes |
|
|
* @param {Array|Element} elem |
|
|
*/ |
|
|
getText = Sizzle.getText = function( elem ) { |
|
|
var node, |
|
|
ret = "", |
|
|
i = 0, |
|
|
nodeType = elem.nodeType; |
|
|
|
|
|
if ( !nodeType ) { |
|
|
// If no nodeType, this is expected to be an array |
|
|
for ( ; (node = elem[i]); i++ ) { |
|
|
// Do not traverse comment nodes |
|
|
ret += getText( node ); |
|
|
} |
|
|
} else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) { |
|
|
// Use textContent for elements |
|
|
// innerText usage removed for consistency of new lines (see #11153) |
|
|
if ( typeof elem.textContent === "string" ) { |
|
|
return elem.textContent; |
|
|
} else { |
|
|
// Traverse its children |
|
|
for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { |
|
|
ret += getText( elem ); |
|
|
} |
|
|
} |
|
|
} else if ( nodeType === 3 || nodeType === 4 ) { |
|
|
return elem.nodeValue; |
|
|
} |
|
|
// Do not include comment or processing instruction nodes |
|
|
|
|
|
return ret; |
|
|
}; |
|
|
|
|
|
Expr = Sizzle.selectors = { |
|
|
|
|
|
// Can be adjusted by the user |
|
|
cacheLength: 50, |
|
|
|
|
|
createPseudo: markFunction, |
|
|
|
|
|
match: matchExpr, |
|
|
|
|
|
find: {}, |
|
|
|
|
|
relative: { |
|
|
">": { dir: "parentNode", first: true }, |
|
|
" ": { dir: "parentNode" }, |
|
|
"+": { dir: "previousSibling", first: true }, |
|
|
"~": { dir: "previousSibling" } |
|
|
}, |
|
|
|
|
|
preFilter: { |
|
|
"ATTR": function( match ) { |
|
|
match[1] = match[1].replace( runescape, funescape ); |
|
|
|
|
|
// Move the given value to match[3] whether quoted or unquoted |
|
|
match[3] = ( match[4] || match[5] || "" ).replace( runescape, funescape ); |
|
|
|
|
|
if ( match[2] === "~=" ) { |
|
|
match[3] = " " + match[3] + " "; |
|
|
} |
|
|
|
|
|
return match.slice( 0, 4 ); |
|
|
}, |
|
|
|
|
|
"CHILD": function( match ) { |
|
|
/* matches from matchExpr["CHILD"] |
|
|
1 type (only|nth|...) |
|
|
2 what (child|of-type) |
|
|
3 argument (even|odd|\d*|\d*n([+-]\d+)?|...) |
|
|
4 xn-component of xn+y argument ([+-]?\d*n|) |
|
|
5 sign of xn-component |
|
|
6 x of xn-component |
|
|
7 sign of y-component |
|
|
8 y of y-component |
|
|
*/ |
|
|
match[1] = match[1].toLowerCase(); |
|
|
|
|
|
if ( match[1].slice( 0, 3 ) === "nth" ) { |
|
|
// nth-* requires argument |
|
|
if ( !match[3] ) { |
|
|
Sizzle.error( match[0] ); |
|
|
} |
|
|
|
|
|
// numeric x and y parameters for Expr.filter.CHILD |
|
|
// remember that false/true cast respectively to 0/1 |
|
|
match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) ); |
|
|
match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" ); |
|
|
|
|
|
// other types prohibit arguments |
|
|
} else if ( match[3] ) { |
|
|
Sizzle.error( match[0] ); |
|
|
} |
|
|
|
|
|
return match; |
|
|
}, |
|
|
|
|
|
"PSEUDO": function( match ) { |
|
|
var excess, |
|
|
unquoted = !match[5] && match[2]; |
|
|
|
|
|
if ( matchExpr["CHILD"].test( match[0] ) ) { |
|
|
return null; |
|
|
} |
|
|
|
|
|
// Accept quoted arguments as-is |
|
|
if ( match[4] ) { |
|
|
match[2] = match[4]; |
|
|
|
|
|
// Strip excess characters from unquoted arguments |
|
|
} else if ( unquoted && rpseudo.test( unquoted ) && |
|
|
// Get excess from tokenize (recursively) |
|
|
(excess = tokenize( unquoted, true )) && |
|
|
// advance to the next closing parenthesis |
|
|
(excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) { |
|
|
|
|
|
// excess is a negative index |
|
|
match[0] = match[0].slice( 0, excess ); |
|
|
match[2] = unquoted.slice( 0, excess ); |
|
|
} |
|
|
|
|
|
// Return only captures needed by the pseudo filter method (type and argument) |
|
|
return match.slice( 0, 3 ); |
|
|
} |
|
|
}, |
|
|
|
|
|
filter: { |
|
|
|
|
|
"TAG": function( nodeName ) { |
|
|
if ( nodeName === "*" ) { |
|
|
return function() { return true; }; |
|
|
} |
|
|
|
|
|
nodeName = nodeName.replace( runescape, funescape ).toLowerCase(); |
|
|
return function( elem ) { |
|
|
return elem.nodeName && elem.nodeName.toLowerCase() === nodeName; |
|
|
}; |
|
|
}, |
|
|
|
|
|
"CLASS": function( className ) { |
|
|
var pattern = classCache[ className + " " ]; |
|
|
|
|
|
return pattern || |
|
|
(pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) && |
|
|
classCache( className, function( elem ) { |
|
|
return pattern.test( elem.className || (typeof elem.getAttribute !== strundefined && elem.getAttribute("class")) || "" ); |
|
|
}); |
|
|
}, |
|
|
|
|
|
"ATTR": function( name, operator, check ) { |
|
|
return function( elem ) { |
|
|
var result = Sizzle.attr( elem, name ); |
|
|
|
|
|
if ( result == null ) { |
|
|
return operator === "!="; |
|
|
} |
|
|
if ( !operator ) { |
|
|
return true; |
|
|
} |
|
|
|
|
|
result += ""; |
|
|
|
|
|
return operator === "=" ? result === check : |
|
|
operator === "!=" ? result !== check : |
|
|
operator === "^=" ? check && result.indexOf( check ) === 0 : |
|
|
operator === "*=" ? check && result.indexOf( check ) > -1 : |
|
|
operator === "$=" ? check && result.slice( -check.length ) === check : |
|
|
operator === "~=" ? ( " " + result + " " ).indexOf( check ) > -1 : |
|
|
operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" : |
|
|
false; |
|
|
}; |
|
|
}, |
|
|
|
|
|
"CHILD": function( type, what, argument, first, last ) { |
|
|
var simple = type.slice( 0, 3 ) !== "nth", |
|
|
forward = type.slice( -4 ) !== "last", |
|
|
ofType = what === "of-type"; |
|
|
|
|
|
return first === 1 && last === 0 ? |
|
|
|
|
|
// Shortcut for :nth-*(n) |
|
|
function( elem ) { |
|
|
return !!elem.parentNode; |
|
|
} : |
|
|
|
|
|
function( elem, context, xml ) { |
|
|
var cache, outerCache, node, diff, nodeIndex, start, |
|
|
dir = simple !== forward ? "nextSibling" : "previousSibling", |
|
|
parent = elem.parentNode, |
|
|
name = ofType && elem.nodeName.toLowerCase(), |
|
|
useCache = !xml && !ofType; |
|
|
|
|
|
if ( parent ) { |
|
|
|
|
|
// :(first|last|only)-(child|of-type) |
|
|
if ( simple ) { |
|
|
while ( dir ) { |
|
|
node = elem; |
|
|
while ( (node = node[ dir ]) ) { |
|
|
if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
// Reverse direction for :only-* (if we haven't yet done so) |
|
|
start = dir = type === "only" && !start && "nextSibling"; |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
start = [ forward ? parent.firstChild : parent.lastChild ]; |
|
|
|
|
|
// non-xml :nth-child(...) stores cache data on `parent` |
|
|
if ( forward && useCache ) { |
|
|
// Seek `elem` from a previously-cached index |
|
|
outerCache = parent[ expando ] || (parent[ expando ] = {}); |
|
|
cache = outerCache[ type ] || []; |
|
|
nodeIndex = cache[0] === dirruns && cache[1]; |
|
|
diff = cache[0] === dirruns && cache[2]; |
|
|
node = nodeIndex && parent.childNodes[ nodeIndex ]; |
|
|
|
|
|
while ( (node = ++nodeIndex && node && node[ dir ] || |
|
|
|
|
|
// Fallback to seeking `elem` from the start |
|
|
(diff = nodeIndex = 0) || start.pop()) ) { |
|
|
|
|
|
// When found, cache indexes on `parent` and break |
|
|
if ( node.nodeType === 1 && ++diff && node === elem ) { |
|
|
outerCache[ type ] = [ dirruns, nodeIndex, diff ]; |
|
|
break; |
|
|
} |
|
|
} |
|
|
|
|
|
// Use previously-cached element index if available |
|
|
} else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) { |
|
|
diff = cache[1]; |
|
|
|
|
|
// xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...) |
|
|
} else { |
|
|
// Use the same loop as above to seek `elem` from the start |
|
|
while ( (node = ++nodeIndex && node && node[ dir ] || |
|
|
(diff = nodeIndex = 0) || start.pop()) ) { |
|
|
|
|
|
if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) { |
|
|
// Cache the index of each encountered element |
|
|
if ( useCache ) { |
|
|
(node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ]; |
|
|
} |
|
|
|
|
|
if ( node === elem ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Incorporate the offset, then check against cycle size |
|
|
diff -= last; |
|
|
return diff === first || ( diff % first === 0 && diff / first >= 0 ); |
|
|
} |
|
|
}; |
|
|
}, |
|
|
|
|
|
"PSEUDO": function( pseudo, argument ) { |
|
|
// pseudo-class names are case-insensitive |
|
|
// http://www.w3.org/TR/selectors/#pseudo-classes |
|
|
// Prioritize by case sensitivity in case custom pseudos are added with uppercase letters |
|
|
// Remember that setFilters inherits from pseudos |
|
|
var args, |
|
|
fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] || |
|
|
Sizzle.error( "unsupported pseudo: " + pseudo ); |
|
|
|
|
|
// The user may use createPseudo to indicate that |
|
|
// arguments are needed to create the filter function |
|
|
// just as Sizzle does |
|
|
if ( fn[ expando ] ) { |
|
|
return fn( argument ); |
|
|
} |
|
|
|
|
|
// But maintain support for old signatures |
|
|
if ( fn.length > 1 ) { |
|
|
args = [ pseudo, pseudo, "", argument ]; |
|
|
return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ? |
|
|
markFunction(function( seed, matches ) { |
|
|
var idx, |
|
|
matched = fn( seed, argument ), |
|
|
i = matched.length; |
|
|
while ( i-- ) { |
|
|
idx = indexOf.call( seed, matched[i] ); |
|
|
seed[ idx ] = !( matches[ idx ] = matched[i] ); |
|
|
} |
|
|
}) : |
|
|
function( elem ) { |
|
|
return fn( elem, 0, args ); |
|
|
}; |
|
|
} |
|
|
|
|
|
return fn; |
|
|
} |
|
|
}, |
|
|
|
|
|
pseudos: { |
|
|
// Potentially complex pseudos |
|
|
"not": markFunction(function( selector ) { |
|
|
// Trim the selector passed to compile |
|
|
// to avoid treating leading and trailing |
|
|
// spaces as combinators |
|
|
var input = [], |
|
|
results = [], |
|
|
matcher = compile( selector.replace( rtrim, "$1" ) ); |
|
|
|
|
|
return matcher[ expando ] ? |
|
|
markFunction(function( seed, matches, context, xml ) { |
|
|
var elem, |
|
|
unmatched = matcher( seed, null, xml, [] ), |
|
|
i = seed.length; |
|
|
|
|
|
// Match elements unmatched by `matcher` |
|
|
while ( i-- ) { |
|
|
if ( (elem = unmatched[i]) ) { |
|
|
seed[i] = !(matches[i] = elem); |
|
|
} |
|
|
} |
|
|
}) : |
|
|
function( elem, context, xml ) { |
|
|
input[0] = elem; |
|
|
matcher( input, null, xml, results ); |
|
|
return !results.pop(); |
|
|
}; |
|
|
}), |
|
|
|
|
|
"has": markFunction(function( selector ) { |
|
|
return function( elem ) { |
|
|
return Sizzle( selector, elem ).length > 0; |
|
|
}; |
|
|
}), |
|
|
|
|
|
"contains": markFunction(function( text ) { |
|
|
return function( elem ) { |
|
|
return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1; |
|
|
}; |
|
|
}), |
|
|
|
|
|
// "Whether an element is represented by a :lang() selector |
|
|
// is based solely on the element's language value |
|
|
// being equal to the identifier C, |
|
|
// or beginning with the identifier C immediately followed by "-". |
|
|
// The matching of C against the element's language value is performed case-insensitively. |
|
|
// The identifier C does not have to be a valid language name." |
|
|
// http://www.w3.org/TR/selectors/#lang-pseudo |
|
|
"lang": markFunction( function( lang ) { |
|
|
// lang value must be a valid identifider |
|
|
if ( !ridentifier.test(lang || "") ) { |
|
|
Sizzle.error( "unsupported lang: " + lang ); |
|
|
} |
|
|
lang = lang.replace( runescape, funescape ).toLowerCase(); |
|
|
return function( elem ) { |
|
|
var elemLang; |
|
|
do { |
|
|
if ( (elemLang = documentIsXML ? |
|
|
elem.getAttribute("xml:lang") || elem.getAttribute("lang") : |
|
|
elem.lang) ) { |
|
|
|
|
|
elemLang = elemLang.toLowerCase(); |
|
|
return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0; |
|
|
} |
|
|
} while ( (elem = elem.parentNode) && elem.nodeType === 1 ); |
|
|
return false; |
|
|
}; |
|
|
}), |
|
|
|
|
|
// Miscellaneous |
|
|
"target": function( elem ) { |
|
|
var hash = window.location && window.location.hash; |
|
|
return hash && hash.slice( 1 ) === elem.id; |
|
|
}, |
|
|
|
|
|
"root": function( elem ) { |
|
|
return elem === docElem; |
|
|
}, |
|
|
|
|
|
"focus": function( elem ) { |
|
|
return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex); |
|
|
}, |
|
|
|
|
|
// Boolean properties |
|
|
"enabled": function( elem ) { |
|
|
return elem.disabled === false; |
|
|
}, |
|
|
|
|
|
"disabled": function( elem ) { |
|
|
return elem.disabled === true; |
|
|
}, |
|
|
|
|
|
"checked": function( elem ) { |
|
|
// In CSS3, :checked should return both checked and selected elements |
|
|
// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked |
|
|
var nodeName = elem.nodeName.toLowerCase(); |
|
|
return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected); |
|
|
}, |
|
|
|
|
|
"selected": function( elem ) { |
|
|
// Accessing this property makes selected-by-default |
|
|
// options in Safari work properly |
|
|
if ( elem.parentNode ) { |
|
|
elem.parentNode.selectedIndex; |
|
|
} |
|
|
|
|
|
return elem.selected === true; |
|
|
}, |
|
|
|
|
|
// Contents |
|
|
"empty": function( elem ) { |
|
|
// http://www.w3.org/TR/selectors/#empty-pseudo |
|
|
// :empty is only affected by element nodes and content nodes(including text(3), cdata(4)), |
|
|
// not comment, processing instructions, or others |
|
|
// Thanks to Diego Perini for the nodeName shortcut |
|
|
// Greater than "@" means alpha characters (specifically not starting with "#" or "?") |
|
|
for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) { |
|
|
if ( elem.nodeName > "@" || elem.nodeType === 3 || elem.nodeType === 4 ) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
"parent": function( elem ) { |
|
|
return !Expr.pseudos["empty"]( elem ); |
|
|
}, |
|
|
|
|
|
// Element/input types |
|
|
"header": function( elem ) { |
|
|
return rheader.test( elem.nodeName ); |
|
|
}, |
|
|
|
|
|
"input": function( elem ) { |
|
|
return rinputs.test( elem.nodeName ); |
|
|
}, |
|
|
|
|
|
"button": function( elem ) { |
|
|
var name = elem.nodeName.toLowerCase(); |
|
|
return name === "input" && elem.type === "button" || name === "button"; |
|
|
}, |
|
|
|
|
|
"text": function( elem ) { |
|
|
var attr; |
|
|
// IE6 and 7 will map elem.type to 'text' for new HTML5 types (search, etc) |
|
|
// use getAttribute instead to test this case |
|
|
return elem.nodeName.toLowerCase() === "input" && |
|
|
elem.type === "text" && |
|
|
( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === elem.type ); |
|
|
}, |
|
|
|
|
|
// Position-in-collection |
|
|
"first": createPositionalPseudo(function() { |
|
|
return [ 0 ]; |
|
|
}), |
|
|
|
|
|
"last": createPositionalPseudo(function( matchIndexes, length ) { |
|
|
return [ length - 1 ]; |
|
|
}), |
|
|
|
|
|
"eq": createPositionalPseudo(function( matchIndexes, length, argument ) { |
|
|
return [ argument < 0 ? argument + length : argument ]; |
|
|
}), |
|
|
|
|
|
"even": createPositionalPseudo(function( matchIndexes, length ) { |
|
|
var i = 0; |
|
|
for ( ; i < length; i += 2 ) { |
|
|
matchIndexes.push( i ); |
|
|
} |
|
|
return matchIndexes; |
|
|
}), |
|
|
|
|
|
"odd": createPositionalPseudo(function( matchIndexes, length ) { |
|
|
var i = 1; |
|
|
for ( ; i < length; i += 2 ) { |
|
|
matchIndexes.push( i ); |
|
|
} |
|
|
return matchIndexes; |
|
|
}), |
|
|
|
|
|
"lt": createPositionalPseudo(function( matchIndexes, length, argument ) { |
|
|
var i = argument < 0 ? argument + length : argument; |
|
|
for ( ; --i >= 0; ) { |
|
|
matchIndexes.push( i ); |
|
|
} |
|
|
return matchIndexes; |
|
|
}), |
|
|
|
|
|
"gt": createPositionalPseudo(function( matchIndexes, length, argument ) { |
|
|
var i = argument < 0 ? argument + length : argument; |
|
|
for ( ; ++i < length; ) { |
|
|
matchIndexes.push( i ); |
|
|
} |
|
|
return matchIndexes; |
|
|
}) |
|
|
} |
|
|
}; |
|
|
|
|
|
// Add button/input type pseudos |
|
|
for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) { |
|
|
Expr.pseudos[ i ] = createInputPseudo( i ); |
|
|
} |
|
|
for ( i in { submit: true, reset: true } ) { |
|
|
Expr.pseudos[ i ] = createButtonPseudo( i ); |
|
|
} |
|
|
|
|
|
function tokenize( selector, parseOnly ) { |
|
|
var matched, match, tokens, type, |
|
|
soFar, groups, preFilters, |
|
|
cached = tokenCache[ selector + " " ]; |
|
|
|
|
|
if ( cached ) { |
|
|
return parseOnly ? 0 : cached.slice( 0 ); |
|
|
} |
|
|
|
|
|
soFar = selector; |
|
|
groups = []; |
|
|
preFilters = Expr.preFilter; |
|
|
|
|
|
while ( soFar ) { |
|
|
|
|
|
// Comma and first run |
|
|
if ( !matched || (match = rcomma.exec( soFar )) ) { |
|
|
if ( match ) { |
|
|
// Don't consume trailing commas as valid |
|
|
soFar = soFar.slice( match[0].length ) || soFar; |
|
|
} |
|
|
groups.push( tokens = [] ); |
|
|
} |
|
|
|
|
|
matched = false; |
|
|
|
|
|
// Combinators |
|
|
if ( (match = rcombinators.exec( soFar )) ) { |
|
|
matched = match.shift(); |
|
|
tokens.push( { |
|
|
value: matched, |
|
|
// Cast descendant combinators to space |
|
|
type: match[0].replace( rtrim, " " ) |
|
|
} ); |
|
|
soFar = soFar.slice( matched.length ); |
|
|
} |
|
|
|
|
|
// Filters |
|
|
for ( type in Expr.filter ) { |
|
|
if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] || |
|
|
(match = preFilters[ type ]( match ))) ) { |
|
|
matched = match.shift(); |
|
|
tokens.push( { |
|
|
value: matched, |
|
|
type: type, |
|
|
matches: match |
|
|
} ); |
|
|
soFar = soFar.slice( matched.length ); |
|
|
} |
|
|
} |
|
|
|
|
|
if ( !matched ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
|
|
|
// Return the length of the invalid excess |
|
|
// if we're just parsing |
|
|
// Otherwise, throw an error or return tokens |
|
|
return parseOnly ? |
|
|
soFar.length : |
|
|
soFar ? |
|
|
Sizzle.error( selector ) : |
|
|
// Cache the tokens |
|
|
tokenCache( selector, groups ).slice( 0 ); |
|
|
} |
|
|
|
|
|
function toSelector( tokens ) { |
|
|
var i = 0, |
|
|
len = tokens.length, |
|
|
selector = ""; |
|
|
for ( ; i < len; i++ ) { |
|
|
selector += tokens[i].value; |
|
|
} |
|
|
return selector; |
|
|
} |
|
|
|
|
|
function addCombinator( matcher, combinator, base ) { |
|
|
var dir = combinator.dir, |
|
|
checkNonElements = base && dir === "parentNode", |
|
|
doneName = done++; |
|
|
|
|
|
return combinator.first ? |
|
|
// Check against closest ancestor/preceding element |
|
|
function( elem, context, xml ) { |
|
|
while ( (elem = elem[ dir ]) ) { |
|
|
if ( elem.nodeType === 1 || checkNonElements ) { |
|
|
return matcher( elem, context, xml ); |
|
|
} |
|
|
} |
|
|
} : |
|
|
|
|
|
// Check against all ancestor/preceding elements |
|
|
function( elem, context, xml ) { |
|
|
var data, cache, outerCache, |
|
|
dirkey = dirruns + " " + doneName; |
|
|
|
|
|
// We can't set arbitrary data on XML nodes, so they don't benefit from dir caching |
|
|
if ( xml ) { |
|
|
while ( (elem = elem[ dir ]) ) { |
|
|
if ( elem.nodeType === 1 || checkNonElements ) { |
|
|
if ( matcher( elem, context, xml ) ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
} |
|
|
} else { |
|
|
while ( (elem = elem[ dir ]) ) { |
|
|
if ( elem.nodeType === 1 || checkNonElements ) { |
|
|
outerCache = elem[ expando ] || (elem[ expando ] = {}); |
|
|
if ( (cache = outerCache[ dir ]) && cache[0] === dirkey ) { |
|
|
if ( (data = cache[1]) === true || data === cachedruns ) { |
|
|
return data === true; |
|
|
} |
|
|
} else { |
|
|
cache = outerCache[ dir ] = [ dirkey ]; |
|
|
cache[1] = matcher( elem, context, xml ) || cachedruns; |
|
|
if ( cache[1] === true ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
function elementMatcher( matchers ) { |
|
|
return matchers.length > 1 ? |
|
|
function( elem, context, xml ) { |
|
|
var i = matchers.length; |
|
|
while ( i-- ) { |
|
|
if ( !matchers[i]( elem, context, xml ) ) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} : |
|
|
matchers[0]; |
|
|
} |
|
|
|
|
|
function condense( unmatched, map, filter, context, xml ) { |
|
|
var elem, |
|
|
newUnmatched = [], |
|
|
i = 0, |
|
|
len = unmatched.length, |
|
|
mapped = map != null; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
if ( (elem = unmatched[i]) ) { |
|
|
if ( !filter || filter( elem, context, xml ) ) { |
|
|
newUnmatched.push( elem ); |
|
|
if ( mapped ) { |
|
|
map.push( i ); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return newUnmatched; |
|
|
} |
|
|
|
|
|
function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) { |
|
|
if ( postFilter && !postFilter[ expando ] ) { |
|
|
postFilter = setMatcher( postFilter ); |
|
|
} |
|
|
if ( postFinder && !postFinder[ expando ] ) { |
|
|
postFinder = setMatcher( postFinder, postSelector ); |
|
|
} |
|
|
return markFunction(function( seed, results, context, xml ) { |
|
|
var temp, i, elem, |
|
|
preMap = [], |
|
|
postMap = [], |
|
|
preexisting = results.length, |
|
|
|
|
|
// Get initial elements from seed or context |
|
|
elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ), |
|
|
|
|
|
// Prefilter to get matcher input, preserving a map for seed-results synchronization |
|
|
matcherIn = preFilter && ( seed || !selector ) ? |
|
|
condense( elems, preMap, preFilter, context, xml ) : |
|
|
elems, |
|
|
|
|
|
matcherOut = matcher ? |
|
|
// If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results, |
|
|
postFinder || ( seed ? preFilter : preexisting || postFilter ) ? |
|
|
|
|
|
// ...intermediate processing is necessary |
|
|
[] : |
|
|
|
|
|
// ...otherwise use results directly |
|
|
results : |
|
|
matcherIn; |
|
|
|
|
|
// Find primary matches |
|
|
if ( matcher ) { |
|
|
matcher( matcherIn, matcherOut, context, xml ); |
|
|
} |
|
|
|
|
|
// Apply postFilter |
|
|
if ( postFilter ) { |
|
|
temp = condense( matcherOut, postMap ); |
|
|
postFilter( temp, [], context, xml ); |
|
|
|
|
|
// Un-match failing elements by moving them back to matcherIn |
|
|
i = temp.length; |
|
|
while ( i-- ) { |
|
|
if ( (elem = temp[i]) ) { |
|
|
matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
if ( seed ) { |
|
|
if ( postFinder || preFilter ) { |
|
|
if ( postFinder ) { |
|
|
// Get the final matcherOut by condensing this intermediate into postFinder contexts |
|
|
temp = []; |
|
|
i = matcherOut.length; |
|
|
while ( i-- ) { |
|
|
if ( (elem = matcherOut[i]) ) { |
|
|
// Restore matcherIn since elem is not yet a final match |
|
|
temp.push( (matcherIn[i] = elem) ); |
|
|
} |
|
|
} |
|
|
postFinder( null, (matcherOut = []), temp, xml ); |
|
|
} |
|
|
|
|
|
// Move matched elements from seed to results to keep them synchronized |
|
|
i = matcherOut.length; |
|
|
while ( i-- ) { |
|
|
if ( (elem = matcherOut[i]) && |
|
|
(temp = postFinder ? indexOf.call( seed, elem ) : preMap[i]) > -1 ) { |
|
|
|
|
|
seed[temp] = !(results[temp] = elem); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Add elements to results, through postFinder if defined |
|
|
} else { |
|
|
matcherOut = condense( |
|
|
matcherOut === results ? |
|
|
matcherOut.splice( preexisting, matcherOut.length ) : |
|
|
matcherOut |
|
|
); |
|
|
if ( postFinder ) { |
|
|
postFinder( null, results, matcherOut, xml ); |
|
|
} else { |
|
|
push.apply( results, matcherOut ); |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
|
|
|
function matcherFromTokens( tokens ) { |
|
|
var checkContext, matcher, j, |
|
|
len = tokens.length, |
|
|
leadingRelative = Expr.relative[ tokens[0].type ], |
|
|
implicitRelative = leadingRelative || Expr.relative[" "], |
|
|
i = leadingRelative ? 1 : 0, |
|
|
|
|
|
// The foundational matcher ensures that elements are reachable from top-level context(s) |
|
|
matchContext = addCombinator( function( elem ) { |
|
|
return elem === checkContext; |
|
|
}, implicitRelative, true ), |
|
|
matchAnyContext = addCombinator( function( elem ) { |
|
|
return indexOf.call( checkContext, elem ) > -1; |
|
|
}, implicitRelative, true ), |
|
|
matchers = [ function( elem, context, xml ) { |
|
|
return ( !leadingRelative && ( xml || context !== outermostContext ) ) || ( |
|
|
(checkContext = context).nodeType ? |
|
|
matchContext( elem, context, xml ) : |
|
|
matchAnyContext( elem, context, xml ) ); |
|
|
} ]; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
if ( (matcher = Expr.relative[ tokens[i].type ]) ) { |
|
|
matchers = [ addCombinator(elementMatcher( matchers ), matcher) ]; |
|
|
} else { |
|
|
matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches ); |
|
|
|
|
|
// Return special upon seeing a positional matcher |
|
|
if ( matcher[ expando ] ) { |
|
|
// Find the next relative operator (if any) for proper handling |
|
|
j = ++i; |
|
|
for ( ; j < len; j++ ) { |
|
|
if ( Expr.relative[ tokens[j].type ] ) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return setMatcher( |
|
|
i > 1 && elementMatcher( matchers ), |
|
|
i > 1 && toSelector( tokens.slice( 0, i - 1 ) ).replace( rtrim, "$1" ), |
|
|
matcher, |
|
|
i < j && matcherFromTokens( tokens.slice( i, j ) ), |
|
|
j < len && matcherFromTokens( (tokens = tokens.slice( j )) ), |
|
|
j < len && toSelector( tokens ) |
|
|
); |
|
|
} |
|
|
matchers.push( matcher ); |
|
|
} |
|
|
} |
|
|
|
|
|
return elementMatcher( matchers ); |
|
|
} |
|
|
|
|
|
function matcherFromGroupMatchers( elementMatchers, setMatchers ) { |
|
|
// A counter to specify which element is currently being matched |
|
|
var matcherCachedRuns = 0, |
|
|
bySet = setMatchers.length > 0, |
|
|
byElement = elementMatchers.length > 0, |
|
|
superMatcher = function( seed, context, xml, results, expandContext ) { |
|
|
var elem, j, matcher, |
|
|
setMatched = [], |
|
|
matchedCount = 0, |
|
|
i = "0", |
|
|
unmatched = seed && [], |
|
|
outermost = expandContext != null, |
|
|
contextBackup = outermostContext, |
|
|
// We must always have either seed elements or context |
|
|
elems = seed || byElement && Expr.find["TAG"]( "*", expandContext && context.parentNode || context ), |
|
|
// Use integer dirruns iff this is the outermost matcher |
|
|
dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1); |
|
|
|
|
|
if ( outermost ) { |
|
|
outermostContext = context !== document && context; |
|
|
cachedruns = matcherCachedRuns; |
|
|
} |
|
|
|
|
|
// Add elements passing elementMatchers directly to results |
|
|
// Keep `i` a string if there are no elements so `matchedCount` will be "00" below |
|
|
for ( ; (elem = elems[i]) != null; i++ ) { |
|
|
if ( byElement && elem ) { |
|
|
j = 0; |
|
|
while ( (matcher = elementMatchers[j++]) ) { |
|
|
if ( matcher( elem, context, xml ) ) { |
|
|
results.push( elem ); |
|
|
break; |
|
|
} |
|
|
} |
|
|
if ( outermost ) { |
|
|
dirruns = dirrunsUnique; |
|
|
cachedruns = ++matcherCachedRuns; |
|
|
} |
|
|
} |
|
|
|
|
|
// Track unmatched elements for set filters |
|
|
if ( bySet ) { |
|
|
// They will have gone through all possible matchers |
|
|
if ( (elem = !matcher && elem) ) { |
|
|
matchedCount--; |
|
|
} |
|
|
|
|
|
// Lengthen the array for every element, matched or not |
|
|
if ( seed ) { |
|
|
unmatched.push( elem ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Apply set filters to unmatched elements |
|
|
matchedCount += i; |
|
|
if ( bySet && i !== matchedCount ) { |
|
|
j = 0; |
|
|
while ( (matcher = setMatchers[j++]) ) { |
|
|
matcher( unmatched, setMatched, context, xml ); |
|
|
} |
|
|
|
|
|
if ( seed ) { |
|
|
// Reintegrate element matches to eliminate the need for sorting |
|
|
if ( matchedCount > 0 ) { |
|
|
while ( i-- ) { |
|
|
if ( !(unmatched[i] || setMatched[i]) ) { |
|
|
setMatched[i] = pop.call( results ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Discard index placeholder values to get only actual matches |
|
|
setMatched = condense( setMatched ); |
|
|
} |
|
|
|
|
|
// Add matches to results |
|
|
push.apply( results, setMatched ); |
|
|
|
|
|
// Seedless set matches succeeding multiple successful matchers stipulate sorting |
|
|
if ( outermost && !seed && setMatched.length > 0 && |
|
|
( matchedCount + setMatchers.length ) > 1 ) { |
|
|
|
|
|
Sizzle.uniqueSort( results ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Override manipulation of globals by nested matchers |
|
|
if ( outermost ) { |
|
|
dirruns = dirrunsUnique; |
|
|
outermostContext = contextBackup; |
|
|
} |
|
|
|
|
|
return unmatched; |
|
|
}; |
|
|
|
|
|
return bySet ? |
|
|
markFunction( superMatcher ) : |
|
|
superMatcher; |
|
|
} |
|
|
|
|
|
compile = Sizzle.compile = function( selector, group /* Internal Use Only */ ) { |
|
|
var i, |
|
|
setMatchers = [], |
|
|
elementMatchers = [], |
|
|
cached = compilerCache[ selector + " " ]; |
|
|
|
|
|
if ( !cached ) { |
|
|
// Generate a function of recursive functions that can be used to check each element |
|
|
if ( !group ) { |
|
|
group = tokenize( selector ); |
|
|
} |
|
|
i = group.length; |
|
|
while ( i-- ) { |
|
|
cached = matcherFromTokens( group[i] ); |
|
|
if ( cached[ expando ] ) { |
|
|
setMatchers.push( cached ); |
|
|
} else { |
|
|
elementMatchers.push( cached ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Cache the compiled function |
|
|
cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) ); |
|
|
} |
|
|
return cached; |
|
|
}; |
|
|
|
|
|
function multipleContexts( selector, contexts, results ) { |
|
|
var i = 0, |
|
|
len = contexts.length; |
|
|
for ( ; i < len; i++ ) { |
|
|
Sizzle( selector, contexts[i], results ); |
|
|
} |
|
|
return results; |
|
|
} |
|
|
|
|
|
function select( selector, context, results, seed ) { |
|
|
var i, tokens, token, type, find, |
|
|
match = tokenize( selector ); |
|
|
|
|
|
if ( !seed ) { |
|
|
// Try to minimize operations if there is only one group |
|
|
if ( match.length === 1 ) { |
|
|
|
|
|
// Take a shortcut and set the context if the root selector is an ID |
|
|
tokens = match[0] = match[0].slice( 0 ); |
|
|
if ( tokens.length > 2 && (token = tokens[0]).type === "ID" && |
|
|
context.nodeType === 9 && !documentIsXML && |
|
|
Expr.relative[ tokens[1].type ] ) { |
|
|
|
|
|
context = Expr.find["ID"]( token.matches[0].replace( runescape, funescape ), context )[0]; |
|
|
if ( !context ) { |
|
|
return results; |
|
|
} |
|
|
|
|
|
selector = selector.slice( tokens.shift().value.length ); |
|
|
} |
|
|
|
|
|
// Fetch a seed set for right-to-left matching |
|
|
i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length; |
|
|
while ( i-- ) { |
|
|
token = tokens[i]; |
|
|
|
|
|
// Abort if we hit a combinator |
|
|
if ( Expr.relative[ (type = token.type) ] ) { |
|
|
break; |
|
|
} |
|
|
if ( (find = Expr.find[ type ]) ) { |
|
|
// Search, expanding context for leading sibling combinators |
|
|
if ( (seed = find( |
|
|
token.matches[0].replace( runescape, funescape ), |
|
|
rsibling.test( tokens[0].type ) && context.parentNode || context |
|
|
)) ) { |
|
|
|
|
|
// If seed is empty or no tokens remain, we can return early |
|
|
tokens.splice( i, 1 ); |
|
|
selector = seed.length && toSelector( tokens ); |
|
|
if ( !selector ) { |
|
|
push.apply( results, slice.call( seed, 0 ) ); |
|
|
return results; |
|
|
} |
|
|
|
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Compile and execute a filtering function |
|
|
// Provide `match` to avoid retokenization if we modified the selector above |
|
|
compile( selector, match )( |
|
|
seed, |
|
|
context, |
|
|
documentIsXML, |
|
|
results, |
|
|
rsibling.test( selector ) |
|
|
); |
|
|
return results; |
|
|
} |
|
|
|
|
|
// Deprecated |
|
|
Expr.pseudos["nth"] = Expr.pseudos["eq"]; |
|
|
|
|
|
// Easy API for creating new setFilters |
|
|
function setFilters() {} |
|
|
Expr.filters = setFilters.prototype = Expr.pseudos; |
|
|
Expr.setFilters = new setFilters(); |
|
|
|
|
|
// Initialize with the default document |
|
|
setDocument(); |
|
|
|
|
|
// Override sizzle attribute retrieval |
|
|
Sizzle.attr = jQuery.attr; |
|
|
jQuery.find = Sizzle; |
|
|
jQuery.expr = Sizzle.selectors; |
|
|
jQuery.expr[":"] = jQuery.expr.pseudos; |
|
|
jQuery.unique = Sizzle.uniqueSort; |
|
|
jQuery.text = Sizzle.getText; |
|
|
jQuery.isXMLDoc = Sizzle.isXML; |
|
|
jQuery.contains = Sizzle.contains; |
|
|
|
|
|
|
|
|
})( window ); |
|
|
var runtil = /Until$/, |
|
|
rparentsprev = /^(?:parents|prev(?:Until|All))/, |
|
|
isSimple = /^.[^:#\[\.,]*$/, |
|
|
rneedsContext = jQuery.expr.match.needsContext, |
|
|
// methods guaranteed to produce a unique set when starting from a unique set |
|
|
guaranteedUnique = { |
|
|
children: true, |
|
|
contents: true, |
|
|
next: true, |
|
|
prev: true |
|
|
}; |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
find: function( selector ) { |
|
|
var i, ret, self, |
|
|
len = this.length; |
|
|
|
|
|
if ( typeof selector !== "string" ) { |
|
|
self = this; |
|
|
return this.pushStack( jQuery( selector ).filter(function() { |
|
|
for ( i = 0; i < len; i++ ) { |
|
|
if ( jQuery.contains( self[ i ], this ) ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
}) ); |
|
|
} |
|
|
|
|
|
ret = []; |
|
|
for ( i = 0; i < len; i++ ) { |
|
|
jQuery.find( selector, this[ i ], ret ); |
|
|
} |
|
|
|
|
|
// Needed because $( selector, context ) becomes $( context ).find( selector ) |
|
|
ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret ); |
|
|
ret.selector = ( this.selector ? this.selector + " " : "" ) + selector; |
|
|
return ret; |
|
|
}, |
|
|
|
|
|
has: function( target ) { |
|
|
var i, |
|
|
targets = jQuery( target, this ), |
|
|
len = targets.length; |
|
|
|
|
|
return this.filter(function() { |
|
|
for ( i = 0; i < len; i++ ) { |
|
|
if ( jQuery.contains( this, targets[i] ) ) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
not: function( selector ) { |
|
|
return this.pushStack( winnow(this, selector, false) ); |
|
|
}, |
|
|
|
|
|
filter: function( selector ) { |
|
|
return this.pushStack( winnow(this, selector, true) ); |
|
|
}, |
|
|
|
|
|
is: function( selector ) { |
|
|
return !!selector && ( |
|
|
typeof selector === "string" ? |
|
|
// If this is a positional/relative selector, check membership in the returned set |
|
|
// so $("p:first").is("p:last") won't return true for a doc with two "p". |
|
|
rneedsContext.test( selector ) ? |
|
|
jQuery( selector, this.context ).index( this[0] ) >= 0 : |
|
|
jQuery.filter( selector, this ).length > 0 : |
|
|
this.filter( selector ).length > 0 ); |
|
|
}, |
|
|
|
|
|
closest: function( selectors, context ) { |
|
|
var cur, |
|
|
i = 0, |
|
|
l = this.length, |
|
|
ret = [], |
|
|
pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ? |
|
|
jQuery( selectors, context || this.context ) : |
|
|
0; |
|
|
|
|
|
for ( ; i < l; i++ ) { |
|
|
cur = this[i]; |
|
|
|
|
|
while ( cur && cur.ownerDocument && cur !== context && cur.nodeType !== 11 ) { |
|
|
if ( pos ? pos.index(cur) > -1 : jQuery.find.matchesSelector(cur, selectors) ) { |
|
|
ret.push( cur ); |
|
|
break; |
|
|
} |
|
|
cur = cur.parentNode; |
|
|
} |
|
|
} |
|
|
|
|
|
return this.pushStack( ret.length > 1 ? jQuery.unique( ret ) : ret ); |
|
|
}, |
|
|
|
|
|
// Determine the position of an element within |
|
|
// the matched set of elements |
|
|
index: function( elem ) { |
|
|
|
|
|
// No argument, return index in parent |
|
|
if ( !elem ) { |
|
|
return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1; |
|
|
} |
|
|
|
|
|
// index in selector |
|
|
if ( typeof elem === "string" ) { |
|
|
return jQuery.inArray( this[0], jQuery( elem ) ); |
|
|
} |
|
|
|
|
|
// Locate the position of the desired element |
|
|
return jQuery.inArray( |
|
|
// If it receives a jQuery object, the first element is used |
|
|
elem.jquery ? elem[0] : elem, this ); |
|
|
}, |
|
|
|
|
|
add: function( selector, context ) { |
|
|
var set = typeof selector === "string" ? |
|
|
jQuery( selector, context ) : |
|
|
jQuery.makeArray( selector && selector.nodeType ? [ selector ] : selector ), |
|
|
all = jQuery.merge( this.get(), set ); |
|
|
|
|
|
return this.pushStack( jQuery.unique(all) ); |
|
|
}, |
|
|
|
|
|
addBack: function( selector ) { |
|
|
return this.add( selector == null ? |
|
|
this.prevObject : this.prevObject.filter(selector) |
|
|
); |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.fn.andSelf = jQuery.fn.addBack; |
|
|
|
|
|
function sibling( cur, dir ) { |
|
|
do { |
|
|
cur = cur[ dir ]; |
|
|
} while ( cur && cur.nodeType !== 1 ); |
|
|
|
|
|
return cur; |
|
|
} |
|
|
|
|
|
jQuery.each({ |
|
|
parent: function( elem ) { |
|
|
var parent = elem.parentNode; |
|
|
return parent && parent.nodeType !== 11 ? parent : null; |
|
|
}, |
|
|
parents: function( elem ) { |
|
|
return jQuery.dir( elem, "parentNode" ); |
|
|
}, |
|
|
parentsUntil: function( elem, i, until ) { |
|
|
return jQuery.dir( elem, "parentNode", until ); |
|
|
}, |
|
|
next: function( elem ) { |
|
|
return sibling( elem, "nextSibling" ); |
|
|
}, |
|
|
prev: function( elem ) { |
|
|
return sibling( elem, "previousSibling" ); |
|
|
}, |
|
|
nextAll: function( elem ) { |
|
|
return jQuery.dir( elem, "nextSibling" ); |
|
|
}, |
|
|
prevAll: function( elem ) { |
|
|
return jQuery.dir( elem, "previousSibling" ); |
|
|
}, |
|
|
nextUntil: function( elem, i, until ) { |
|
|
return jQuery.dir( elem, "nextSibling", until ); |
|
|
}, |
|
|
prevUntil: function( elem, i, until ) { |
|
|
return jQuery.dir( elem, "previousSibling", until ); |
|
|
}, |
|
|
siblings: function( elem ) { |
|
|
return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem ); |
|
|
}, |
|
|
children: function( elem ) { |
|
|
return jQuery.sibling( elem.firstChild ); |
|
|
}, |
|
|
contents: function( elem ) { |
|
|
return jQuery.nodeName( elem, "iframe" ) ? |
|
|
elem.contentDocument || elem.contentWindow.document : |
|
|
jQuery.merge( [], elem.childNodes ); |
|
|
} |
|
|
}, function( name, fn ) { |
|
|
jQuery.fn[ name ] = function( until, selector ) { |
|
|
var ret = jQuery.map( this, fn, until ); |
|
|
|
|
|
if ( !runtil.test( name ) ) { |
|
|
selector = until; |
|
|
} |
|
|
|
|
|
if ( selector && typeof selector === "string" ) { |
|
|
ret = jQuery.filter( selector, ret ); |
|
|
} |
|
|
|
|
|
ret = this.length > 1 && !guaranteedUnique[ name ] ? jQuery.unique( ret ) : ret; |
|
|
|
|
|
if ( this.length > 1 && rparentsprev.test( name ) ) { |
|
|
ret = ret.reverse(); |
|
|
} |
|
|
|
|
|
return this.pushStack( ret ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.extend({ |
|
|
filter: function( expr, elems, not ) { |
|
|
if ( not ) { |
|
|
expr = ":not(" + expr + ")"; |
|
|
} |
|
|
|
|
|
return elems.length === 1 ? |
|
|
jQuery.find.matchesSelector(elems[0], expr) ? [ elems[0] ] : [] : |
|
|
jQuery.find.matches(expr, elems); |
|
|
}, |
|
|
|
|
|
dir: function( elem, dir, until ) { |
|
|
var matched = [], |
|
|
cur = elem[ dir ]; |
|
|
|
|
|
while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) { |
|
|
if ( cur.nodeType === 1 ) { |
|
|
matched.push( cur ); |
|
|
} |
|
|
cur = cur[dir]; |
|
|
} |
|
|
return matched; |
|
|
}, |
|
|
|
|
|
sibling: function( n, elem ) { |
|
|
var r = []; |
|
|
|
|
|
for ( ; n; n = n.nextSibling ) { |
|
|
if ( n.nodeType === 1 && n !== elem ) { |
|
|
r.push( n ); |
|
|
} |
|
|
} |
|
|
|
|
|
return r; |
|
|
} |
|
|
}); |
|
|
|
|
|
// Implement the identical functionality for filter and not |
|
|
function winnow( elements, qualifier, keep ) { |
|
|
|
|
|
// Can't pass null or undefined to indexOf in Firefox 4 |
|
|
// Set to 0 to skip string check |
|
|
qualifier = qualifier || 0; |
|
|
|
|
|
if ( jQuery.isFunction( qualifier ) ) { |
|
|
return jQuery.grep(elements, function( elem, i ) { |
|
|
var retVal = !!qualifier.call( elem, i, elem ); |
|
|
return retVal === keep; |
|
|
}); |
|
|
|
|
|
} else if ( qualifier.nodeType ) { |
|
|
return jQuery.grep(elements, function( elem ) { |
|
|
return ( elem === qualifier ) === keep; |
|
|
}); |
|
|
|
|
|
} else if ( typeof qualifier === "string" ) { |
|
|
var filtered = jQuery.grep(elements, function( elem ) { |
|
|
return elem.nodeType === 1; |
|
|
}); |
|
|
|
|
|
if ( isSimple.test( qualifier ) ) { |
|
|
return jQuery.filter(qualifier, filtered, !keep); |
|
|
} else { |
|
|
qualifier = jQuery.filter( qualifier, filtered ); |
|
|
} |
|
|
} |
|
|
|
|
|
return jQuery.grep(elements, function( elem ) { |
|
|
return ( jQuery.inArray( elem, qualifier ) >= 0 ) === keep; |
|
|
}); |
|
|
} |
|
|
function createSafeFragment( document ) { |
|
|
var list = nodeNames.split( "|" ), |
|
|
safeFrag = document.createDocumentFragment(); |
|
|
|
|
|
if ( safeFrag.createElement ) { |
|
|
while ( list.length ) { |
|
|
safeFrag.createElement( |
|
|
list.pop() |
|
|
); |
|
|
} |
|
|
} |
|
|
return safeFrag; |
|
|
} |
|
|
|
|
|
var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" + |
|
|
"header|hgroup|mark|meter|nav|output|progress|section|summary|time|video", |
|
|
rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g, |
|
|
rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"), |
|
|
rleadingWhitespace = /^\s+/, |
|
|
rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi, |
|
|
rtagName = /<([\w:]+)/, |
|
|
rtbody = /<tbody/i, |
|
|
rhtml = /<|&#?\w+;/, |
|
|
rnoInnerhtml = /<(?:script|style|link)/i, |
|
|
manipulation_rcheckableType = /^(?:checkbox|radio)$/i, |
|
|
// checked="checked" or checked |
|
|
rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i, |
|
|
rscriptType = /^$|\/(?:java|ecma)script/i, |
|
|
rscriptTypeMasked = /^true\/(.*)/, |
|
|
rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g, |
|
|
|
|
|
// We have to close these tags to support XHTML (#13200) |
|
|
wrapMap = { |
|
|
option: [ 1, "<select multiple='multiple'>", "</select>" ], |
|
|
legend: [ 1, "<fieldset>", "</fieldset>" ], |
|
|
area: [ 1, "<map>", "</map>" ], |
|
|
param: [ 1, "<object>", "</object>" ], |
|
|
thead: [ 1, "<table>", "</table>" ], |
|
|
tr: [ 2, "<table><tbody>", "</tbody></table>" ], |
|
|
col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ], |
|
|
td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ], |
|
|
|
|
|
// IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags, |
|
|
// unless wrapped in a div with non-breaking characters in front of it. |
|
|
_default: jQuery.support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>" ] |
|
|
}, |
|
|
safeFragment = createSafeFragment( document ), |
|
|
fragmentDiv = safeFragment.appendChild( document.createElement("div") ); |
|
|
|
|
|
wrapMap.optgroup = wrapMap.option; |
|
|
wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead; |
|
|
wrapMap.th = wrapMap.td; |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
text: function( value ) { |
|
|
return jQuery.access( this, function( value ) { |
|
|
return value === undefined ? |
|
|
jQuery.text( this ) : |
|
|
this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) ); |
|
|
}, null, value, arguments.length ); |
|
|
}, |
|
|
|
|
|
wrapAll: function( html ) { |
|
|
if ( jQuery.isFunction( html ) ) { |
|
|
return this.each(function(i) { |
|
|
jQuery(this).wrapAll( html.call(this, i) ); |
|
|
}); |
|
|
} |
|
|
|
|
|
if ( this[0] ) { |
|
|
// The elements to wrap the target around |
|
|
var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true); |
|
|
|
|
|
if ( this[0].parentNode ) { |
|
|
wrap.insertBefore( this[0] ); |
|
|
} |
|
|
|
|
|
wrap.map(function() { |
|
|
var elem = this; |
|
|
|
|
|
while ( elem.firstChild && elem.firstChild.nodeType === 1 ) { |
|
|
elem = elem.firstChild; |
|
|
} |
|
|
|
|
|
return elem; |
|
|
}).append( this ); |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
wrapInner: function( html ) { |
|
|
if ( jQuery.isFunction( html ) ) { |
|
|
return this.each(function(i) { |
|
|
jQuery(this).wrapInner( html.call(this, i) ); |
|
|
}); |
|
|
} |
|
|
|
|
|
return this.each(function() { |
|
|
var self = jQuery( this ), |
|
|
contents = self.contents(); |
|
|
|
|
|
if ( contents.length ) { |
|
|
contents.wrapAll( html ); |
|
|
|
|
|
} else { |
|
|
self.append( html ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
wrap: function( html ) { |
|
|
var isFunction = jQuery.isFunction( html ); |
|
|
|
|
|
return this.each(function(i) { |
|
|
jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html ); |
|
|
}); |
|
|
}, |
|
|
|
|
|
unwrap: function() { |
|
|
return this.parent().each(function() { |
|
|
if ( !jQuery.nodeName( this, "body" ) ) { |
|
|
jQuery( this ).replaceWith( this.childNodes ); |
|
|
} |
|
|
}).end(); |
|
|
}, |
|
|
|
|
|
append: function() { |
|
|
return this.domManip(arguments, true, function( elem ) { |
|
|
if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { |
|
|
this.appendChild( elem ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
prepend: function() { |
|
|
return this.domManip(arguments, true, function( elem ) { |
|
|
if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) { |
|
|
this.insertBefore( elem, this.firstChild ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
before: function() { |
|
|
return this.domManip( arguments, false, function( elem ) { |
|
|
if ( this.parentNode ) { |
|
|
this.parentNode.insertBefore( elem, this ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
after: function() { |
|
|
return this.domManip( arguments, false, function( elem ) { |
|
|
if ( this.parentNode ) { |
|
|
this.parentNode.insertBefore( elem, this.nextSibling ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
// keepData is for internal use only--do not document |
|
|
remove: function( selector, keepData ) { |
|
|
var elem, |
|
|
i = 0; |
|
|
|
|
|
for ( ; (elem = this[i]) != null; i++ ) { |
|
|
if ( !selector || jQuery.filter( selector, [ elem ] ).length > 0 ) { |
|
|
if ( !keepData && elem.nodeType === 1 ) { |
|
|
jQuery.cleanData( getAll( elem ) ); |
|
|
} |
|
|
|
|
|
if ( elem.parentNode ) { |
|
|
if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) { |
|
|
setGlobalEval( getAll( elem, "script" ) ); |
|
|
} |
|
|
elem.parentNode.removeChild( elem ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
empty: function() { |
|
|
var elem, |
|
|
i = 0; |
|
|
|
|
|
for ( ; (elem = this[i]) != null; i++ ) { |
|
|
// Remove element nodes and prevent memory leaks |
|
|
if ( elem.nodeType === 1 ) { |
|
|
jQuery.cleanData( getAll( elem, false ) ); |
|
|
} |
|
|
|
|
|
// Remove any remaining nodes |
|
|
while ( elem.firstChild ) { |
|
|
elem.removeChild( elem.firstChild ); |
|
|
} |
|
|
|
|
|
// If this is a select, ensure that it displays empty (#12336) |
|
|
// Support: IE<9 |
|
|
if ( elem.options && jQuery.nodeName( elem, "select" ) ) { |
|
|
elem.options.length = 0; |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
clone: function( dataAndEvents, deepDataAndEvents ) { |
|
|
dataAndEvents = dataAndEvents == null ? false : dataAndEvents; |
|
|
deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents; |
|
|
|
|
|
return this.map( function () { |
|
|
return jQuery.clone( this, dataAndEvents, deepDataAndEvents ); |
|
|
}); |
|
|
}, |
|
|
|
|
|
html: function( value ) { |
|
|
return jQuery.access( this, function( value ) { |
|
|
var elem = this[0] || {}, |
|
|
i = 0, |
|
|
l = this.length; |
|
|
|
|
|
if ( value === undefined ) { |
|
|
return elem.nodeType === 1 ? |
|
|
elem.innerHTML.replace( rinlinejQuery, "" ) : |
|
|
undefined; |
|
|
} |
|
|
|
|
|
// See if we can take a shortcut and just use innerHTML |
|
|
if ( typeof value === "string" && !rnoInnerhtml.test( value ) && |
|
|
( jQuery.support.htmlSerialize || !rnoshimcache.test( value ) ) && |
|
|
( jQuery.support.leadingWhitespace || !rleadingWhitespace.test( value ) ) && |
|
|
!wrapMap[ ( rtagName.exec( value ) || ["", ""] )[1].toLowerCase() ] ) { |
|
|
|
|
|
value = value.replace( rxhtmlTag, "<$1></$2>" ); |
|
|
|
|
|
try { |
|
|
for (; i < l; i++ ) { |
|
|
// Remove element nodes and prevent memory leaks |
|
|
elem = this[i] || {}; |
|
|
if ( elem.nodeType === 1 ) { |
|
|
jQuery.cleanData( getAll( elem, false ) ); |
|
|
elem.innerHTML = value; |
|
|
} |
|
|
} |
|
|
|
|
|
elem = 0; |
|
|
|
|
|
// If using innerHTML throws an exception, use the fallback method |
|
|
} catch(e) {} |
|
|
} |
|
|
|
|
|
if ( elem ) { |
|
|
this.empty().append( value ); |
|
|
} |
|
|
}, null, value, arguments.length ); |
|
|
}, |
|
|
|
|
|
replaceWith: function( value ) { |
|
|
var isFunc = jQuery.isFunction( value ); |
|
|
|
|
|
// Make sure that the elements are removed from the DOM before they are inserted |
|
|
// this can help fix replacing a parent with child elements |
|
|
if ( !isFunc && typeof value !== "string" ) { |
|
|
value = jQuery( value ).not( this ).detach(); |
|
|
} |
|
|
|
|
|
return this.domManip( [ value ], true, function( elem ) { |
|
|
var next = this.nextSibling, |
|
|
parent = this.parentNode; |
|
|
|
|
|
if ( parent ) { |
|
|
jQuery( this ).remove(); |
|
|
parent.insertBefore( elem, next ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
detach: function( selector ) { |
|
|
return this.remove( selector, true ); |
|
|
}, |
|
|
|
|
|
domManip: function( args, table, callback ) { |
|
|
|
|
|
// Flatten any nested arrays |
|
|
args = core_concat.apply( [], args ); |
|
|
|
|
|
var first, node, hasScripts, |
|
|
scripts, doc, fragment, |
|
|
i = 0, |
|
|
l = this.length, |
|
|
set = this, |
|
|
iNoClone = l - 1, |
|
|
value = args[0], |
|
|
isFunction = jQuery.isFunction( value ); |
|
|
|
|
|
// We can't cloneNode fragments that contain checked, in WebKit |
|
|
if ( isFunction || !( l <= 1 || typeof value !== "string" || jQuery.support.checkClone || !rchecked.test( value ) ) ) { |
|
|
return this.each(function( index ) { |
|
|
var self = set.eq( index ); |
|
|
if ( isFunction ) { |
|
|
args[0] = value.call( this, index, table ? self.html() : undefined ); |
|
|
} |
|
|
self.domManip( args, table, callback ); |
|
|
}); |
|
|
} |
|
|
|
|
|
if ( l ) { |
|
|
fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, this ); |
|
|
first = fragment.firstChild; |
|
|
|
|
|
if ( fragment.childNodes.length === 1 ) { |
|
|
fragment = first; |
|
|
} |
|
|
|
|
|
if ( first ) { |
|
|
table = table && jQuery.nodeName( first, "tr" ); |
|
|
scripts = jQuery.map( getAll( fragment, "script" ), disableScript ); |
|
|
hasScripts = scripts.length; |
|
|
|
|
|
// Use the original fragment for the last item instead of the first because it can end up |
|
|
// being emptied incorrectly in certain situations (#8070). |
|
|
for ( ; i < l; i++ ) { |
|
|
node = fragment; |
|
|
|
|
|
if ( i !== iNoClone ) { |
|
|
node = jQuery.clone( node, true, true ); |
|
|
|
|
|
// Keep references to cloned scripts for later restoration |
|
|
if ( hasScripts ) { |
|
|
jQuery.merge( scripts, getAll( node, "script" ) ); |
|
|
} |
|
|
} |
|
|
|
|
|
callback.call( |
|
|
table && jQuery.nodeName( this[i], "table" ) ? |
|
|
findOrAppend( this[i], "tbody" ) : |
|
|
this[i], |
|
|
node, |
|
|
i |
|
|
); |
|
|
} |
|
|
|
|
|
if ( hasScripts ) { |
|
|
doc = scripts[ scripts.length - 1 ].ownerDocument; |
|
|
|
|
|
// Reenable scripts |
|
|
jQuery.map( scripts, restoreScript ); |
|
|
|
|
|
// Evaluate executable scripts on first document insertion |
|
|
for ( i = 0; i < hasScripts; i++ ) { |
|
|
node = scripts[ i ]; |
|
|
if ( rscriptType.test( node.type || "" ) && |
|
|
!jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) { |
|
|
|
|
|
if ( node.src ) { |
|
|
// Hope ajax is available... |
|
|
jQuery.ajax({ |
|
|
url: node.src, |
|
|
type: "GET", |
|
|
dataType: "script", |
|
|
async: false, |
|
|
global: false, |
|
|
"throws": true |
|
|
}); |
|
|
} else { |
|
|
jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) ); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Fix #11809: Avoid leaking memory |
|
|
fragment = first = null; |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
} |
|
|
}); |
|
|
|
|
|
function findOrAppend( elem, tag ) { |
|
|
return elem.getElementsByTagName( tag )[0] || elem.appendChild( elem.ownerDocument.createElement( tag ) ); |
|
|
} |
|
|
|
|
|
// Replace/restore the type attribute of script elements for safe DOM manipulation |
|
|
function disableScript( elem ) { |
|
|
var attr = elem.getAttributeNode("type"); |
|
|
elem.type = ( attr && attr.specified ) + "/" + elem.type; |
|
|
return elem; |
|
|
} |
|
|
function restoreScript( elem ) { |
|
|
var match = rscriptTypeMasked.exec( elem.type ); |
|
|
if ( match ) { |
|
|
elem.type = match[1]; |
|
|
} else { |
|
|
elem.removeAttribute("type"); |
|
|
} |
|
|
return elem; |
|
|
} |
|
|
|
|
|
// Mark scripts as having already been evaluated |
|
|
function setGlobalEval( elems, refElements ) { |
|
|
var elem, |
|
|
i = 0; |
|
|
for ( ; (elem = elems[i]) != null; i++ ) { |
|
|
jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) ); |
|
|
} |
|
|
} |
|
|
|
|
|
function cloneCopyEvent( src, dest ) { |
|
|
|
|
|
if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var type, i, l, |
|
|
oldData = jQuery._data( src ), |
|
|
curData = jQuery._data( dest, oldData ), |
|
|
events = oldData.events; |
|
|
|
|
|
if ( events ) { |
|
|
delete curData.handle; |
|
|
curData.events = {}; |
|
|
|
|
|
for ( type in events ) { |
|
|
for ( i = 0, l = events[ type ].length; i < l; i++ ) { |
|
|
jQuery.event.add( dest, type, events[ type ][ i ] ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// make the cloned public data object a copy from the original |
|
|
if ( curData.data ) { |
|
|
curData.data = jQuery.extend( {}, curData.data ); |
|
|
} |
|
|
} |
|
|
|
|
|
function fixCloneNodeIssues( src, dest ) { |
|
|
var nodeName, e, data; |
|
|
|
|
|
// We do not need to do anything for non-Elements |
|
|
if ( dest.nodeType !== 1 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
nodeName = dest.nodeName.toLowerCase(); |
|
|
|
|
|
// IE6-8 copies events bound via attachEvent when using cloneNode. |
|
|
if ( !jQuery.support.noCloneEvent && dest[ jQuery.expando ] ) { |
|
|
data = jQuery._data( dest ); |
|
|
|
|
|
for ( e in data.events ) { |
|
|
jQuery.removeEvent( dest, e, data.handle ); |
|
|
} |
|
|
|
|
|
// Event data gets referenced instead of copied if the expando gets copied too |
|
|
dest.removeAttribute( jQuery.expando ); |
|
|
} |
|
|
|
|
|
// IE blanks contents when cloning scripts, and tries to evaluate newly-set text |
|
|
if ( nodeName === "script" && dest.text !== src.text ) { |
|
|
disableScript( dest ).text = src.text; |
|
|
restoreScript( dest ); |
|
|
|
|
|
// IE6-10 improperly clones children of object elements using classid. |
|
|
// IE10 throws NoModificationAllowedError if parent is null, #12132. |
|
|
} else if ( nodeName === "object" ) { |
|
|
if ( dest.parentNode ) { |
|
|
dest.outerHTML = src.outerHTML; |
|
|
} |
|
|
|
|
|
// This path appears unavoidable for IE9. When cloning an object |
|
|
// element in IE9, the outerHTML strategy above is not sufficient. |
|
|
// If the src has innerHTML and the destination does not, |
|
|
// copy the src.innerHTML into the dest.innerHTML. #10324 |
|
|
if ( jQuery.support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) { |
|
|
dest.innerHTML = src.innerHTML; |
|
|
} |
|
|
|
|
|
} else if ( nodeName === "input" && manipulation_rcheckableType.test( src.type ) ) { |
|
|
// IE6-8 fails to persist the checked state of a cloned checkbox |
|
|
// or radio button. Worse, IE6-7 fail to give the cloned element |
|
|
// a checked appearance if the defaultChecked value isn't also set |
|
|
|
|
|
dest.defaultChecked = dest.checked = src.checked; |
|
|
|
|
|
// IE6-7 get confused and end up setting the value of a cloned |
|
|
// checkbox/radio button to an empty string instead of "on" |
|
|
if ( dest.value !== src.value ) { |
|
|
dest.value = src.value; |
|
|
} |
|
|
|
|
|
// IE6-8 fails to return the selected option to the default selected |
|
|
// state when cloning options |
|
|
} else if ( nodeName === "option" ) { |
|
|
dest.defaultSelected = dest.selected = src.defaultSelected; |
|
|
|
|
|
// IE6-8 fails to set the defaultValue to the correct value when |
|
|
// cloning other types of input fields |
|
|
} else if ( nodeName === "input" || nodeName === "textarea" ) { |
|
|
dest.defaultValue = src.defaultValue; |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.each({ |
|
|
appendTo: "append", |
|
|
prependTo: "prepend", |
|
|
insertBefore: "before", |
|
|
insertAfter: "after", |
|
|
replaceAll: "replaceWith" |
|
|
}, function( name, original ) { |
|
|
jQuery.fn[ name ] = function( selector ) { |
|
|
var elems, |
|
|
i = 0, |
|
|
ret = [], |
|
|
insert = jQuery( selector ), |
|
|
last = insert.length - 1; |
|
|
|
|
|
for ( ; i <= last; i++ ) { |
|
|
elems = i === last ? this : this.clone(true); |
|
|
jQuery( insert[i] )[ original ]( elems ); |
|
|
|
|
|
// Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get() |
|
|
core_push.apply( ret, elems.get() ); |
|
|
} |
|
|
|
|
|
return this.pushStack( ret ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
function getAll( context, tag ) { |
|
|
var elems, elem, |
|
|
i = 0, |
|
|
found = typeof context.getElementsByTagName !== core_strundefined ? context.getElementsByTagName( tag || "*" ) : |
|
|
typeof context.querySelectorAll !== core_strundefined ? context.querySelectorAll( tag || "*" ) : |
|
|
undefined; |
|
|
|
|
|
if ( !found ) { |
|
|
for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) { |
|
|
if ( !tag || jQuery.nodeName( elem, tag ) ) { |
|
|
found.push( elem ); |
|
|
} else { |
|
|
jQuery.merge( found, getAll( elem, tag ) ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return tag === undefined || tag && jQuery.nodeName( context, tag ) ? |
|
|
jQuery.merge( [ context ], found ) : |
|
|
found; |
|
|
} |
|
|
|
|
|
// Used in buildFragment, fixes the defaultChecked property |
|
|
function fixDefaultChecked( elem ) { |
|
|
if ( manipulation_rcheckableType.test( elem.type ) ) { |
|
|
elem.defaultChecked = elem.checked; |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.extend({ |
|
|
clone: function( elem, dataAndEvents, deepDataAndEvents ) { |
|
|
var destElements, node, clone, i, srcElements, |
|
|
inPage = jQuery.contains( elem.ownerDocument, elem ); |
|
|
|
|
|
if ( jQuery.support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) { |
|
|
clone = elem.cloneNode( true ); |
|
|
|
|
|
// IE<=8 does not properly clone detached, unknown element nodes |
|
|
} else { |
|
|
fragmentDiv.innerHTML = elem.outerHTML; |
|
|
fragmentDiv.removeChild( clone = fragmentDiv.firstChild ); |
|
|
} |
|
|
|
|
|
if ( (!jQuery.support.noCloneEvent || !jQuery.support.noCloneChecked) && |
|
|
(elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) { |
|
|
|
|
|
// We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2 |
|
|
destElements = getAll( clone ); |
|
|
srcElements = getAll( elem ); |
|
|
|
|
|
// Fix all IE cloning issues |
|
|
for ( i = 0; (node = srcElements[i]) != null; ++i ) { |
|
|
// Ensure that the destination node is not null; Fixes #9587 |
|
|
if ( destElements[i] ) { |
|
|
fixCloneNodeIssues( node, destElements[i] ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Copy the events from the original to the clone |
|
|
if ( dataAndEvents ) { |
|
|
if ( deepDataAndEvents ) { |
|
|
srcElements = srcElements || getAll( elem ); |
|
|
destElements = destElements || getAll( clone ); |
|
|
|
|
|
for ( i = 0; (node = srcElements[i]) != null; i++ ) { |
|
|
cloneCopyEvent( node, destElements[i] ); |
|
|
} |
|
|
} else { |
|
|
cloneCopyEvent( elem, clone ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Preserve script evaluation history |
|
|
destElements = getAll( clone, "script" ); |
|
|
if ( destElements.length > 0 ) { |
|
|
setGlobalEval( destElements, !inPage && getAll( elem, "script" ) ); |
|
|
} |
|
|
|
|
|
destElements = srcElements = node = null; |
|
|
|
|
|
// Return the cloned set |
|
|
return clone; |
|
|
}, |
|
|
|
|
|
buildFragment: function( elems, context, scripts, selection ) { |
|
|
var j, elem, contains, |
|
|
tmp, tag, tbody, wrap, |
|
|
l = elems.length, |
|
|
|
|
|
// Ensure a safe fragment |
|
|
safe = createSafeFragment( context ), |
|
|
|
|
|
nodes = [], |
|
|
i = 0; |
|
|
|
|
|
for ( ; i < l; i++ ) { |
|
|
elem = elems[ i ]; |
|
|
|
|
|
if ( elem || elem === 0 ) { |
|
|
|
|
|
// Add nodes directly |
|
|
if ( jQuery.type( elem ) === "object" ) { |
|
|
jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem ); |
|
|
|
|
|
// Convert non-html into a text node |
|
|
} else if ( !rhtml.test( elem ) ) { |
|
|
nodes.push( context.createTextNode( elem ) ); |
|
|
|
|
|
// Convert html into DOM nodes |
|
|
} else { |
|
|
tmp = tmp || safe.appendChild( context.createElement("div") ); |
|
|
|
|
|
// Deserialize a standard representation |
|
|
tag = ( rtagName.exec( elem ) || ["", ""] )[1].toLowerCase(); |
|
|
wrap = wrapMap[ tag ] || wrapMap._default; |
|
|
|
|
|
tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2]; |
|
|
|
|
|
// Descend through wrappers to the right content |
|
|
j = wrap[0]; |
|
|
while ( j-- ) { |
|
|
tmp = tmp.lastChild; |
|
|
} |
|
|
|
|
|
// Manually add leading whitespace removed by IE |
|
|
if ( !jQuery.support.leadingWhitespace && rleadingWhitespace.test( elem ) ) { |
|
|
nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) ); |
|
|
} |
|
|
|
|
|
// Remove IE's autoinserted <tbody> from table fragments |
|
|
if ( !jQuery.support.tbody ) { |
|
|
|
|
|
// String was a <table>, *may* have spurious <tbody> |
|
|
elem = tag === "table" && !rtbody.test( elem ) ? |
|
|
tmp.firstChild : |
|
|
|
|
|
// String was a bare <thead> or <tfoot> |
|
|
wrap[1] === "<table>" && !rtbody.test( elem ) ? |
|
|
tmp : |
|
|
0; |
|
|
|
|
|
j = elem && elem.childNodes.length; |
|
|
while ( j-- ) { |
|
|
if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) { |
|
|
elem.removeChild( tbody ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.merge( nodes, tmp.childNodes ); |
|
|
|
|
|
// Fix #12392 for WebKit and IE > 9 |
|
|
tmp.textContent = ""; |
|
|
|
|
|
// Fix #12392 for oldIE |
|
|
while ( tmp.firstChild ) { |
|
|
tmp.removeChild( tmp.firstChild ); |
|
|
} |
|
|
|
|
|
// Remember the top-level container for proper cleanup |
|
|
tmp = safe.lastChild; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Fix #11356: Clear elements from fragment |
|
|
if ( tmp ) { |
|
|
safe.removeChild( tmp ); |
|
|
} |
|
|
|
|
|
// Reset defaultChecked for any radios and checkboxes |
|
|
// about to be appended to the DOM in IE 6/7 (#8060) |
|
|
if ( !jQuery.support.appendChecked ) { |
|
|
jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked ); |
|
|
} |
|
|
|
|
|
i = 0; |
|
|
while ( (elem = nodes[ i++ ]) ) { |
|
|
|
|
|
// #4087 - If origin and destination elements are the same, and this is |
|
|
// that element, do not do anything |
|
|
if ( selection && jQuery.inArray( elem, selection ) !== -1 ) { |
|
|
continue; |
|
|
} |
|
|
|
|
|
contains = jQuery.contains( elem.ownerDocument, elem ); |
|
|
|
|
|
// Append to fragment |
|
|
tmp = getAll( safe.appendChild( elem ), "script" ); |
|
|
|
|
|
// Preserve script evaluation history |
|
|
if ( contains ) { |
|
|
setGlobalEval( tmp ); |
|
|
} |
|
|
|
|
|
// Capture executables |
|
|
if ( scripts ) { |
|
|
j = 0; |
|
|
while ( (elem = tmp[ j++ ]) ) { |
|
|
if ( rscriptType.test( elem.type || "" ) ) { |
|
|
scripts.push( elem ); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
tmp = null; |
|
|
|
|
|
return safe; |
|
|
}, |
|
|
|
|
|
cleanData: function( elems, /* internal */ acceptData ) { |
|
|
var elem, type, id, data, |
|
|
i = 0, |
|
|
internalKey = jQuery.expando, |
|
|
cache = jQuery.cache, |
|
|
deleteExpando = jQuery.support.deleteExpando, |
|
|
special = jQuery.event.special; |
|
|
|
|
|
for ( ; (elem = elems[i]) != null; i++ ) { |
|
|
|
|
|
if ( acceptData || jQuery.acceptData( elem ) ) { |
|
|
|
|
|
id = elem[ internalKey ]; |
|
|
data = id && cache[ id ]; |
|
|
|
|
|
if ( data ) { |
|
|
if ( data.events ) { |
|
|
for ( type in data.events ) { |
|
|
if ( special[ type ] ) { |
|
|
jQuery.event.remove( elem, type ); |
|
|
|
|
|
// This is a shortcut to avoid jQuery.event.remove's overhead |
|
|
} else { |
|
|
jQuery.removeEvent( elem, type, data.handle ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Remove cache only if it was not already removed by jQuery.event.remove |
|
|
if ( cache[ id ] ) { |
|
|
|
|
|
delete cache[ id ]; |
|
|
|
|
|
// IE does not allow us to delete expando properties from nodes, |
|
|
// nor does it have a removeAttribute function on Document nodes; |
|
|
// we must handle all of these cases |
|
|
if ( deleteExpando ) { |
|
|
delete elem[ internalKey ]; |
|
|
|
|
|
} else if ( typeof elem.removeAttribute !== core_strundefined ) { |
|
|
elem.removeAttribute( internalKey ); |
|
|
|
|
|
} else { |
|
|
elem[ internalKey ] = null; |
|
|
} |
|
|
|
|
|
core_deletedIds.push( id ); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
}); |
|
|
var iframe, getStyles, curCSS, |
|
|
ralpha = /alpha\([^)]*\)/i, |
|
|
ropacity = /opacity\s*=\s*([^)]*)/, |
|
|
rposition = /^(top|right|bottom|left)$/, |
|
|
// swappable if display is none or starts with table except "table", "table-cell", or "table-caption" |
|
|
// see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display |
|
|
rdisplayswap = /^(none|table(?!-c[ea]).+)/, |
|
|
rmargin = /^margin/, |
|
|
rnumsplit = new RegExp( "^(" + core_pnum + ")(.*)$", "i" ), |
|
|
rnumnonpx = new RegExp( "^(" + core_pnum + ")(?!px)[a-z%]+$", "i" ), |
|
|
rrelNum = new RegExp( "^([+-])=(" + core_pnum + ")", "i" ), |
|
|
elemdisplay = { BODY: "block" }, |
|
|
|
|
|
cssShow = { position: "absolute", visibility: "hidden", display: "block" }, |
|
|
cssNormalTransform = { |
|
|
letterSpacing: 0, |
|
|
fontWeight: 400 |
|
|
}, |
|
|
|
|
|
cssExpand = [ "Top", "Right", "Bottom", "Left" ], |
|
|
cssPrefixes = [ "Webkit", "O", "Moz", "ms" ]; |
|
|
|
|
|
// return a css property mapped to a potentially vendor prefixed property |
|
|
function vendorPropName( style, name ) { |
|
|
|
|
|
// shortcut for names that are not vendor prefixed |
|
|
if ( name in style ) { |
|
|
return name; |
|
|
} |
|
|
|
|
|
// check for vendor prefixed names |
|
|
var capName = name.charAt(0).toUpperCase() + name.slice(1), |
|
|
origName = name, |
|
|
i = cssPrefixes.length; |
|
|
|
|
|
while ( i-- ) { |
|
|
name = cssPrefixes[ i ] + capName; |
|
|
if ( name in style ) { |
|
|
return name; |
|
|
} |
|
|
} |
|
|
|
|
|
return origName; |
|
|
} |
|
|
|
|
|
function isHidden( elem, el ) { |
|
|
// isHidden might be called from jQuery#filter function; |
|
|
// in that case, element will be second argument |
|
|
elem = el || elem; |
|
|
return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem ); |
|
|
} |
|
|
|
|
|
function showHide( elements, show ) { |
|
|
var display, elem, hidden, |
|
|
values = [], |
|
|
index = 0, |
|
|
length = elements.length; |
|
|
|
|
|
for ( ; index < length; index++ ) { |
|
|
elem = elements[ index ]; |
|
|
if ( !elem.style ) { |
|
|
continue; |
|
|
} |
|
|
|
|
|
values[ index ] = jQuery._data( elem, "olddisplay" ); |
|
|
display = elem.style.display; |
|
|
if ( show ) { |
|
|
// Reset the inline display of this element to learn if it is |
|
|
// being hidden by cascaded rules or not |
|
|
if ( !values[ index ] && display === "none" ) { |
|
|
elem.style.display = ""; |
|
|
} |
|
|
|
|
|
// Set elements which have been overridden with display: none |
|
|
// in a stylesheet to whatever the default browser style is |
|
|
// for such an element |
|
|
if ( elem.style.display === "" && isHidden( elem ) ) { |
|
|
values[ index ] = jQuery._data( elem, "olddisplay", css_defaultDisplay(elem.nodeName) ); |
|
|
} |
|
|
} else { |
|
|
|
|
|
if ( !values[ index ] ) { |
|
|
hidden = isHidden( elem ); |
|
|
|
|
|
if ( display && display !== "none" || !hidden ) { |
|
|
jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) ); |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Set the display of most of the elements in a second loop |
|
|
// to avoid the constant reflow |
|
|
for ( index = 0; index < length; index++ ) { |
|
|
elem = elements[ index ]; |
|
|
if ( !elem.style ) { |
|
|
continue; |
|
|
} |
|
|
if ( !show || elem.style.display === "none" || elem.style.display === "" ) { |
|
|
elem.style.display = show ? values[ index ] || "" : "none"; |
|
|
} |
|
|
} |
|
|
|
|
|
return elements; |
|
|
} |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
css: function( name, value ) { |
|
|
return jQuery.access( this, function( elem, name, value ) { |
|
|
var len, styles, |
|
|
map = {}, |
|
|
i = 0; |
|
|
|
|
|
if ( jQuery.isArray( name ) ) { |
|
|
styles = getStyles( elem ); |
|
|
len = name.length; |
|
|
|
|
|
for ( ; i < len; i++ ) { |
|
|
map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles ); |
|
|
} |
|
|
|
|
|
return map; |
|
|
} |
|
|
|
|
|
return value !== undefined ? |
|
|
jQuery.style( elem, name, value ) : |
|
|
jQuery.css( elem, name ); |
|
|
}, name, value, arguments.length > 1 ); |
|
|
}, |
|
|
show: function() { |
|
|
return showHide( this, true ); |
|
|
}, |
|
|
hide: function() { |
|
|
return showHide( this ); |
|
|
}, |
|
|
toggle: function( state ) { |
|
|
var bool = typeof state === "boolean"; |
|
|
|
|
|
return this.each(function() { |
|
|
if ( bool ? state : isHidden( this ) ) { |
|
|
jQuery( this ).show(); |
|
|
} else { |
|
|
jQuery( this ).hide(); |
|
|
} |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
jQuery.extend({ |
|
|
// Add in style property hooks for overriding the default |
|
|
// behavior of getting and setting a style property |
|
|
cssHooks: { |
|
|
opacity: { |
|
|
get: function( elem, computed ) { |
|
|
if ( computed ) { |
|
|
// We should always get a number back from opacity |
|
|
var ret = curCSS( elem, "opacity" ); |
|
|
return ret === "" ? "1" : ret; |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
// Exclude the following css properties to add px |
|
|
cssNumber: { |
|
|
"columnCount": true, |
|
|
"fillOpacity": true, |
|
|
"fontWeight": true, |
|
|
"lineHeight": true, |
|
|
"opacity": true, |
|
|
"orphans": true, |
|
|
"widows": true, |
|
|
"zIndex": true, |
|
|
"zoom": true |
|
|
}, |
|
|
|
|
|
// Add in properties whose names you wish to fix before |
|
|
// setting or getting the value |
|
|
cssProps: { |
|
|
// normalize float css property |
|
|
"float": jQuery.support.cssFloat ? "cssFloat" : "styleFloat" |
|
|
}, |
|
|
|
|
|
// Get and set the style property on a DOM Node |
|
|
style: function( elem, name, value, extra ) { |
|
|
// Don't set styles on text and comment nodes |
|
|
if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// Make sure that we're working with the right name |
|
|
var ret, type, hooks, |
|
|
origName = jQuery.camelCase( name ), |
|
|
style = elem.style; |
|
|
|
|
|
name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) ); |
|
|
|
|
|
// gets hook for the prefixed version |
|
|
// followed by the unprefixed version |
|
|
hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; |
|
|
|
|
|
// Check if we're setting a value |
|
|
if ( value !== undefined ) { |
|
|
type = typeof value; |
|
|
|
|
|
// convert relative number strings (+= or -=) to relative numbers. #7345 |
|
|
if ( type === "string" && (ret = rrelNum.exec( value )) ) { |
|
|
value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) ); |
|
|
// Fixes bug #9237 |
|
|
type = "number"; |
|
|
} |
|
|
|
|
|
// Make sure that NaN and null values aren't set. See: #7116 |
|
|
if ( value == null || type === "number" && isNaN( value ) ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// If a number was passed in, add 'px' to the (except for certain CSS properties) |
|
|
if ( type === "number" && !jQuery.cssNumber[ origName ] ) { |
|
|
value += "px"; |
|
|
} |
|
|
|
|
|
// Fixes #8908, it can be done more correctly by specifing setters in cssHooks, |
|
|
// but it would mean to define eight (for every problematic property) identical functions |
|
|
if ( !jQuery.support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) { |
|
|
style[ name ] = "inherit"; |
|
|
} |
|
|
|
|
|
// If a hook was provided, use that value, otherwise just set the specified value |
|
|
if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) { |
|
|
|
|
|
// Wrapped to prevent IE from throwing errors when 'invalid' values are provided |
|
|
// Fixes bug #5509 |
|
|
try { |
|
|
style[ name ] = value; |
|
|
} catch(e) {} |
|
|
} |
|
|
|
|
|
} else { |
|
|
// If a hook was provided get the non-computed value from there |
|
|
if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) { |
|
|
return ret; |
|
|
} |
|
|
|
|
|
// Otherwise just get the value from the style object |
|
|
return style[ name ]; |
|
|
} |
|
|
}, |
|
|
|
|
|
css: function( elem, name, extra, styles ) { |
|
|
var num, val, hooks, |
|
|
origName = jQuery.camelCase( name ); |
|
|
|
|
|
// Make sure that we're working with the right name |
|
|
name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) ); |
|
|
|
|
|
// gets hook for the prefixed version |
|
|
// followed by the unprefixed version |
|
|
hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ]; |
|
|
|
|
|
// If a hook was provided get the computed value from there |
|
|
if ( hooks && "get" in hooks ) { |
|
|
val = hooks.get( elem, true, extra ); |
|
|
} |
|
|
|
|
|
// Otherwise, if a way to get the computed value exists, use that |
|
|
if ( val === undefined ) { |
|
|
val = curCSS( elem, name, styles ); |
|
|
} |
|
|
|
|
|
//convert "normal" to computed value |
|
|
if ( val === "normal" && name in cssNormalTransform ) { |
|
|
val = cssNormalTransform[ name ]; |
|
|
} |
|
|
|
|
|
// Return, converting to number if forced or a qualifier was provided and val looks numeric |
|
|
if ( extra === "" || extra ) { |
|
|
num = parseFloat( val ); |
|
|
return extra === true || jQuery.isNumeric( num ) ? num || 0 : val; |
|
|
} |
|
|
return val; |
|
|
}, |
|
|
|
|
|
// A method for quickly swapping in/out CSS properties to get correct calculations |
|
|
swap: function( elem, options, callback, args ) { |
|
|
var ret, name, |
|
|
old = {}; |
|
|
|
|
|
// Remember the old values, and insert the new ones |
|
|
for ( name in options ) { |
|
|
old[ name ] = elem.style[ name ]; |
|
|
elem.style[ name ] = options[ name ]; |
|
|
} |
|
|
|
|
|
ret = callback.apply( elem, args || [] ); |
|
|
|
|
|
// Revert the old values |
|
|
for ( name in options ) { |
|
|
elem.style[ name ] = old[ name ]; |
|
|
} |
|
|
|
|
|
return ret; |
|
|
} |
|
|
}); |
|
|
|
|
|
// NOTE: we've included the "window" in window.getComputedStyle |
|
|
// because jsdom on node.js will break without it. |
|
|
if ( window.getComputedStyle ) { |
|
|
getStyles = function( elem ) { |
|
|
return window.getComputedStyle( elem, null ); |
|
|
}; |
|
|
|
|
|
curCSS = function( elem, name, _computed ) { |
|
|
var width, minWidth, maxWidth, |
|
|
computed = _computed || getStyles( elem ), |
|
|
|
|
|
// getPropertyValue is only needed for .css('filter') in IE9, see #12537 |
|
|
ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined, |
|
|
style = elem.style; |
|
|
|
|
|
if ( computed ) { |
|
|
|
|
|
if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) { |
|
|
ret = jQuery.style( elem, name ); |
|
|
} |
|
|
|
|
|
// A tribute to the "awesome hack by Dean Edwards" |
|
|
// Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right |
|
|
// Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels |
|
|
// this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values |
|
|
if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) { |
|
|
|
|
|
// Remember the original values |
|
|
width = style.width; |
|
|
minWidth = style.minWidth; |
|
|
maxWidth = style.maxWidth; |
|
|
|
|
|
// Put in the new values to get a computed value out |
|
|
style.minWidth = style.maxWidth = style.width = ret; |
|
|
ret = computed.width; |
|
|
|
|
|
// Revert the changed values |
|
|
style.width = width; |
|
|
style.minWidth = minWidth; |
|
|
style.maxWidth = maxWidth; |
|
|
} |
|
|
} |
|
|
|
|
|
return ret; |
|
|
}; |
|
|
} else if ( document.documentElement.currentStyle ) { |
|
|
getStyles = function( elem ) { |
|
|
return elem.currentStyle; |
|
|
}; |
|
|
|
|
|
curCSS = function( elem, name, _computed ) { |
|
|
var left, rs, rsLeft, |
|
|
computed = _computed || getStyles( elem ), |
|
|
ret = computed ? computed[ name ] : undefined, |
|
|
style = elem.style; |
|
|
|
|
|
// Avoid setting ret to empty string here |
|
|
// so we don't default to auto |
|
|
if ( ret == null && style && style[ name ] ) { |
|
|
ret = style[ name ]; |
|
|
} |
|
|
|
|
|
// From the awesome hack by Dean Edwards |
|
|
// http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291 |
|
|
|
|
|
// If we're not dealing with a regular pixel number |
|
|
// but a number that has a weird ending, we need to convert it to pixels |
|
|
// but not position css attributes, as those are proportional to the parent element instead |
|
|
// and we can't measure the parent instead because it might trigger a "stacking dolls" problem |
|
|
if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) { |
|
|
|
|
|
// Remember the original values |
|
|
left = style.left; |
|
|
rs = elem.runtimeStyle; |
|
|
rsLeft = rs && rs.left; |
|
|
|
|
|
// Put in the new values to get a computed value out |
|
|
if ( rsLeft ) { |
|
|
rs.left = elem.currentStyle.left; |
|
|
} |
|
|
style.left = name === "fontSize" ? "1em" : ret; |
|
|
ret = style.pixelLeft + "px"; |
|
|
|
|
|
// Revert the changed values |
|
|
style.left = left; |
|
|
if ( rsLeft ) { |
|
|
rs.left = rsLeft; |
|
|
} |
|
|
} |
|
|
|
|
|
return ret === "" ? "auto" : ret; |
|
|
}; |
|
|
} |
|
|
|
|
|
function setPositiveNumber( elem, value, subtract ) { |
|
|
var matches = rnumsplit.exec( value ); |
|
|
return matches ? |
|
|
// Guard against undefined "subtract", e.g., when used as in cssHooks |
|
|
Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) : |
|
|
value; |
|
|
} |
|
|
|
|
|
function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) { |
|
|
var i = extra === ( isBorderBox ? "border" : "content" ) ? |
|
|
// If we already have the right measurement, avoid augmentation |
|
|
4 : |
|
|
// Otherwise initialize for horizontal or vertical properties |
|
|
name === "width" ? 1 : 0, |
|
|
|
|
|
val = 0; |
|
|
|
|
|
for ( ; i < 4; i += 2 ) { |
|
|
// both box models exclude margin, so add it if we want it |
|
|
if ( extra === "margin" ) { |
|
|
val += jQuery.css( elem, extra + cssExpand[ i ], true, styles ); |
|
|
} |
|
|
|
|
|
if ( isBorderBox ) { |
|
|
// border-box includes padding, so remove it if we want content |
|
|
if ( extra === "content" ) { |
|
|
val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); |
|
|
} |
|
|
|
|
|
// at this point, extra isn't border nor margin, so remove border |
|
|
if ( extra !== "margin" ) { |
|
|
val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); |
|
|
} |
|
|
} else { |
|
|
// at this point, extra isn't content, so add padding |
|
|
val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles ); |
|
|
|
|
|
// at this point, extra isn't content nor padding, so add border |
|
|
if ( extra !== "padding" ) { |
|
|
val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return val; |
|
|
} |
|
|
|
|
|
function getWidthOrHeight( elem, name, extra ) { |
|
|
|
|
|
// Start with offset property, which is equivalent to the border-box value |
|
|
var valueIsBorderBox = true, |
|
|
val = name === "width" ? elem.offsetWidth : elem.offsetHeight, |
|
|
styles = getStyles( elem ), |
|
|
isBorderBox = jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box"; |
|
|
|
|
|
// some non-html elements return undefined for offsetWidth, so check for null/undefined |
|
|
// svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285 |
|
|
// MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668 |
|
|
if ( val <= 0 || val == null ) { |
|
|
// Fall back to computed then uncomputed css if necessary |
|
|
val = curCSS( elem, name, styles ); |
|
|
if ( val < 0 || val == null ) { |
|
|
val = elem.style[ name ]; |
|
|
} |
|
|
|
|
|
// Computed unit is not pixels. Stop here and return. |
|
|
if ( rnumnonpx.test(val) ) { |
|
|
return val; |
|
|
} |
|
|
|
|
|
// we need the check for style in case a browser which returns unreliable values |
|
|
// for getComputedStyle silently falls back to the reliable elem.style |
|
|
valueIsBorderBox = isBorderBox && ( jQuery.support.boxSizingReliable || val === elem.style[ name ] ); |
|
|
|
|
|
// Normalize "", auto, and prepare for extra |
|
|
val = parseFloat( val ) || 0; |
|
|
} |
|
|
|
|
|
// use the active box-sizing model to add/subtract irrelevant styles |
|
|
return ( val + |
|
|
augmentWidthOrHeight( |
|
|
elem, |
|
|
name, |
|
|
extra || ( isBorderBox ? "border" : "content" ), |
|
|
valueIsBorderBox, |
|
|
styles |
|
|
) |
|
|
) + "px"; |
|
|
} |
|
|
|
|
|
// Try to determine the default display value of an element |
|
|
function css_defaultDisplay( nodeName ) { |
|
|
var doc = document, |
|
|
display = elemdisplay[ nodeName ]; |
|
|
|
|
|
if ( !display ) { |
|
|
display = actualDisplay( nodeName, doc ); |
|
|
|
|
|
// If the simple way fails, read from inside an iframe |
|
|
if ( display === "none" || !display ) { |
|
|
// Use the already-created iframe if possible |
|
|
iframe = ( iframe || |
|
|
jQuery("<iframe frameborder='0' width='0' height='0'/>") |
|
|
.css( "cssText", "display:block !important" ) |
|
|
).appendTo( doc.documentElement ); |
|
|
|
|
|
// Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse |
|
|
doc = ( iframe[0].contentWindow || iframe[0].contentDocument ).document; |
|
|
doc.write("<!doctype html><html><body>"); |
|
|
doc.close(); |
|
|
|
|
|
display = actualDisplay( nodeName, doc ); |
|
|
iframe.detach(); |
|
|
} |
|
|
|
|
|
// Store the correct default display |
|
|
elemdisplay[ nodeName ] = display; |
|
|
} |
|
|
|
|
|
return display; |
|
|
} |
|
|
|
|
|
// Called ONLY from within css_defaultDisplay |
|
|
function actualDisplay( name, doc ) { |
|
|
var elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ), |
|
|
display = jQuery.css( elem[0], "display" ); |
|
|
elem.remove(); |
|
|
return display; |
|
|
} |
|
|
|
|
|
jQuery.each([ "height", "width" ], function( i, name ) { |
|
|
jQuery.cssHooks[ name ] = { |
|
|
get: function( elem, computed, extra ) { |
|
|
if ( computed ) { |
|
|
// certain elements can have dimension info if we invisibly show them |
|
|
// however, it must have a current display style that would benefit from this |
|
|
return elem.offsetWidth === 0 && rdisplayswap.test( jQuery.css( elem, "display" ) ) ? |
|
|
jQuery.swap( elem, cssShow, function() { |
|
|
return getWidthOrHeight( elem, name, extra ); |
|
|
}) : |
|
|
getWidthOrHeight( elem, name, extra ); |
|
|
} |
|
|
}, |
|
|
|
|
|
set: function( elem, value, extra ) { |
|
|
var styles = extra && getStyles( elem ); |
|
|
return setPositiveNumber( elem, value, extra ? |
|
|
augmentWidthOrHeight( |
|
|
elem, |
|
|
name, |
|
|
extra, |
|
|
jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box", |
|
|
styles |
|
|
) : 0 |
|
|
); |
|
|
} |
|
|
}; |
|
|
}); |
|
|
|
|
|
if ( !jQuery.support.opacity ) { |
|
|
jQuery.cssHooks.opacity = { |
|
|
get: function( elem, computed ) { |
|
|
// IE uses filters for opacity |
|
|
return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ? |
|
|
( 0.01 * parseFloat( RegExp.$1 ) ) + "" : |
|
|
computed ? "1" : ""; |
|
|
}, |
|
|
|
|
|
set: function( elem, value ) { |
|
|
var style = elem.style, |
|
|
currentStyle = elem.currentStyle, |
|
|
opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "", |
|
|
filter = currentStyle && currentStyle.filter || style.filter || ""; |
|
|
|
|
|
// IE has trouble with opacity if it does not have layout |
|
|
// Force it by setting the zoom level |
|
|
style.zoom = 1; |
|
|
|
|
|
// if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652 |
|
|
// if value === "", then remove inline opacity #12685 |
|
|
if ( ( value >= 1 || value === "" ) && |
|
|
jQuery.trim( filter.replace( ralpha, "" ) ) === "" && |
|
|
style.removeAttribute ) { |
|
|
|
|
|
// Setting style.filter to null, "" & " " still leave "filter:" in the cssText |
|
|
// if "filter:" is present at all, clearType is disabled, we want to avoid this |
|
|
// style.removeAttribute is IE Only, but so apparently is this code path... |
|
|
style.removeAttribute( "filter" ); |
|
|
|
|
|
// if there is no filter style applied in a css rule or unset inline opacity, we are done |
|
|
if ( value === "" || currentStyle && !currentStyle.filter ) { |
|
|
return; |
|
|
} |
|
|
} |
|
|
|
|
|
// otherwise, set new filter values |
|
|
style.filter = ralpha.test( filter ) ? |
|
|
filter.replace( ralpha, opacity ) : |
|
|
filter + " " + opacity; |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// These hooks cannot be added until DOM ready because the support test |
|
|
// for it is not run until after DOM ready |
|
|
jQuery(function() { |
|
|
if ( !jQuery.support.reliableMarginRight ) { |
|
|
jQuery.cssHooks.marginRight = { |
|
|
get: function( elem, computed ) { |
|
|
if ( computed ) { |
|
|
// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right |
|
|
// Work around by temporarily setting element display to inline-block |
|
|
return jQuery.swap( elem, { "display": "inline-block" }, |
|
|
curCSS, [ elem, "marginRight" ] ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084 |
|
|
// getComputedStyle returns percent when specified for top/left/bottom/right |
|
|
// rather than make the css module depend on the offset module, we just check for it here |
|
|
if ( !jQuery.support.pixelPosition && jQuery.fn.position ) { |
|
|
jQuery.each( [ "top", "left" ], function( i, prop ) { |
|
|
jQuery.cssHooks[ prop ] = { |
|
|
get: function( elem, computed ) { |
|
|
if ( computed ) { |
|
|
computed = curCSS( elem, prop ); |
|
|
// if curCSS returns percentage, fallback to offset |
|
|
return rnumnonpx.test( computed ) ? |
|
|
jQuery( elem ).position()[ prop ] + "px" : |
|
|
computed; |
|
|
} |
|
|
} |
|
|
}; |
|
|
}); |
|
|
} |
|
|
|
|
|
}); |
|
|
|
|
|
if ( jQuery.expr && jQuery.expr.filters ) { |
|
|
jQuery.expr.filters.hidden = function( elem ) { |
|
|
// Support: Opera <= 12.12 |
|
|
// Opera reports offsetWidths and offsetHeights less than zero on some elements |
|
|
return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 || |
|
|
(!jQuery.support.reliableHiddenOffsets && ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none"); |
|
|
}; |
|
|
|
|
|
jQuery.expr.filters.visible = function( elem ) { |
|
|
return !jQuery.expr.filters.hidden( elem ); |
|
|
}; |
|
|
} |
|
|
|
|
|
// These hooks are used by animate to expand properties |
|
|
jQuery.each({ |
|
|
margin: "", |
|
|
padding: "", |
|
|
border: "Width" |
|
|
}, function( prefix, suffix ) { |
|
|
jQuery.cssHooks[ prefix + suffix ] = { |
|
|
expand: function( value ) { |
|
|
var i = 0, |
|
|
expanded = {}, |
|
|
|
|
|
// assumes a single number if not a string |
|
|
parts = typeof value === "string" ? value.split(" ") : [ value ]; |
|
|
|
|
|
for ( ; i < 4; i++ ) { |
|
|
expanded[ prefix + cssExpand[ i ] + suffix ] = |
|
|
parts[ i ] || parts[ i - 2 ] || parts[ 0 ]; |
|
|
} |
|
|
|
|
|
return expanded; |
|
|
} |
|
|
}; |
|
|
|
|
|
if ( !rmargin.test( prefix ) ) { |
|
|
jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber; |
|
|
} |
|
|
}); |
|
|
var r20 = /%20/g, |
|
|
rbracket = /\[\]$/, |
|
|
rCRLF = /\r?\n/g, |
|
|
rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i, |
|
|
rsubmittable = /^(?:input|select|textarea|keygen)/i; |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
serialize: function() { |
|
|
return jQuery.param( this.serializeArray() ); |
|
|
}, |
|
|
serializeArray: function() { |
|
|
return this.map(function(){ |
|
|
// Can add propHook for "elements" to filter or add form elements |
|
|
var elements = jQuery.prop( this, "elements" ); |
|
|
return elements ? jQuery.makeArray( elements ) : this; |
|
|
}) |
|
|
.filter(function(){ |
|
|
var type = this.type; |
|
|
// Use .is(":disabled") so that fieldset[disabled] works |
|
|
return this.name && !jQuery( this ).is( ":disabled" ) && |
|
|
rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) && |
|
|
( this.checked || !manipulation_rcheckableType.test( type ) ); |
|
|
}) |
|
|
.map(function( i, elem ){ |
|
|
var val = jQuery( this ).val(); |
|
|
|
|
|
return val == null ? |
|
|
null : |
|
|
jQuery.isArray( val ) ? |
|
|
jQuery.map( val, function( val ){ |
|
|
return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; |
|
|
}) : |
|
|
{ name: elem.name, value: val.replace( rCRLF, "\r\n" ) }; |
|
|
}).get(); |
|
|
} |
|
|
}); |
|
|
|
|
|
//Serialize an array of form elements or a set of |
|
|
//key/values into a query string |
|
|
jQuery.param = function( a, traditional ) { |
|
|
var prefix, |
|
|
s = [], |
|
|
add = function( key, value ) { |
|
|
// If value is a function, invoke it and return its value |
|
|
value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value ); |
|
|
s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value ); |
|
|
}; |
|
|
|
|
|
// Set traditional to true for jQuery <= 1.3.2 behavior. |
|
|
if ( traditional === undefined ) { |
|
|
traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional; |
|
|
} |
|
|
|
|
|
// If an array was passed in, assume that it is an array of form elements. |
|
|
if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) { |
|
|
// Serialize the form elements |
|
|
jQuery.each( a, function() { |
|
|
add( this.name, this.value ); |
|
|
}); |
|
|
|
|
|
} else { |
|
|
// If traditional, encode the "old" way (the way 1.3.2 or older |
|
|
// did it), otherwise encode params recursively. |
|
|
for ( prefix in a ) { |
|
|
buildParams( prefix, a[ prefix ], traditional, add ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Return the resulting serialization |
|
|
return s.join( "&" ).replace( r20, "+" ); |
|
|
}; |
|
|
|
|
|
function buildParams( prefix, obj, traditional, add ) { |
|
|
var name; |
|
|
|
|
|
if ( jQuery.isArray( obj ) ) { |
|
|
// Serialize array item. |
|
|
jQuery.each( obj, function( i, v ) { |
|
|
if ( traditional || rbracket.test( prefix ) ) { |
|
|
// Treat each array item as a scalar. |
|
|
add( prefix, v ); |
|
|
|
|
|
} else { |
|
|
// Item is non-scalar (array or object), encode its numeric index. |
|
|
buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add ); |
|
|
} |
|
|
}); |
|
|
|
|
|
} else if ( !traditional && jQuery.type( obj ) === "object" ) { |
|
|
// Serialize object item. |
|
|
for ( name in obj ) { |
|
|
buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add ); |
|
|
} |
|
|
|
|
|
} else { |
|
|
// Serialize scalar item. |
|
|
add( prefix, obj ); |
|
|
} |
|
|
} |
|
|
jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " + |
|
|
"mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " + |
|
|
"change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) { |
|
|
|
|
|
// Handle event binding |
|
|
jQuery.fn[ name ] = function( data, fn ) { |
|
|
return arguments.length > 0 ? |
|
|
this.on( name, null, data, fn ) : |
|
|
this.trigger( name ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.fn.hover = function( fnOver, fnOut ) { |
|
|
return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver ); |
|
|
}; |
|
|
var |
|
|
// Document location |
|
|
ajaxLocParts, |
|
|
ajaxLocation, |
|
|
ajax_nonce = jQuery.now(), |
|
|
|
|
|
ajax_rquery = /\?/, |
|
|
rhash = /#.*$/, |
|
|
rts = /([?&])_=[^&]*/, |
|
|
rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL |
|
|
// #7653, #8125, #8152: local protocol detection |
|
|
rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/, |
|
|
rnoContent = /^(?:GET|HEAD)$/, |
|
|
rprotocol = /^\/\//, |
|
|
rurl = /^([\w.+-]+:)(?:\/\/([^\/?#:]*)(?::(\d+)|)|)/, |
|
|
|
|
|
// Keep a copy of the old load method |
|
|
_load = jQuery.fn.load, |
|
|
|
|
|
/* Prefilters |
|
|
* 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example) |
|
|
* 2) These are called: |
|
|
* - BEFORE asking for a transport |
|
|
* - AFTER param serialization (s.data is a string if s.processData is true) |
|
|
* 3) key is the dataType |
|
|
* 4) the catchall symbol "*" can be used |
|
|
* 5) execution will start with transport dataType and THEN continue down to "*" if needed |
|
|
*/ |
|
|
prefilters = {}, |
|
|
|
|
|
/* Transports bindings |
|
|
* 1) key is the dataType |
|
|
* 2) the catchall symbol "*" can be used |
|
|
* 3) selection will start with transport dataType and THEN go to "*" if needed |
|
|
*/ |
|
|
transports = {}, |
|
|
|
|
|
// Avoid comment-prolog char sequence (#10098); must appease lint and evade compression |
|
|
allTypes = "*/".concat("*"); |
|
|
|
|
|
// #8138, IE may throw an exception when accessing |
|
|
// a field from window.location if document.domain has been set |
|
|
try { |
|
|
ajaxLocation = location.href; |
|
|
} catch( e ) { |
|
|
// Use the href attribute of an A element |
|
|
// since IE will modify it given document.location |
|
|
ajaxLocation = document.createElement( "a" ); |
|
|
ajaxLocation.href = ""; |
|
|
ajaxLocation = ajaxLocation.href; |
|
|
} |
|
|
|
|
|
// Segment location into parts |
|
|
ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || []; |
|
|
|
|
|
// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport |
|
|
function addToPrefiltersOrTransports( structure ) { |
|
|
|
|
|
// dataTypeExpression is optional and defaults to "*" |
|
|
return function( dataTypeExpression, func ) { |
|
|
|
|
|
if ( typeof dataTypeExpression !== "string" ) { |
|
|
func = dataTypeExpression; |
|
|
dataTypeExpression = "*"; |
|
|
} |
|
|
|
|
|
var dataType, |
|
|
i = 0, |
|
|
dataTypes = dataTypeExpression.toLowerCase().match( core_rnotwhite ) || []; |
|
|
|
|
|
if ( jQuery.isFunction( func ) ) { |
|
|
// For each dataType in the dataTypeExpression |
|
|
while ( (dataType = dataTypes[i++]) ) { |
|
|
// Prepend if requested |
|
|
if ( dataType[0] === "+" ) { |
|
|
dataType = dataType.slice( 1 ) || "*"; |
|
|
(structure[ dataType ] = structure[ dataType ] || []).unshift( func ); |
|
|
|
|
|
// Otherwise append |
|
|
} else { |
|
|
(structure[ dataType ] = structure[ dataType ] || []).push( func ); |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
|
|
|
// Base inspection function for prefilters and transports |
|
|
function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) { |
|
|
|
|
|
var inspected = {}, |
|
|
seekingTransport = ( structure === transports ); |
|
|
|
|
|
function inspect( dataType ) { |
|
|
var selected; |
|
|
inspected[ dataType ] = true; |
|
|
jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) { |
|
|
var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR ); |
|
|
if( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) { |
|
|
options.dataTypes.unshift( dataTypeOrTransport ); |
|
|
inspect( dataTypeOrTransport ); |
|
|
return false; |
|
|
} else if ( seekingTransport ) { |
|
|
return !( selected = dataTypeOrTransport ); |
|
|
} |
|
|
}); |
|
|
return selected; |
|
|
} |
|
|
|
|
|
return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" ); |
|
|
} |
|
|
|
|
|
// A special extend for ajax options |
|
|
// that takes "flat" options (not to be deep extended) |
|
|
// Fixes #9887 |
|
|
function ajaxExtend( target, src ) { |
|
|
var deep, key, |
|
|
flatOptions = jQuery.ajaxSettings.flatOptions || {}; |
|
|
|
|
|
for ( key in src ) { |
|
|
if ( src[ key ] !== undefined ) { |
|
|
( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ]; |
|
|
} |
|
|
} |
|
|
if ( deep ) { |
|
|
jQuery.extend( true, target, deep ); |
|
|
} |
|
|
|
|
|
return target; |
|
|
} |
|
|
|
|
|
jQuery.fn.load = function( url, params, callback ) { |
|
|
if ( typeof url !== "string" && _load ) { |
|
|
return _load.apply( this, arguments ); |
|
|
} |
|
|
|
|
|
var selector, response, type, |
|
|
self = this, |
|
|
off = url.indexOf(" "); |
|
|
|
|
|
if ( off >= 0 ) { |
|
|
selector = url.slice( off, url.length ); |
|
|
url = url.slice( 0, off ); |
|
|
} |
|
|
|
|
|
// If it's a function |
|
|
if ( jQuery.isFunction( params ) ) { |
|
|
|
|
|
// We assume that it's the callback |
|
|
callback = params; |
|
|
params = undefined; |
|
|
|
|
|
// Otherwise, build a param string |
|
|
} else if ( params && typeof params === "object" ) { |
|
|
type = "POST"; |
|
|
} |
|
|
|
|
|
// If we have elements to modify, make the request |
|
|
if ( self.length > 0 ) { |
|
|
jQuery.ajax({ |
|
|
url: url, |
|
|
|
|
|
// if "type" variable is undefined, then "GET" method will be used |
|
|
type: type, |
|
|
dataType: "html", |
|
|
data: params |
|
|
}).done(function( responseText ) { |
|
|
|
|
|
// Save response for use in complete callback |
|
|
response = arguments; |
|
|
|
|
|
self.html( selector ? |
|
|
|
|
|
// If a selector was specified, locate the right elements in a dummy div |
|
|
// Exclude scripts to avoid IE 'Permission Denied' errors |
|
|
jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) : |
|
|
|
|
|
// Otherwise use the full result |
|
|
responseText ); |
|
|
|
|
|
}).complete( callback && function( jqXHR, status ) { |
|
|
self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] ); |
|
|
}); |
|
|
} |
|
|
|
|
|
return this; |
|
|
}; |
|
|
|
|
|
// Attach a bunch of functions for handling common AJAX events |
|
|
jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ){ |
|
|
jQuery.fn[ type ] = function( fn ){ |
|
|
return this.on( type, fn ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.each( [ "get", "post" ], function( i, method ) { |
|
|
jQuery[ method ] = function( url, data, callback, type ) { |
|
|
// shift arguments if data argument was omitted |
|
|
if ( jQuery.isFunction( data ) ) { |
|
|
type = type || callback; |
|
|
callback = data; |
|
|
data = undefined; |
|
|
} |
|
|
|
|
|
return jQuery.ajax({ |
|
|
url: url, |
|
|
type: method, |
|
|
dataType: type, |
|
|
data: data, |
|
|
success: callback |
|
|
}); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.extend({ |
|
|
|
|
|
// Counter for holding the number of active queries |
|
|
active: 0, |
|
|
|
|
|
// Last-Modified header cache for next request |
|
|
lastModified: {}, |
|
|
etag: {}, |
|
|
|
|
|
ajaxSettings: { |
|
|
url: ajaxLocation, |
|
|
type: "GET", |
|
|
isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ), |
|
|
global: true, |
|
|
processData: true, |
|
|
async: true, |
|
|
contentType: "application/x-www-form-urlencoded; charset=UTF-8", |
|
|
/* |
|
|
timeout: 0, |
|
|
data: null, |
|
|
dataType: null, |
|
|
username: null, |
|
|
password: null, |
|
|
cache: null, |
|
|
throws: false, |
|
|
traditional: false, |
|
|
headers: {}, |
|
|
*/ |
|
|
|
|
|
accepts: { |
|
|
"*": allTypes, |
|
|
text: "text/plain", |
|
|
html: "text/html", |
|
|
xml: "application/xml, text/xml", |
|
|
json: "application/json, text/javascript" |
|
|
}, |
|
|
|
|
|
contents: { |
|
|
xml: /xml/, |
|
|
html: /html/, |
|
|
json: /json/ |
|
|
}, |
|
|
|
|
|
responseFields: { |
|
|
xml: "responseXML", |
|
|
text: "responseText" |
|
|
}, |
|
|
|
|
|
// Data converters |
|
|
// Keys separate source (or catchall "*") and destination types with a single space |
|
|
converters: { |
|
|
|
|
|
// Convert anything to text |
|
|
"* text": window.String, |
|
|
|
|
|
// Text to html (true = no transformation) |
|
|
"text html": true, |
|
|
|
|
|
// Evaluate text as a json expression |
|
|
"text json": jQuery.parseJSON, |
|
|
|
|
|
// Parse text as xml |
|
|
"text xml": jQuery.parseXML |
|
|
}, |
|
|
|
|
|
// For options that shouldn't be deep extended: |
|
|
// you can add your own custom options here if |
|
|
// and when you create one that shouldn't be |
|
|
// deep extended (see ajaxExtend) |
|
|
flatOptions: { |
|
|
url: true, |
|
|
context: true |
|
|
} |
|
|
}, |
|
|
|
|
|
// Creates a full fledged settings object into target |
|
|
// with both ajaxSettings and settings fields. |
|
|
// If target is omitted, writes into ajaxSettings. |
|
|
ajaxSetup: function( target, settings ) { |
|
|
return settings ? |
|
|
|
|
|
// Building a settings object |
|
|
ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) : |
|
|
|
|
|
// Extending ajaxSettings |
|
|
ajaxExtend( jQuery.ajaxSettings, target ); |
|
|
}, |
|
|
|
|
|
ajaxPrefilter: addToPrefiltersOrTransports( prefilters ), |
|
|
ajaxTransport: addToPrefiltersOrTransports( transports ), |
|
|
|
|
|
// Main method |
|
|
ajax: function( url, options ) { |
|
|
|
|
|
// If url is an object, simulate pre-1.5 signature |
|
|
if ( typeof url === "object" ) { |
|
|
options = url; |
|
|
url = undefined; |
|
|
} |
|
|
|
|
|
// Force options to be an object |
|
|
options = options || {}; |
|
|
|
|
|
var // Cross-domain detection vars |
|
|
parts, |
|
|
// Loop variable |
|
|
i, |
|
|
// URL without anti-cache param |
|
|
cacheURL, |
|
|
// Response headers as string |
|
|
responseHeadersString, |
|
|
// timeout handle |
|
|
timeoutTimer, |
|
|
|
|
|
// To know if global events are to be dispatched |
|
|
fireGlobals, |
|
|
|
|
|
transport, |
|
|
// Response headers |
|
|
responseHeaders, |
|
|
// Create the final options object |
|
|
s = jQuery.ajaxSetup( {}, options ), |
|
|
// Callbacks context |
|
|
callbackContext = s.context || s, |
|
|
// Context for global events is callbackContext if it is a DOM node or jQuery collection |
|
|
globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ? |
|
|
jQuery( callbackContext ) : |
|
|
jQuery.event, |
|
|
// Deferreds |
|
|
deferred = jQuery.Deferred(), |
|
|
completeDeferred = jQuery.Callbacks("once memory"), |
|
|
// Status-dependent callbacks |
|
|
statusCode = s.statusCode || {}, |
|
|
// Headers (they are sent all at once) |
|
|
requestHeaders = {}, |
|
|
requestHeadersNames = {}, |
|
|
// The jqXHR state |
|
|
state = 0, |
|
|
// Default abort message |
|
|
strAbort = "canceled", |
|
|
// Fake xhr |
|
|
jqXHR = { |
|
|
readyState: 0, |
|
|
|
|
|
// Builds headers hashtable if needed |
|
|
getResponseHeader: function( key ) { |
|
|
var match; |
|
|
if ( state === 2 ) { |
|
|
if ( !responseHeaders ) { |
|
|
responseHeaders = {}; |
|
|
while ( (match = rheaders.exec( responseHeadersString )) ) { |
|
|
responseHeaders[ match[1].toLowerCase() ] = match[ 2 ]; |
|
|
} |
|
|
} |
|
|
match = responseHeaders[ key.toLowerCase() ]; |
|
|
} |
|
|
return match == null ? null : match; |
|
|
}, |
|
|
|
|
|
// Raw string |
|
|
getAllResponseHeaders: function() { |
|
|
return state === 2 ? responseHeadersString : null; |
|
|
}, |
|
|
|
|
|
// Caches the header |
|
|
setRequestHeader: function( name, value ) { |
|
|
var lname = name.toLowerCase(); |
|
|
if ( !state ) { |
|
|
name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name; |
|
|
requestHeaders[ name ] = value; |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
// Overrides response content-type header |
|
|
overrideMimeType: function( type ) { |
|
|
if ( !state ) { |
|
|
s.mimeType = type; |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
// Status-dependent callbacks |
|
|
statusCode: function( map ) { |
|
|
var code; |
|
|
if ( map ) { |
|
|
if ( state < 2 ) { |
|
|
for ( code in map ) { |
|
|
// Lazy-add the new callback in a way that preserves old ones |
|
|
statusCode[ code ] = [ statusCode[ code ], map[ code ] ]; |
|
|
} |
|
|
} else { |
|
|
// Execute the appropriate callbacks |
|
|
jqXHR.always( map[ jqXHR.status ] ); |
|
|
} |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
// Cancel the request |
|
|
abort: function( statusText ) { |
|
|
var finalText = statusText || strAbort; |
|
|
if ( transport ) { |
|
|
transport.abort( finalText ); |
|
|
} |
|
|
done( 0, finalText ); |
|
|
return this; |
|
|
} |
|
|
}; |
|
|
|
|
|
// Attach deferreds |
|
|
deferred.promise( jqXHR ).complete = completeDeferred.add; |
|
|
jqXHR.success = jqXHR.done; |
|
|
jqXHR.error = jqXHR.fail; |
|
|
|
|
|
// Remove hash character (#7531: and string promotion) |
|
|
// Add protocol if not provided (#5866: IE7 issue with protocol-less urls) |
|
|
// Handle falsy url in the settings object (#10093: consistency with old signature) |
|
|
// We also use the url parameter if available |
|
|
s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" ); |
|
|
|
|
|
// Alias method option to type as per ticket #12004 |
|
|
s.type = options.method || options.type || s.method || s.type; |
|
|
|
|
|
// Extract dataTypes list |
|
|
s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( core_rnotwhite ) || [""]; |
|
|
|
|
|
// A cross-domain request is in order when we have a protocol:host:port mismatch |
|
|
if ( s.crossDomain == null ) { |
|
|
parts = rurl.exec( s.url.toLowerCase() ); |
|
|
s.crossDomain = !!( parts && |
|
|
( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] || |
|
|
( parts[ 3 ] || ( parts[ 1 ] === "http:" ? 80 : 443 ) ) != |
|
|
( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? 80 : 443 ) ) ) |
|
|
); |
|
|
} |
|
|
|
|
|
// Convert data if not already a string |
|
|
if ( s.data && s.processData && typeof s.data !== "string" ) { |
|
|
s.data = jQuery.param( s.data, s.traditional ); |
|
|
} |
|
|
|
|
|
// Apply prefilters |
|
|
inspectPrefiltersOrTransports( prefilters, s, options, jqXHR ); |
|
|
|
|
|
// If request was aborted inside a prefilter, stop there |
|
|
if ( state === 2 ) { |
|
|
return jqXHR; |
|
|
} |
|
|
|
|
|
// We can fire global events as of now if asked to |
|
|
fireGlobals = s.global; |
|
|
|
|
|
// Watch for a new set of requests |
|
|
if ( fireGlobals && jQuery.active++ === 0 ) { |
|
|
jQuery.event.trigger("ajaxStart"); |
|
|
} |
|
|
|
|
|
// Uppercase the type |
|
|
s.type = s.type.toUpperCase(); |
|
|
|
|
|
// Determine if request has content |
|
|
s.hasContent = !rnoContent.test( s.type ); |
|
|
|
|
|
// Save the URL in case we're toying with the If-Modified-Since |
|
|
// and/or If-None-Match header later on |
|
|
cacheURL = s.url; |
|
|
|
|
|
// More options handling for requests with no content |
|
|
if ( !s.hasContent ) { |
|
|
|
|
|
// If data is available, append data to url |
|
|
if ( s.data ) { |
|
|
cacheURL = ( s.url += ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + s.data ); |
|
|
// #9682: remove data so that it's not used in an eventual retry |
|
|
delete s.data; |
|
|
} |
|
|
|
|
|
// Add anti-cache in url if needed |
|
|
if ( s.cache === false ) { |
|
|
s.url = rts.test( cacheURL ) ? |
|
|
|
|
|
// If there is already a '_' parameter, set its value |
|
|
cacheURL.replace( rts, "$1_=" + ajax_nonce++ ) : |
|
|
|
|
|
// Otherwise add one to the end |
|
|
cacheURL + ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ajax_nonce++; |
|
|
} |
|
|
} |
|
|
|
|
|
// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. |
|
|
if ( s.ifModified ) { |
|
|
if ( jQuery.lastModified[ cacheURL ] ) { |
|
|
jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] ); |
|
|
} |
|
|
if ( jQuery.etag[ cacheURL ] ) { |
|
|
jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Set the correct header, if data is being sent |
|
|
if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) { |
|
|
jqXHR.setRequestHeader( "Content-Type", s.contentType ); |
|
|
} |
|
|
|
|
|
// Set the Accepts header for the server, depending on the dataType |
|
|
jqXHR.setRequestHeader( |
|
|
"Accept", |
|
|
s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ? |
|
|
s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) : |
|
|
s.accepts[ "*" ] |
|
|
); |
|
|
|
|
|
// Check for headers option |
|
|
for ( i in s.headers ) { |
|
|
jqXHR.setRequestHeader( i, s.headers[ i ] ); |
|
|
} |
|
|
|
|
|
// Allow custom headers/mimetypes and early abort |
|
|
if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) { |
|
|
// Abort if not done already and return |
|
|
return jqXHR.abort(); |
|
|
} |
|
|
|
|
|
// aborting is no longer a cancellation |
|
|
strAbort = "abort"; |
|
|
|
|
|
// Install callbacks on deferreds |
|
|
for ( i in { success: 1, error: 1, complete: 1 } ) { |
|
|
jqXHR[ i ]( s[ i ] ); |
|
|
} |
|
|
|
|
|
// Get transport |
|
|
transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR ); |
|
|
|
|
|
// If no transport, we auto-abort |
|
|
if ( !transport ) { |
|
|
done( -1, "No Transport" ); |
|
|
} else { |
|
|
jqXHR.readyState = 1; |
|
|
|
|
|
// Send global event |
|
|
if ( fireGlobals ) { |
|
|
globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] ); |
|
|
} |
|
|
// Timeout |
|
|
if ( s.async && s.timeout > 0 ) { |
|
|
timeoutTimer = setTimeout(function() { |
|
|
jqXHR.abort("timeout"); |
|
|
}, s.timeout ); |
|
|
} |
|
|
|
|
|
try { |
|
|
state = 1; |
|
|
transport.send( requestHeaders, done ); |
|
|
} catch ( e ) { |
|
|
// Propagate exception as error if not done |
|
|
if ( state < 2 ) { |
|
|
done( -1, e ); |
|
|
// Simply rethrow otherwise |
|
|
} else { |
|
|
throw e; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Callback for when everything is done |
|
|
function done( status, nativeStatusText, responses, headers ) { |
|
|
var isSuccess, success, error, response, modified, |
|
|
statusText = nativeStatusText; |
|
|
|
|
|
// Called once |
|
|
if ( state === 2 ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// State is "done" now |
|
|
state = 2; |
|
|
|
|
|
// Clear timeout if it exists |
|
|
if ( timeoutTimer ) { |
|
|
clearTimeout( timeoutTimer ); |
|
|
} |
|
|
|
|
|
// Dereference transport for early garbage collection |
|
|
// (no matter how long the jqXHR object will be used) |
|
|
transport = undefined; |
|
|
|
|
|
// Cache response headers |
|
|
responseHeadersString = headers || ""; |
|
|
|
|
|
// Set readyState |
|
|
jqXHR.readyState = status > 0 ? 4 : 0; |
|
|
|
|
|
// Get response data |
|
|
if ( responses ) { |
|
|
response = ajaxHandleResponses( s, jqXHR, responses ); |
|
|
} |
|
|
|
|
|
// If successful, handle type chaining |
|
|
if ( status >= 200 && status < 300 || status === 304 ) { |
|
|
|
|
|
// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode. |
|
|
if ( s.ifModified ) { |
|
|
modified = jqXHR.getResponseHeader("Last-Modified"); |
|
|
if ( modified ) { |
|
|
jQuery.lastModified[ cacheURL ] = modified; |
|
|
} |
|
|
modified = jqXHR.getResponseHeader("etag"); |
|
|
if ( modified ) { |
|
|
jQuery.etag[ cacheURL ] = modified; |
|
|
} |
|
|
} |
|
|
|
|
|
// if no content |
|
|
if ( status === 204 ) { |
|
|
isSuccess = true; |
|
|
statusText = "nocontent"; |
|
|
|
|
|
// if not modified |
|
|
} else if ( status === 304 ) { |
|
|
isSuccess = true; |
|
|
statusText = "notmodified"; |
|
|
|
|
|
// If we have data, let's convert it |
|
|
} else { |
|
|
isSuccess = ajaxConvert( s, response ); |
|
|
statusText = isSuccess.state; |
|
|
success = isSuccess.data; |
|
|
error = isSuccess.error; |
|
|
isSuccess = !error; |
|
|
} |
|
|
} else { |
|
|
// We extract error from statusText |
|
|
// then normalize statusText and status for non-aborts |
|
|
error = statusText; |
|
|
if ( status || !statusText ) { |
|
|
statusText = "error"; |
|
|
if ( status < 0 ) { |
|
|
status = 0; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Set data for the fake xhr object |
|
|
jqXHR.status = status; |
|
|
jqXHR.statusText = ( nativeStatusText || statusText ) + ""; |
|
|
|
|
|
// Success/Error |
|
|
if ( isSuccess ) { |
|
|
deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] ); |
|
|
} else { |
|
|
deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] ); |
|
|
} |
|
|
|
|
|
// Status-dependent callbacks |
|
|
jqXHR.statusCode( statusCode ); |
|
|
statusCode = undefined; |
|
|
|
|
|
if ( fireGlobals ) { |
|
|
globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError", |
|
|
[ jqXHR, s, isSuccess ? success : error ] ); |
|
|
} |
|
|
|
|
|
// Complete |
|
|
completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] ); |
|
|
|
|
|
if ( fireGlobals ) { |
|
|
globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] ); |
|
|
// Handle the global AJAX counter |
|
|
if ( !( --jQuery.active ) ) { |
|
|
jQuery.event.trigger("ajaxStop"); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return jqXHR; |
|
|
}, |
|
|
|
|
|
getScript: function( url, callback ) { |
|
|
return jQuery.get( url, undefined, callback, "script" ); |
|
|
}, |
|
|
|
|
|
getJSON: function( url, data, callback ) { |
|
|
return jQuery.get( url, data, callback, "json" ); |
|
|
} |
|
|
}); |
|
|
|
|
|
/* Handles responses to an ajax request: |
|
|
* - sets all responseXXX fields accordingly |
|
|
* - finds the right dataType (mediates between content-type and expected dataType) |
|
|
* - returns the corresponding response |
|
|
*/ |
|
|
function ajaxHandleResponses( s, jqXHR, responses ) { |
|
|
var firstDataType, ct, finalDataType, type, |
|
|
contents = s.contents, |
|
|
dataTypes = s.dataTypes, |
|
|
responseFields = s.responseFields; |
|
|
|
|
|
// Fill responseXXX fields |
|
|
for ( type in responseFields ) { |
|
|
if ( type in responses ) { |
|
|
jqXHR[ responseFields[type] ] = responses[ type ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// Remove auto dataType and get content-type in the process |
|
|
while( dataTypes[ 0 ] === "*" ) { |
|
|
dataTypes.shift(); |
|
|
if ( ct === undefined ) { |
|
|
ct = s.mimeType || jqXHR.getResponseHeader("Content-Type"); |
|
|
} |
|
|
} |
|
|
|
|
|
// Check if we're dealing with a known content-type |
|
|
if ( ct ) { |
|
|
for ( type in contents ) { |
|
|
if ( contents[ type ] && contents[ type ].test( ct ) ) { |
|
|
dataTypes.unshift( type ); |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Check to see if we have a response for the expected dataType |
|
|
if ( dataTypes[ 0 ] in responses ) { |
|
|
finalDataType = dataTypes[ 0 ]; |
|
|
} else { |
|
|
// Try convertible dataTypes |
|
|
for ( type in responses ) { |
|
|
if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) { |
|
|
finalDataType = type; |
|
|
break; |
|
|
} |
|
|
if ( !firstDataType ) { |
|
|
firstDataType = type; |
|
|
} |
|
|
} |
|
|
// Or just use first one |
|
|
finalDataType = finalDataType || firstDataType; |
|
|
} |
|
|
|
|
|
// If we found a dataType |
|
|
// We add the dataType to the list if needed |
|
|
// and return the corresponding response |
|
|
if ( finalDataType ) { |
|
|
if ( finalDataType !== dataTypes[ 0 ] ) { |
|
|
dataTypes.unshift( finalDataType ); |
|
|
} |
|
|
return responses[ finalDataType ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// Chain conversions given the request and the original response |
|
|
function ajaxConvert( s, response ) { |
|
|
var conv2, current, conv, tmp, |
|
|
converters = {}, |
|
|
i = 0, |
|
|
// Work with a copy of dataTypes in case we need to modify it for conversion |
|
|
dataTypes = s.dataTypes.slice(), |
|
|
prev = dataTypes[ 0 ]; |
|
|
|
|
|
// Apply the dataFilter if provided |
|
|
if ( s.dataFilter ) { |
|
|
response = s.dataFilter( response, s.dataType ); |
|
|
} |
|
|
|
|
|
// Create converters map with lowercased keys |
|
|
if ( dataTypes[ 1 ] ) { |
|
|
for ( conv in s.converters ) { |
|
|
converters[ conv.toLowerCase() ] = s.converters[ conv ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// Convert to each sequential dataType, tolerating list modification |
|
|
for ( ; (current = dataTypes[++i]); ) { |
|
|
|
|
|
// There's only work to do if current dataType is non-auto |
|
|
if ( current !== "*" ) { |
|
|
|
|
|
// Convert response if prev dataType is non-auto and differs from current |
|
|
if ( prev !== "*" && prev !== current ) { |
|
|
|
|
|
// Seek a direct converter |
|
|
conv = converters[ prev + " " + current ] || converters[ "* " + current ]; |
|
|
|
|
|
// If none found, seek a pair |
|
|
if ( !conv ) { |
|
|
for ( conv2 in converters ) { |
|
|
|
|
|
// If conv2 outputs current |
|
|
tmp = conv2.split(" "); |
|
|
if ( tmp[ 1 ] === current ) { |
|
|
|
|
|
// If prev can be converted to accepted input |
|
|
conv = converters[ prev + " " + tmp[ 0 ] ] || |
|
|
converters[ "* " + tmp[ 0 ] ]; |
|
|
if ( conv ) { |
|
|
// Condense equivalence converters |
|
|
if ( conv === true ) { |
|
|
conv = converters[ conv2 ]; |
|
|
|
|
|
// Otherwise, insert the intermediate dataType |
|
|
} else if ( converters[ conv2 ] !== true ) { |
|
|
current = tmp[ 0 ]; |
|
|
dataTypes.splice( i--, 0, current ); |
|
|
} |
|
|
|
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Apply converter (if not an equivalence) |
|
|
if ( conv !== true ) { |
|
|
|
|
|
// Unless errors are allowed to bubble, catch and return them |
|
|
if ( conv && s["throws"] ) { |
|
|
response = conv( response ); |
|
|
} else { |
|
|
try { |
|
|
response = conv( response ); |
|
|
} catch ( e ) { |
|
|
return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current }; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// Update prev for next iteration |
|
|
prev = current; |
|
|
} |
|
|
} |
|
|
|
|
|
return { state: "success", data: response }; |
|
|
} |
|
|
// Install script dataType |
|
|
jQuery.ajaxSetup({ |
|
|
accepts: { |
|
|
script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript" |
|
|
}, |
|
|
contents: { |
|
|
script: /(?:java|ecma)script/ |
|
|
}, |
|
|
converters: { |
|
|
"text script": function( text ) { |
|
|
jQuery.globalEval( text ); |
|
|
return text; |
|
|
} |
|
|
} |
|
|
}); |
|
|
|
|
|
// Handle cache's special case and global |
|
|
jQuery.ajaxPrefilter( "script", function( s ) { |
|
|
if ( s.cache === undefined ) { |
|
|
s.cache = false; |
|
|
} |
|
|
if ( s.crossDomain ) { |
|
|
s.type = "GET"; |
|
|
s.global = false; |
|
|
} |
|
|
}); |
|
|
|
|
|
// Bind script tag hack transport |
|
|
jQuery.ajaxTransport( "script", function(s) { |
|
|
|
|
|
// This transport only deals with cross domain requests |
|
|
if ( s.crossDomain ) { |
|
|
|
|
|
var script, |
|
|
head = document.head || jQuery("head")[0] || document.documentElement; |
|
|
|
|
|
return { |
|
|
|
|
|
send: function( _, callback ) { |
|
|
|
|
|
script = document.createElement("script"); |
|
|
|
|
|
script.async = true; |
|
|
|
|
|
if ( s.scriptCharset ) { |
|
|
script.charset = s.scriptCharset; |
|
|
} |
|
|
|
|
|
script.src = s.url; |
|
|
|
|
|
// Attach handlers for all browsers |
|
|
script.onload = script.onreadystatechange = function( _, isAbort ) { |
|
|
|
|
|
if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) { |
|
|
|
|
|
// Handle memory leak in IE |
|
|
script.onload = script.onreadystatechange = null; |
|
|
|
|
|
// Remove the script |
|
|
if ( script.parentNode ) { |
|
|
script.parentNode.removeChild( script ); |
|
|
} |
|
|
|
|
|
// Dereference the script |
|
|
script = null; |
|
|
|
|
|
// Callback if not abort |
|
|
if ( !isAbort ) { |
|
|
callback( 200, "success" ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
// Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending |
|
|
// Use native DOM manipulation to avoid our domManip AJAX trickery |
|
|
head.insertBefore( script, head.firstChild ); |
|
|
}, |
|
|
|
|
|
abort: function() { |
|
|
if ( script ) { |
|
|
script.onload( undefined, true ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
}); |
|
|
var oldCallbacks = [], |
|
|
rjsonp = /(=)\?(?=&|$)|\?\?/; |
|
|
|
|
|
// Default jsonp settings |
|
|
jQuery.ajaxSetup({ |
|
|
jsonp: "callback", |
|
|
jsonpCallback: function() { |
|
|
var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( ajax_nonce++ ) ); |
|
|
this[ callback ] = true; |
|
|
return callback; |
|
|
} |
|
|
}); |
|
|
|
|
|
// Detect, normalize options and install callbacks for jsonp requests |
|
|
jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) { |
|
|
|
|
|
var callbackName, overwritten, responseContainer, |
|
|
jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ? |
|
|
"url" : |
|
|
typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data" |
|
|
); |
|
|
|
|
|
// Handle iff the expected data type is "jsonp" or we have a parameter to set |
|
|
if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) { |
|
|
|
|
|
// Get callback name, remembering preexisting value associated with it |
|
|
callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ? |
|
|
s.jsonpCallback() : |
|
|
s.jsonpCallback; |
|
|
|
|
|
// Insert callback into url or form data |
|
|
if ( jsonProp ) { |
|
|
s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName ); |
|
|
} else if ( s.jsonp !== false ) { |
|
|
s.url += ( ajax_rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName; |
|
|
} |
|
|
|
|
|
// Use data converter to retrieve json after script execution |
|
|
s.converters["script json"] = function() { |
|
|
if ( !responseContainer ) { |
|
|
jQuery.error( callbackName + " was not called" ); |
|
|
} |
|
|
return responseContainer[ 0 ]; |
|
|
}; |
|
|
|
|
|
// force json dataType |
|
|
s.dataTypes[ 0 ] = "json"; |
|
|
|
|
|
// Install callback |
|
|
overwritten = window[ callbackName ]; |
|
|
window[ callbackName ] = function() { |
|
|
responseContainer = arguments; |
|
|
}; |
|
|
|
|
|
// Clean-up function (fires after converters) |
|
|
jqXHR.always(function() { |
|
|
// Restore preexisting value |
|
|
window[ callbackName ] = overwritten; |
|
|
|
|
|
// Save back as free |
|
|
if ( s[ callbackName ] ) { |
|
|
// make sure that re-using the options doesn't screw things around |
|
|
s.jsonpCallback = originalSettings.jsonpCallback; |
|
|
|
|
|
// save the callback name for future use |
|
|
oldCallbacks.push( callbackName ); |
|
|
} |
|
|
|
|
|
// Call if it was a function and we have a response |
|
|
if ( responseContainer && jQuery.isFunction( overwritten ) ) { |
|
|
overwritten( responseContainer[ 0 ] ); |
|
|
} |
|
|
|
|
|
responseContainer = overwritten = undefined; |
|
|
}); |
|
|
|
|
|
// Delegate to script |
|
|
return "script"; |
|
|
} |
|
|
}); |
|
|
var xhrCallbacks, xhrSupported, |
|
|
xhrId = 0, |
|
|
// #5280: Internet Explorer will keep connections alive if we don't abort on unload |
|
|
xhrOnUnloadAbort = window.ActiveXObject && function() { |
|
|
// Abort all pending requests |
|
|
var key; |
|
|
for ( key in xhrCallbacks ) { |
|
|
xhrCallbacks[ key ]( undefined, true ); |
|
|
} |
|
|
}; |
|
|
|
|
|
// Functions to create xhrs |
|
|
function createStandardXHR() { |
|
|
try { |
|
|
return new window.XMLHttpRequest(); |
|
|
} catch( e ) {} |
|
|
} |
|
|
|
|
|
function createActiveXHR() { |
|
|
try { |
|
|
return new window.ActiveXObject("Microsoft.XMLHTTP"); |
|
|
} catch( e ) {} |
|
|
} |
|
|
|
|
|
// Create the request object |
|
|
// (This is still attached to ajaxSettings for backward compatibility) |
|
|
jQuery.ajaxSettings.xhr = window.ActiveXObject ? |
|
|
/* Microsoft failed to properly |
|
|
* implement the XMLHttpRequest in IE7 (can't request local files), |
|
|
* so we use the ActiveXObject when it is available |
|
|
* Additionally XMLHttpRequest can be disabled in IE7/IE8 so |
|
|
* we need a fallback. |
|
|
*/ |
|
|
function() { |
|
|
return !this.isLocal && createStandardXHR() || createActiveXHR(); |
|
|
} : |
|
|
// For all other browsers, use the standard XMLHttpRequest object |
|
|
createStandardXHR; |
|
|
|
|
|
// Determine support properties |
|
|
xhrSupported = jQuery.ajaxSettings.xhr(); |
|
|
jQuery.support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported ); |
|
|
xhrSupported = jQuery.support.ajax = !!xhrSupported; |
|
|
|
|
|
// Create transport if the browser can provide an xhr |
|
|
if ( xhrSupported ) { |
|
|
|
|
|
jQuery.ajaxTransport(function( s ) { |
|
|
// Cross domain only allowed if supported through XMLHttpRequest |
|
|
if ( !s.crossDomain || jQuery.support.cors ) { |
|
|
|
|
|
var callback; |
|
|
|
|
|
return { |
|
|
send: function( headers, complete ) { |
|
|
|
|
|
// Get a new xhr |
|
|
var handle, i, |
|
|
xhr = s.xhr(); |
|
|
|
|
|
// Open the socket |
|
|
// Passing null username, generates a login popup on Opera (#2865) |
|
|
if ( s.username ) { |
|
|
xhr.open( s.type, s.url, s.async, s.username, s.password ); |
|
|
} else { |
|
|
xhr.open( s.type, s.url, s.async ); |
|
|
} |
|
|
|
|
|
// Apply custom fields if provided |
|
|
if ( s.xhrFields ) { |
|
|
for ( i in s.xhrFields ) { |
|
|
xhr[ i ] = s.xhrFields[ i ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// Override mime type if needed |
|
|
if ( s.mimeType && xhr.overrideMimeType ) { |
|
|
xhr.overrideMimeType( s.mimeType ); |
|
|
} |
|
|
|
|
|
// X-Requested-With header |
|
|
// For cross-domain requests, seeing as conditions for a preflight are |
|
|
// akin to a jigsaw puzzle, we simply never set it to be sure. |
|
|
// (it can always be set on a per-request basis or even using ajaxSetup) |
|
|
// For same-domain requests, won't change header if already provided. |
|
|
if ( !s.crossDomain && !headers["X-Requested-With"] ) { |
|
|
headers["X-Requested-With"] = "XMLHttpRequest"; |
|
|
} |
|
|
|
|
|
// Need an extra try/catch for cross domain requests in Firefox 3 |
|
|
try { |
|
|
for ( i in headers ) { |
|
|
xhr.setRequestHeader( i, headers[ i ] ); |
|
|
} |
|
|
} catch( err ) {} |
|
|
|
|
|
// Do send the request |
|
|
// This may raise an exception which is actually |
|
|
// handled in jQuery.ajax (so no try/catch here) |
|
|
xhr.send( ( s.hasContent && s.data ) || null ); |
|
|
|
|
|
// Listener |
|
|
callback = function( _, isAbort ) { |
|
|
var status, responseHeaders, statusText, responses; |
|
|
|
|
|
// Firefox throws exceptions when accessing properties |
|
|
// of an xhr when a network error occurred |
|
|
// http://helpful.knobs-dials.com/index.php/Component_returned_failure_code:_0x80040111_(NS_ERROR_NOT_AVAILABLE) |
|
|
try { |
|
|
|
|
|
// Was never called and is aborted or complete |
|
|
if ( callback && ( isAbort || xhr.readyState === 4 ) ) { |
|
|
|
|
|
// Only called once |
|
|
callback = undefined; |
|
|
|
|
|
// Do not keep as active anymore |
|
|
if ( handle ) { |
|
|
xhr.onreadystatechange = jQuery.noop; |
|
|
if ( xhrOnUnloadAbort ) { |
|
|
delete xhrCallbacks[ handle ]; |
|
|
} |
|
|
} |
|
|
|
|
|
// If it's an abort |
|
|
if ( isAbort ) { |
|
|
// Abort it manually if needed |
|
|
if ( xhr.readyState !== 4 ) { |
|
|
xhr.abort(); |
|
|
} |
|
|
} else { |
|
|
responses = {}; |
|
|
status = xhr.status; |
|
|
responseHeaders = xhr.getAllResponseHeaders(); |
|
|
|
|
|
// When requesting binary data, IE6-9 will throw an exception |
|
|
// on any attempt to access responseText (#11426) |
|
|
if ( typeof xhr.responseText === "string" ) { |
|
|
responses.text = xhr.responseText; |
|
|
} |
|
|
|
|
|
// Firefox throws an exception when accessing |
|
|
// statusText for faulty cross-domain requests |
|
|
try { |
|
|
statusText = xhr.statusText; |
|
|
} catch( e ) { |
|
|
// We normalize with Webkit giving an empty statusText |
|
|
statusText = ""; |
|
|
} |
|
|
|
|
|
// Filter status for non standard behaviors |
|
|
|
|
|
// If the request is local and we have data: assume a success |
|
|
// (success with no data won't get notified, that's the best we |
|
|
// can do given current implementations) |
|
|
if ( !status && s.isLocal && !s.crossDomain ) { |
|
|
status = responses.text ? 200 : 404; |
|
|
// IE - #1450: sometimes returns 1223 when it should be 204 |
|
|
} else if ( status === 1223 ) { |
|
|
status = 204; |
|
|
} |
|
|
} |
|
|
} |
|
|
} catch( firefoxAccessException ) { |
|
|
if ( !isAbort ) { |
|
|
complete( -1, firefoxAccessException ); |
|
|
} |
|
|
} |
|
|
|
|
|
// Call complete if needed |
|
|
if ( responses ) { |
|
|
complete( status, statusText, responses, responseHeaders ); |
|
|
} |
|
|
}; |
|
|
|
|
|
if ( !s.async ) { |
|
|
// if we're in sync mode we fire the callback |
|
|
callback(); |
|
|
} else if ( xhr.readyState === 4 ) { |
|
|
// (IE6 & IE7) if it's in cache and has been |
|
|
// retrieved directly we need to fire the callback |
|
|
setTimeout( callback ); |
|
|
} else { |
|
|
handle = ++xhrId; |
|
|
if ( xhrOnUnloadAbort ) { |
|
|
// Create the active xhrs callbacks list if needed |
|
|
// and attach the unload handler |
|
|
if ( !xhrCallbacks ) { |
|
|
xhrCallbacks = {}; |
|
|
jQuery( window ).unload( xhrOnUnloadAbort ); |
|
|
} |
|
|
// Add to list of active xhrs callbacks |
|
|
xhrCallbacks[ handle ] = callback; |
|
|
} |
|
|
xhr.onreadystatechange = callback; |
|
|
} |
|
|
}, |
|
|
|
|
|
abort: function() { |
|
|
if ( callback ) { |
|
|
callback( undefined, true ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
} |
|
|
}); |
|
|
} |
|
|
var fxNow, timerId, |
|
|
rfxtypes = /^(?:toggle|show|hide)$/, |
|
|
rfxnum = new RegExp( "^(?:([+-])=|)(" + core_pnum + ")([a-z%]*)$", "i" ), |
|
|
rrun = /queueHooks$/, |
|
|
animationPrefilters = [ defaultPrefilter ], |
|
|
tweeners = { |
|
|
"*": [function( prop, value ) { |
|
|
var end, unit, |
|
|
tween = this.createTween( prop, value ), |
|
|
parts = rfxnum.exec( value ), |
|
|
target = tween.cur(), |
|
|
start = +target || 0, |
|
|
scale = 1, |
|
|
maxIterations = 20; |
|
|
|
|
|
if ( parts ) { |
|
|
end = +parts[2]; |
|
|
unit = parts[3] || ( jQuery.cssNumber[ prop ] ? "" : "px" ); |
|
|
|
|
|
// We need to compute starting value |
|
|
if ( unit !== "px" && start ) { |
|
|
// Iteratively approximate from a nonzero starting point |
|
|
// Prefer the current property, because this process will be trivial if it uses the same units |
|
|
// Fallback to end or a simple constant |
|
|
start = jQuery.css( tween.elem, prop, true ) || end || 1; |
|
|
|
|
|
do { |
|
|
// If previous iteration zeroed out, double until we get *something* |
|
|
// Use a string for doubling factor so we don't accidentally see scale as unchanged below |
|
|
scale = scale || ".5"; |
|
|
|
|
|
// Adjust and apply |
|
|
start = start / scale; |
|
|
jQuery.style( tween.elem, prop, start + unit ); |
|
|
|
|
|
// Update scale, tolerating zero or NaN from tween.cur() |
|
|
// And breaking the loop if scale is unchanged or perfect, or if we've just had enough |
|
|
} while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations ); |
|
|
} |
|
|
|
|
|
tween.unit = unit; |
|
|
tween.start = start; |
|
|
// If a +=/-= token was provided, we're doing a relative animation |
|
|
tween.end = parts[1] ? start + ( parts[1] + 1 ) * end : end; |
|
|
} |
|
|
return tween; |
|
|
}] |
|
|
}; |
|
|
|
|
|
// Animations created synchronously will run synchronously |
|
|
function createFxNow() { |
|
|
setTimeout(function() { |
|
|
fxNow = undefined; |
|
|
}); |
|
|
return ( fxNow = jQuery.now() ); |
|
|
} |
|
|
|
|
|
function createTweens( animation, props ) { |
|
|
jQuery.each( props, function( prop, value ) { |
|
|
var collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ), |
|
|
index = 0, |
|
|
length = collection.length; |
|
|
for ( ; index < length; index++ ) { |
|
|
if ( collection[ index ].call( animation, prop, value ) ) { |
|
|
|
|
|
// we're done with this property |
|
|
return; |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
|
|
|
function Animation( elem, properties, options ) { |
|
|
var result, |
|
|
stopped, |
|
|
index = 0, |
|
|
length = animationPrefilters.length, |
|
|
deferred = jQuery.Deferred().always( function() { |
|
|
// don't match elem in the :animated selector |
|
|
delete tick.elem; |
|
|
}), |
|
|
tick = function() { |
|
|
if ( stopped ) { |
|
|
return false; |
|
|
} |
|
|
var currentTime = fxNow || createFxNow(), |
|
|
remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ), |
|
|
// archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497) |
|
|
temp = remaining / animation.duration || 0, |
|
|
percent = 1 - temp, |
|
|
index = 0, |
|
|
length = animation.tweens.length; |
|
|
|
|
|
for ( ; index < length ; index++ ) { |
|
|
animation.tweens[ index ].run( percent ); |
|
|
} |
|
|
|
|
|
deferred.notifyWith( elem, [ animation, percent, remaining ]); |
|
|
|
|
|
if ( percent < 1 && length ) { |
|
|
return remaining; |
|
|
} else { |
|
|
deferred.resolveWith( elem, [ animation ] ); |
|
|
return false; |
|
|
} |
|
|
}, |
|
|
animation = deferred.promise({ |
|
|
elem: elem, |
|
|
props: jQuery.extend( {}, properties ), |
|
|
opts: jQuery.extend( true, { specialEasing: {} }, options ), |
|
|
originalProperties: properties, |
|
|
originalOptions: options, |
|
|
startTime: fxNow || createFxNow(), |
|
|
duration: options.duration, |
|
|
tweens: [], |
|
|
createTween: function( prop, end ) { |
|
|
var tween = jQuery.Tween( elem, animation.opts, prop, end, |
|
|
animation.opts.specialEasing[ prop ] || animation.opts.easing ); |
|
|
animation.tweens.push( tween ); |
|
|
return tween; |
|
|
}, |
|
|
stop: function( gotoEnd ) { |
|
|
var index = 0, |
|
|
// if we are going to the end, we want to run all the tweens |
|
|
// otherwise we skip this part |
|
|
length = gotoEnd ? animation.tweens.length : 0; |
|
|
if ( stopped ) { |
|
|
return this; |
|
|
} |
|
|
stopped = true; |
|
|
for ( ; index < length ; index++ ) { |
|
|
animation.tweens[ index ].run( 1 ); |
|
|
} |
|
|
|
|
|
// resolve when we played the last frame |
|
|
// otherwise, reject |
|
|
if ( gotoEnd ) { |
|
|
deferred.resolveWith( elem, [ animation, gotoEnd ] ); |
|
|
} else { |
|
|
deferred.rejectWith( elem, [ animation, gotoEnd ] ); |
|
|
} |
|
|
return this; |
|
|
} |
|
|
}), |
|
|
props = animation.props; |
|
|
|
|
|
propFilter( props, animation.opts.specialEasing ); |
|
|
|
|
|
for ( ; index < length ; index++ ) { |
|
|
result = animationPrefilters[ index ].call( animation, elem, props, animation.opts ); |
|
|
if ( result ) { |
|
|
return result; |
|
|
} |
|
|
} |
|
|
|
|
|
createTweens( animation, props ); |
|
|
|
|
|
if ( jQuery.isFunction( animation.opts.start ) ) { |
|
|
animation.opts.start.call( elem, animation ); |
|
|
} |
|
|
|
|
|
jQuery.fx.timer( |
|
|
jQuery.extend( tick, { |
|
|
elem: elem, |
|
|
anim: animation, |
|
|
queue: animation.opts.queue |
|
|
}) |
|
|
); |
|
|
|
|
|
// attach callbacks from options |
|
|
return animation.progress( animation.opts.progress ) |
|
|
.done( animation.opts.done, animation.opts.complete ) |
|
|
.fail( animation.opts.fail ) |
|
|
.always( animation.opts.always ); |
|
|
} |
|
|
|
|
|
function propFilter( props, specialEasing ) { |
|
|
var value, name, index, easing, hooks; |
|
|
|
|
|
// camelCase, specialEasing and expand cssHook pass |
|
|
for ( index in props ) { |
|
|
name = jQuery.camelCase( index ); |
|
|
easing = specialEasing[ name ]; |
|
|
value = props[ index ]; |
|
|
if ( jQuery.isArray( value ) ) { |
|
|
easing = value[ 1 ]; |
|
|
value = props[ index ] = value[ 0 ]; |
|
|
} |
|
|
|
|
|
if ( index !== name ) { |
|
|
props[ name ] = value; |
|
|
delete props[ index ]; |
|
|
} |
|
|
|
|
|
hooks = jQuery.cssHooks[ name ]; |
|
|
if ( hooks && "expand" in hooks ) { |
|
|
value = hooks.expand( value ); |
|
|
delete props[ name ]; |
|
|
|
|
|
// not quite $.extend, this wont overwrite keys already present. |
|
|
// also - reusing 'index' from above because we have the correct "name" |
|
|
for ( index in value ) { |
|
|
if ( !( index in props ) ) { |
|
|
props[ index ] = value[ index ]; |
|
|
specialEasing[ index ] = easing; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
specialEasing[ name ] = easing; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
jQuery.Animation = jQuery.extend( Animation, { |
|
|
|
|
|
tweener: function( props, callback ) { |
|
|
if ( jQuery.isFunction( props ) ) { |
|
|
callback = props; |
|
|
props = [ "*" ]; |
|
|
} else { |
|
|
props = props.split(" "); |
|
|
} |
|
|
|
|
|
var prop, |
|
|
index = 0, |
|
|
length = props.length; |
|
|
|
|
|
for ( ; index < length ; index++ ) { |
|
|
prop = props[ index ]; |
|
|
tweeners[ prop ] = tweeners[ prop ] || []; |
|
|
tweeners[ prop ].unshift( callback ); |
|
|
} |
|
|
}, |
|
|
|
|
|
prefilter: function( callback, prepend ) { |
|
|
if ( prepend ) { |
|
|
animationPrefilters.unshift( callback ); |
|
|
} else { |
|
|
animationPrefilters.push( callback ); |
|
|
} |
|
|
} |
|
|
}); |
|
|
|
|
|
function defaultPrefilter( elem, props, opts ) { |
|
|
/*jshint validthis:true */ |
|
|
var prop, index, length, |
|
|
value, dataShow, toggle, |
|
|
tween, hooks, oldfire, |
|
|
anim = this, |
|
|
style = elem.style, |
|
|
orig = {}, |
|
|
handled = [], |
|
|
hidden = elem.nodeType && isHidden( elem ); |
|
|
|
|
|
// handle queue: false promises |
|
|
if ( !opts.queue ) { |
|
|
hooks = jQuery._queueHooks( elem, "fx" ); |
|
|
if ( hooks.unqueued == null ) { |
|
|
hooks.unqueued = 0; |
|
|
oldfire = hooks.empty.fire; |
|
|
hooks.empty.fire = function() { |
|
|
if ( !hooks.unqueued ) { |
|
|
oldfire(); |
|
|
} |
|
|
}; |
|
|
} |
|
|
hooks.unqueued++; |
|
|
|
|
|
anim.always(function() { |
|
|
// doing this makes sure that the complete handler will be called |
|
|
// before this completes |
|
|
anim.always(function() { |
|
|
hooks.unqueued--; |
|
|
if ( !jQuery.queue( elem, "fx" ).length ) { |
|
|
hooks.empty.fire(); |
|
|
} |
|
|
}); |
|
|
}); |
|
|
} |
|
|
|
|
|
// height/width overflow pass |
|
|
if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) { |
|
|
// Make sure that nothing sneaks out |
|
|
// Record all 3 overflow attributes because IE does not |
|
|
// change the overflow attribute when overflowX and |
|
|
// overflowY are set to the same value |
|
|
opts.overflow = [ style.overflow, style.overflowX, style.overflowY ]; |
|
|
|
|
|
// Set display property to inline-block for height/width |
|
|
// animations on inline elements that are having width/height animated |
|
|
if ( jQuery.css( elem, "display" ) === "inline" && |
|
|
jQuery.css( elem, "float" ) === "none" ) { |
|
|
|
|
|
// inline-level elements accept inline-block; |
|
|
// block-level elements need to be inline with layout |
|
|
if ( !jQuery.support.inlineBlockNeedsLayout || css_defaultDisplay( elem.nodeName ) === "inline" ) { |
|
|
style.display = "inline-block"; |
|
|
|
|
|
} else { |
|
|
style.zoom = 1; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
if ( opts.overflow ) { |
|
|
style.overflow = "hidden"; |
|
|
if ( !jQuery.support.shrinkWrapBlocks ) { |
|
|
anim.always(function() { |
|
|
style.overflow = opts.overflow[ 0 ]; |
|
|
style.overflowX = opts.overflow[ 1 ]; |
|
|
style.overflowY = opts.overflow[ 2 ]; |
|
|
}); |
|
|
} |
|
|
} |
|
|
|
|
|
|
|
|
// show/hide pass |
|
|
for ( index in props ) { |
|
|
value = props[ index ]; |
|
|
if ( rfxtypes.exec( value ) ) { |
|
|
delete props[ index ]; |
|
|
toggle = toggle || value === "toggle"; |
|
|
if ( value === ( hidden ? "hide" : "show" ) ) { |
|
|
continue; |
|
|
} |
|
|
handled.push( index ); |
|
|
} |
|
|
} |
|
|
|
|
|
length = handled.length; |
|
|
if ( length ) { |
|
|
dataShow = jQuery._data( elem, "fxshow" ) || jQuery._data( elem, "fxshow", {} ); |
|
|
if ( "hidden" in dataShow ) { |
|
|
hidden = dataShow.hidden; |
|
|
} |
|
|
|
|
|
// store state if its toggle - enables .stop().toggle() to "reverse" |
|
|
if ( toggle ) { |
|
|
dataShow.hidden = !hidden; |
|
|
} |
|
|
if ( hidden ) { |
|
|
jQuery( elem ).show(); |
|
|
} else { |
|
|
anim.done(function() { |
|
|
jQuery( elem ).hide(); |
|
|
}); |
|
|
} |
|
|
anim.done(function() { |
|
|
var prop; |
|
|
jQuery._removeData( elem, "fxshow" ); |
|
|
for ( prop in orig ) { |
|
|
jQuery.style( elem, prop, orig[ prop ] ); |
|
|
} |
|
|
}); |
|
|
for ( index = 0 ; index < length ; index++ ) { |
|
|
prop = handled[ index ]; |
|
|
tween = anim.createTween( prop, hidden ? dataShow[ prop ] : 0 ); |
|
|
orig[ prop ] = dataShow[ prop ] || jQuery.style( elem, prop ); |
|
|
|
|
|
if ( !( prop in dataShow ) ) { |
|
|
dataShow[ prop ] = tween.start; |
|
|
if ( hidden ) { |
|
|
tween.end = tween.start; |
|
|
tween.start = prop === "width" || prop === "height" ? 1 : 0; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
function Tween( elem, options, prop, end, easing ) { |
|
|
return new Tween.prototype.init( elem, options, prop, end, easing ); |
|
|
} |
|
|
jQuery.Tween = Tween; |
|
|
|
|
|
Tween.prototype = { |
|
|
constructor: Tween, |
|
|
init: function( elem, options, prop, end, easing, unit ) { |
|
|
this.elem = elem; |
|
|
this.prop = prop; |
|
|
this.easing = easing || "swing"; |
|
|
this.options = options; |
|
|
this.start = this.now = this.cur(); |
|
|
this.end = end; |
|
|
this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" ); |
|
|
}, |
|
|
cur: function() { |
|
|
var hooks = Tween.propHooks[ this.prop ]; |
|
|
|
|
|
return hooks && hooks.get ? |
|
|
hooks.get( this ) : |
|
|
Tween.propHooks._default.get( this ); |
|
|
}, |
|
|
run: function( percent ) { |
|
|
var eased, |
|
|
hooks = Tween.propHooks[ this.prop ]; |
|
|
|
|
|
if ( this.options.duration ) { |
|
|
this.pos = eased = jQuery.easing[ this.easing ]( |
|
|
percent, this.options.duration * percent, 0, 1, this.options.duration |
|
|
); |
|
|
} else { |
|
|
this.pos = eased = percent; |
|
|
} |
|
|
this.now = ( this.end - this.start ) * eased + this.start; |
|
|
|
|
|
if ( this.options.step ) { |
|
|
this.options.step.call( this.elem, this.now, this ); |
|
|
} |
|
|
|
|
|
if ( hooks && hooks.set ) { |
|
|
hooks.set( this ); |
|
|
} else { |
|
|
Tween.propHooks._default.set( this ); |
|
|
} |
|
|
return this; |
|
|
} |
|
|
}; |
|
|
|
|
|
Tween.prototype.init.prototype = Tween.prototype; |
|
|
|
|
|
Tween.propHooks = { |
|
|
_default: { |
|
|
get: function( tween ) { |
|
|
var result; |
|
|
|
|
|
if ( tween.elem[ tween.prop ] != null && |
|
|
(!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) { |
|
|
return tween.elem[ tween.prop ]; |
|
|
} |
|
|
|
|
|
// passing an empty string as a 3rd parameter to .css will automatically |
|
|
// attempt a parseFloat and fallback to a string if the parse fails |
|
|
// so, simple values such as "10px" are parsed to Float. |
|
|
// complex values such as "rotate(1rad)" are returned as is. |
|
|
result = jQuery.css( tween.elem, tween.prop, "" ); |
|
|
// Empty strings, null, undefined and "auto" are converted to 0. |
|
|
return !result || result === "auto" ? 0 : result; |
|
|
}, |
|
|
set: function( tween ) { |
|
|
// use step hook for back compat - use cssHook if its there - use .style if its |
|
|
// available and use plain properties where available |
|
|
if ( jQuery.fx.step[ tween.prop ] ) { |
|
|
jQuery.fx.step[ tween.prop ]( tween ); |
|
|
} else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) { |
|
|
jQuery.style( tween.elem, tween.prop, tween.now + tween.unit ); |
|
|
} else { |
|
|
tween.elem[ tween.prop ] = tween.now; |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
// Remove in 2.0 - this supports IE8's panic based approach |
|
|
// to setting things on disconnected nodes |
|
|
|
|
|
Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = { |
|
|
set: function( tween ) { |
|
|
if ( tween.elem.nodeType && tween.elem.parentNode ) { |
|
|
tween.elem[ tween.prop ] = tween.now; |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.each([ "toggle", "show", "hide" ], function( i, name ) { |
|
|
var cssFn = jQuery.fn[ name ]; |
|
|
jQuery.fn[ name ] = function( speed, easing, callback ) { |
|
|
return speed == null || typeof speed === "boolean" ? |
|
|
cssFn.apply( this, arguments ) : |
|
|
this.animate( genFx( name, true ), speed, easing, callback ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.fn.extend({ |
|
|
fadeTo: function( speed, to, easing, callback ) { |
|
|
|
|
|
// show any hidden elements after setting opacity to 0 |
|
|
return this.filter( isHidden ).css( "opacity", 0 ).show() |
|
|
|
|
|
// animate to the value specified |
|
|
.end().animate({ opacity: to }, speed, easing, callback ); |
|
|
}, |
|
|
animate: function( prop, speed, easing, callback ) { |
|
|
var empty = jQuery.isEmptyObject( prop ), |
|
|
optall = jQuery.speed( speed, easing, callback ), |
|
|
doAnimation = function() { |
|
|
// Operate on a copy of prop so per-property easing won't be lost |
|
|
var anim = Animation( this, jQuery.extend( {}, prop ), optall ); |
|
|
doAnimation.finish = function() { |
|
|
anim.stop( true ); |
|
|
}; |
|
|
// Empty animations, or finishing resolves immediately |
|
|
if ( empty || jQuery._data( this, "finish" ) ) { |
|
|
anim.stop( true ); |
|
|
} |
|
|
}; |
|
|
doAnimation.finish = doAnimation; |
|
|
|
|
|
return empty || optall.queue === false ? |
|
|
this.each( doAnimation ) : |
|
|
this.queue( optall.queue, doAnimation ); |
|
|
}, |
|
|
stop: function( type, clearQueue, gotoEnd ) { |
|
|
var stopQueue = function( hooks ) { |
|
|
var stop = hooks.stop; |
|
|
delete hooks.stop; |
|
|
stop( gotoEnd ); |
|
|
}; |
|
|
|
|
|
if ( typeof type !== "string" ) { |
|
|
gotoEnd = clearQueue; |
|
|
clearQueue = type; |
|
|
type = undefined; |
|
|
} |
|
|
if ( clearQueue && type !== false ) { |
|
|
this.queue( type || "fx", [] ); |
|
|
} |
|
|
|
|
|
return this.each(function() { |
|
|
var dequeue = true, |
|
|
index = type != null && type + "queueHooks", |
|
|
timers = jQuery.timers, |
|
|
data = jQuery._data( this ); |
|
|
|
|
|
if ( index ) { |
|
|
if ( data[ index ] && data[ index ].stop ) { |
|
|
stopQueue( data[ index ] ); |
|
|
} |
|
|
} else { |
|
|
for ( index in data ) { |
|
|
if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) { |
|
|
stopQueue( data[ index ] ); |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
for ( index = timers.length; index--; ) { |
|
|
if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) { |
|
|
timers[ index ].anim.stop( gotoEnd ); |
|
|
dequeue = false; |
|
|
timers.splice( index, 1 ); |
|
|
} |
|
|
} |
|
|
|
|
|
// start the next in the queue if the last step wasn't forced |
|
|
// timers currently will call their complete callbacks, which will dequeue |
|
|
// but only if they were gotoEnd |
|
|
if ( dequeue || !gotoEnd ) { |
|
|
jQuery.dequeue( this, type ); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
finish: function( type ) { |
|
|
if ( type !== false ) { |
|
|
type = type || "fx"; |
|
|
} |
|
|
return this.each(function() { |
|
|
var index, |
|
|
data = jQuery._data( this ), |
|
|
queue = data[ type + "queue" ], |
|
|
hooks = data[ type + "queueHooks" ], |
|
|
timers = jQuery.timers, |
|
|
length = queue ? queue.length : 0; |
|
|
|
|
|
// enable finishing flag on private data |
|
|
data.finish = true; |
|
|
|
|
|
// empty the queue first |
|
|
jQuery.queue( this, type, [] ); |
|
|
|
|
|
if ( hooks && hooks.cur && hooks.cur.finish ) { |
|
|
hooks.cur.finish.call( this ); |
|
|
} |
|
|
|
|
|
// look for any active animations, and finish them |
|
|
for ( index = timers.length; index--; ) { |
|
|
if ( timers[ index ].elem === this && timers[ index ].queue === type ) { |
|
|
timers[ index ].anim.stop( true ); |
|
|
timers.splice( index, 1 ); |
|
|
} |
|
|
} |
|
|
|
|
|
// look for any animations in the old queue and finish them |
|
|
for ( index = 0; index < length; index++ ) { |
|
|
if ( queue[ index ] && queue[ index ].finish ) { |
|
|
queue[ index ].finish.call( this ); |
|
|
} |
|
|
} |
|
|
|
|
|
// turn off finishing flag |
|
|
delete data.finish; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
// Generate parameters to create a standard animation |
|
|
function genFx( type, includeWidth ) { |
|
|
var which, |
|
|
attrs = { height: type }, |
|
|
i = 0; |
|
|
|
|
|
// if we include width, step value is 1 to do all cssExpand values, |
|
|
// if we don't include width, step value is 2 to skip over Left and Right |
|
|
includeWidth = includeWidth? 1 : 0; |
|
|
for( ; i < 4 ; i += 2 - includeWidth ) { |
|
|
which = cssExpand[ i ]; |
|
|
attrs[ "margin" + which ] = attrs[ "padding" + which ] = type; |
|
|
} |
|
|
|
|
|
if ( includeWidth ) { |
|
|
attrs.opacity = attrs.width = type; |
|
|
} |
|
|
|
|
|
return attrs; |
|
|
} |
|
|
|
|
|
// Generate shortcuts for custom animations |
|
|
jQuery.each({ |
|
|
slideDown: genFx("show"), |
|
|
slideUp: genFx("hide"), |
|
|
slideToggle: genFx("toggle"), |
|
|
fadeIn: { opacity: "show" }, |
|
|
fadeOut: { opacity: "hide" }, |
|
|
fadeToggle: { opacity: "toggle" } |
|
|
}, function( name, props ) { |
|
|
jQuery.fn[ name ] = function( speed, easing, callback ) { |
|
|
return this.animate( props, speed, easing, callback ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
jQuery.speed = function( speed, easing, fn ) { |
|
|
var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : { |
|
|
complete: fn || !fn && easing || |
|
|
jQuery.isFunction( speed ) && speed, |
|
|
duration: speed, |
|
|
easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing |
|
|
}; |
|
|
|
|
|
opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration : |
|
|
opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default; |
|
|
|
|
|
// normalize opt.queue - true/undefined/null -> "fx" |
|
|
if ( opt.queue == null || opt.queue === true ) { |
|
|
opt.queue = "fx"; |
|
|
} |
|
|
|
|
|
// Queueing |
|
|
opt.old = opt.complete; |
|
|
|
|
|
opt.complete = function() { |
|
|
if ( jQuery.isFunction( opt.old ) ) { |
|
|
opt.old.call( this ); |
|
|
} |
|
|
|
|
|
if ( opt.queue ) { |
|
|
jQuery.dequeue( this, opt.queue ); |
|
|
} |
|
|
}; |
|
|
|
|
|
return opt; |
|
|
}; |
|
|
|
|
|
jQuery.easing = { |
|
|
linear: function( p ) { |
|
|
return p; |
|
|
}, |
|
|
swing: function( p ) { |
|
|
return 0.5 - Math.cos( p*Math.PI ) / 2; |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.timers = []; |
|
|
jQuery.fx = Tween.prototype.init; |
|
|
jQuery.fx.tick = function() { |
|
|
var timer, |
|
|
timers = jQuery.timers, |
|
|
i = 0; |
|
|
|
|
|
fxNow = jQuery.now(); |
|
|
|
|
|
for ( ; i < timers.length; i++ ) { |
|
|
timer = timers[ i ]; |
|
|
// Checks the timer has not already been removed |
|
|
if ( !timer() && timers[ i ] === timer ) { |
|
|
timers.splice( i--, 1 ); |
|
|
} |
|
|
} |
|
|
|
|
|
if ( !timers.length ) { |
|
|
jQuery.fx.stop(); |
|
|
} |
|
|
fxNow = undefined; |
|
|
}; |
|
|
|
|
|
jQuery.fx.timer = function( timer ) { |
|
|
if ( timer() && jQuery.timers.push( timer ) ) { |
|
|
jQuery.fx.start(); |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.fx.interval = 13; |
|
|
|
|
|
jQuery.fx.start = function() { |
|
|
if ( !timerId ) { |
|
|
timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval ); |
|
|
} |
|
|
}; |
|
|
|
|
|
jQuery.fx.stop = function() { |
|
|
clearInterval( timerId ); |
|
|
timerId = null; |
|
|
}; |
|
|
|
|
|
jQuery.fx.speeds = { |
|
|
slow: 600, |
|
|
fast: 200, |
|
|
// Default speed |
|
|
_default: 400 |
|
|
}; |
|
|
|
|
|
// Back Compat <1.8 extension point |
|
|
jQuery.fx.step = {}; |
|
|
|
|
|
if ( jQuery.expr && jQuery.expr.filters ) { |
|
|
jQuery.expr.filters.animated = function( elem ) { |
|
|
return jQuery.grep(jQuery.timers, function( fn ) { |
|
|
return elem === fn.elem; |
|
|
}).length; |
|
|
}; |
|
|
} |
|
|
jQuery.fn.offset = function( options ) { |
|
|
if ( arguments.length ) { |
|
|
return options === undefined ? |
|
|
this : |
|
|
this.each(function( i ) { |
|
|
jQuery.offset.setOffset( this, options, i ); |
|
|
}); |
|
|
} |
|
|
|
|
|
var docElem, win, |
|
|
box = { top: 0, left: 0 }, |
|
|
elem = this[ 0 ], |
|
|
doc = elem && elem.ownerDocument; |
|
|
|
|
|
if ( !doc ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
docElem = doc.documentElement; |
|
|
|
|
|
// Make sure it's not a disconnected DOM node |
|
|
if ( !jQuery.contains( docElem, elem ) ) { |
|
|
return box; |
|
|
} |
|
|
|
|
|
// If we don't have gBCR, just use 0,0 rather than error |
|
|
// BlackBerry 5, iOS 3 (original iPhone) |
|
|
if ( typeof elem.getBoundingClientRect !== core_strundefined ) { |
|
|
box = elem.getBoundingClientRect(); |
|
|
} |
|
|
win = getWindow( doc ); |
|
|
return { |
|
|
top: box.top + ( win.pageYOffset || docElem.scrollTop ) - ( docElem.clientTop || 0 ), |
|
|
left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 ) |
|
|
}; |
|
|
}; |
|
|
|
|
|
jQuery.offset = { |
|
|
|
|
|
setOffset: function( elem, options, i ) { |
|
|
var position = jQuery.css( elem, "position" ); |
|
|
|
|
|
// set position first, in-case top/left are set even on static elem |
|
|
if ( position === "static" ) { |
|
|
elem.style.position = "relative"; |
|
|
} |
|
|
|
|
|
var curElem = jQuery( elem ), |
|
|
curOffset = curElem.offset(), |
|
|
curCSSTop = jQuery.css( elem, "top" ), |
|
|
curCSSLeft = jQuery.css( elem, "left" ), |
|
|
calculatePosition = ( position === "absolute" || position === "fixed" ) && jQuery.inArray("auto", [curCSSTop, curCSSLeft]) > -1, |
|
|
props = {}, curPosition = {}, curTop, curLeft; |
|
|
|
|
|
// need to be able to calculate position if either top or left is auto and position is either absolute or fixed |
|
|
if ( calculatePosition ) { |
|
|
curPosition = curElem.position(); |
|
|
curTop = curPosition.top; |
|
|
curLeft = curPosition.left; |
|
|
} else { |
|
|
curTop = parseFloat( curCSSTop ) || 0; |
|
|
curLeft = parseFloat( curCSSLeft ) || 0; |
|
|
} |
|
|
|
|
|
if ( jQuery.isFunction( options ) ) { |
|
|
options = options.call( elem, i, curOffset ); |
|
|
} |
|
|
|
|
|
if ( options.top != null ) { |
|
|
props.top = ( options.top - curOffset.top ) + curTop; |
|
|
} |
|
|
if ( options.left != null ) { |
|
|
props.left = ( options.left - curOffset.left ) + curLeft; |
|
|
} |
|
|
|
|
|
if ( "using" in options ) { |
|
|
options.using.call( elem, props ); |
|
|
} else { |
|
|
curElem.css( props ); |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
|
|
|
jQuery.fn.extend({ |
|
|
|
|
|
position: function() { |
|
|
if ( !this[ 0 ] ) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var offsetParent, offset, |
|
|
parentOffset = { top: 0, left: 0 }, |
|
|
elem = this[ 0 ]; |
|
|
|
|
|
// fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is it's only offset parent |
|
|
if ( jQuery.css( elem, "position" ) === "fixed" ) { |
|
|
// we assume that getBoundingClientRect is available when computed position is fixed |
|
|
offset = elem.getBoundingClientRect(); |
|
|
} else { |
|
|
// Get *real* offsetParent |
|
|
offsetParent = this.offsetParent(); |
|
|
|
|
|
// Get correct offsets |
|
|
offset = this.offset(); |
|
|
if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) { |
|
|
parentOffset = offsetParent.offset(); |
|
|
} |
|
|
|
|
|
// Add offsetParent borders |
|
|
parentOffset.top += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true ); |
|
|
parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true ); |
|
|
} |
|
|
|
|
|
// Subtract parent offsets and element margins |
|
|
// note: when an element has margin: auto the offsetLeft and marginLeft |
|
|
// are the same in Safari causing offset.left to incorrectly be 0 |
|
|
return { |
|
|
top: offset.top - parentOffset.top - jQuery.css( elem, "marginTop", true ), |
|
|
left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true) |
|
|
}; |
|
|
}, |
|
|
|
|
|
offsetParent: function() { |
|
|
return this.map(function() { |
|
|
var offsetParent = this.offsetParent || document.documentElement; |
|
|
while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position") === "static" ) ) { |
|
|
offsetParent = offsetParent.offsetParent; |
|
|
} |
|
|
return offsetParent || document.documentElement; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
|
|
|
// Create scrollLeft and scrollTop methods |
|
|
jQuery.each( {scrollLeft: "pageXOffset", scrollTop: "pageYOffset"}, function( method, prop ) { |
|
|
var top = /Y/.test( prop ); |
|
|
|
|
|
jQuery.fn[ method ] = function( val ) { |
|
|
return jQuery.access( this, function( elem, method, val ) { |
|
|
var win = getWindow( elem ); |
|
|
|
|
|
if ( val === undefined ) { |
|
|
return win ? (prop in win) ? win[ prop ] : |
|
|
win.document.documentElement[ method ] : |
|
|
elem[ method ]; |
|
|
} |
|
|
|
|
|
if ( win ) { |
|
|
win.scrollTo( |
|
|
!top ? val : jQuery( win ).scrollLeft(), |
|
|
top ? val : jQuery( win ).scrollTop() |
|
|
); |
|
|
|
|
|
} else { |
|
|
elem[ method ] = val; |
|
|
} |
|
|
}, method, val, arguments.length, null ); |
|
|
}; |
|
|
}); |
|
|
|
|
|
function getWindow( elem ) { |
|
|
return jQuery.isWindow( elem ) ? |
|
|
elem : |
|
|
elem.nodeType === 9 ? |
|
|
elem.defaultView || elem.parentWindow : |
|
|
false; |
|
|
} |
|
|
// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods |
|
|
jQuery.each( { Height: "height", Width: "width" }, function( name, type ) { |
|
|
jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) { |
|
|
// margin is only for outerHeight, outerWidth |
|
|
jQuery.fn[ funcName ] = function( margin, value ) { |
|
|
var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ), |
|
|
extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" ); |
|
|
|
|
|
return jQuery.access( this, function( elem, type, value ) { |
|
|
var doc; |
|
|
|
|
|
if ( jQuery.isWindow( elem ) ) { |
|
|
// As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there |
|
|
// isn't a whole lot we can do. See pull request at this URL for discussion: |
|
|
// https://github.com/jquery/jquery/pull/764 |
|
|
return elem.document.documentElement[ "client" + name ]; |
|
|
} |
|
|
|
|
|
// Get document width or height |
|
|
if ( elem.nodeType === 9 ) { |
|
|
doc = elem.documentElement; |
|
|
|
|
|
// Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest |
|
|
// unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it. |
|
|
return Math.max( |
|
|
elem.body[ "scroll" + name ], doc[ "scroll" + name ], |
|
|
elem.body[ "offset" + name ], doc[ "offset" + name ], |
|
|
doc[ "client" + name ] |
|
|
); |
|
|
} |
|
|
|
|
|
return value === undefined ? |
|
|
// Get width or height on the element, requesting but not forcing parseFloat |
|
|
jQuery.css( elem, type, extra ) : |
|
|
|
|
|
// Set width or height on the element |
|
|
jQuery.style( elem, type, value, extra ); |
|
|
}, type, chainable ? margin : undefined, chainable, null ); |
|
|
}; |
|
|
}); |
|
|
}); |
|
|
// Limit scope pollution from any deprecated API |
|
|
// (function() { |
|
|
|
|
|
// })(); |
|
|
// Expose jQuery to the global object |
|
|
window.jQuery = window.$ = jQuery; |
|
|
|
|
|
// Expose jQuery as an AMD module, but only for AMD loaders that |
|
|
// understand the issues with loading multiple versions of jQuery |
|
|
// in a page that all might call define(). The loader will indicate |
|
|
// they have special allowances for multiple jQuery versions by |
|
|
// specifying define.amd.jQuery = true. Register as a named module, |
|
|
// since jQuery can be concatenated with other files that may use define, |
|
|
// but not use a proper concatenation script that understands anonymous |
|
|
// AMD modules. A named AMD is safest and most robust way to register. |
|
|
// Lowercase jquery is used because AMD module names are derived from |
|
|
// file names, and jQuery is normally delivered in a lowercase file name. |
|
|
// Do this after creating the global so that if an AMD module wants to call |
|
|
// noConflict to hide this version of jQuery, it will work. |
|
|
if ( typeof define === "function" && define.amd && define.amd.jQuery ) { |
|
|
define( "jquery", [], function () { return jQuery; } ); |
|
|
} |
|
|
|
|
|
})( window );/** |
|
|
* @license |
|
|
* Lodash (Custom Build) <https://lodash.com/> |
|
|
* Build: `lodash core plus="debounce,throttle,get,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference,defaultsDeep"` |
|
|
* Copyright JS Foundation and other contributors <https://js.foundation/> |
|
|
* Released under MIT license <https://lodash.com/license> |
|
|
* Based on Underscore.js 1.8.3 <http://underscorejs.org/LICENSE> |
|
|
* Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors |
|
|
*/ |
|
|
;(function() { |
|
|
|
|
|
/** Used as a safe reference for `undefined` in pre-ES5 environments. */ |
|
|
var undefined; |
|
|
|
|
|
/** Used as the semantic version number. */ |
|
|
var VERSION = '4.17.5'; |
|
|
|
|
|
/** Used as the size to enable large array optimizations. */ |
|
|
var LARGE_ARRAY_SIZE = 200; |
|
|
|
|
|
/** Error message constants. */ |
|
|
var FUNC_ERROR_TEXT = 'Expected a function'; |
|
|
|
|
|
/** Used to stand-in for `undefined` hash values. */ |
|
|
var HASH_UNDEFINED = '__lodash_hash_undefined__'; |
|
|
|
|
|
/** Used as the maximum memoize cache size. */ |
|
|
var MAX_MEMOIZE_SIZE = 500; |
|
|
|
|
|
/** Used as the internal argument placeholder. */ |
|
|
var PLACEHOLDER = '__lodash_placeholder__'; |
|
|
|
|
|
/** Used to compose bitmasks for cloning. */ |
|
|
var CLONE_DEEP_FLAG = 1, |
|
|
CLONE_FLAT_FLAG = 2, |
|
|
CLONE_SYMBOLS_FLAG = 4; |
|
|
|
|
|
/** Used to compose bitmasks for value comparisons. */ |
|
|
var COMPARE_PARTIAL_FLAG = 1, |
|
|
COMPARE_UNORDERED_FLAG = 2; |
|
|
|
|
|
/** Used to compose bitmasks for function metadata. */ |
|
|
var WRAP_BIND_FLAG = 1, |
|
|
WRAP_BIND_KEY_FLAG = 2, |
|
|
WRAP_CURRY_BOUND_FLAG = 4, |
|
|
WRAP_CURRY_FLAG = 8, |
|
|
WRAP_CURRY_RIGHT_FLAG = 16, |
|
|
WRAP_PARTIAL_FLAG = 32, |
|
|
WRAP_PARTIAL_RIGHT_FLAG = 64, |
|
|
WRAP_ARY_FLAG = 128, |
|
|
WRAP_REARG_FLAG = 256, |
|
|
WRAP_FLIP_FLAG = 512; |
|
|
|
|
|
/** Used to detect hot functions by number of calls within a span of milliseconds. */ |
|
|
var HOT_COUNT = 800, |
|
|
HOT_SPAN = 16; |
|
|
|
|
|
/** Used to indicate the type of lazy iteratees. */ |
|
|
var LAZY_FILTER_FLAG = 1, |
|
|
LAZY_MAP_FLAG = 2, |
|
|
LAZY_WHILE_FLAG = 3; |
|
|
|
|
|
/** Used as references for various `Number` constants. */ |
|
|
var INFINITY = 1 / 0, |
|
|
MAX_SAFE_INTEGER = 9007199254740991, |
|
|
MAX_INTEGER = 1.7976931348623157e+308, |
|
|
NAN = 0 / 0; |
|
|
|
|
|
/** Used as references for the maximum length and index of an array. */ |
|
|
var MAX_ARRAY_LENGTH = 4294967295; |
|
|
|
|
|
/** Used to associate wrap methods with their bit flags. */ |
|
|
var wrapFlags = [ |
|
|
['ary', WRAP_ARY_FLAG], |
|
|
['bind', WRAP_BIND_FLAG], |
|
|
['bindKey', WRAP_BIND_KEY_FLAG], |
|
|
['curry', WRAP_CURRY_FLAG], |
|
|
['curryRight', WRAP_CURRY_RIGHT_FLAG], |
|
|
['flip', WRAP_FLIP_FLAG], |
|
|
['partial', WRAP_PARTIAL_FLAG], |
|
|
['partialRight', WRAP_PARTIAL_RIGHT_FLAG], |
|
|
['rearg', WRAP_REARG_FLAG] |
|
|
]; |
|
|
|
|
|
/** `Object#toString` result references. */ |
|
|
var argsTag = '[object Arguments]', |
|
|
arrayTag = '[object Array]', |
|
|
asyncTag = '[object AsyncFunction]', |
|
|
boolTag = '[object Boolean]', |
|
|
dateTag = '[object Date]', |
|
|
errorTag = '[object Error]', |
|
|
funcTag = '[object Function]', |
|
|
genTag = '[object GeneratorFunction]', |
|
|
mapTag = '[object Map]', |
|
|
numberTag = '[object Number]', |
|
|
nullTag = '[object Null]', |
|
|
objectTag = '[object Object]', |
|
|
promiseTag = '[object Promise]', |
|
|
proxyTag = '[object Proxy]', |
|
|
regexpTag = '[object RegExp]', |
|
|
setTag = '[object Set]', |
|
|
stringTag = '[object String]', |
|
|
symbolTag = '[object Symbol]', |
|
|
undefinedTag = '[object Undefined]', |
|
|
weakMapTag = '[object WeakMap]'; |
|
|
|
|
|
var arrayBufferTag = '[object ArrayBuffer]', |
|
|
dataViewTag = '[object DataView]', |
|
|
float32Tag = '[object Float32Array]', |
|
|
float64Tag = '[object Float64Array]', |
|
|
int8Tag = '[object Int8Array]', |
|
|
int16Tag = '[object Int16Array]', |
|
|
int32Tag = '[object Int32Array]', |
|
|
uint8Tag = '[object Uint8Array]', |
|
|
uint8ClampedTag = '[object Uint8ClampedArray]', |
|
|
uint16Tag = '[object Uint16Array]', |
|
|
uint32Tag = '[object Uint32Array]'; |
|
|
|
|
|
/** Used to match HTML entities and HTML characters. */ |
|
|
var reUnescapedHtml = /[&<>"']/g, |
|
|
reHasUnescapedHtml = RegExp(reUnescapedHtml.source); |
|
|
|
|
|
/** Used to match property names within property paths. */ |
|
|
var reIsDeepProp = /\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/, |
|
|
reIsPlainProp = /^\w*$/, |
|
|
rePropName = /[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g; |
|
|
|
|
|
/** |
|
|
* Used to match `RegExp` |
|
|
* [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns). |
|
|
*/ |
|
|
var reRegExpChar = /[\\^$.*+?()[\]{}|]/g; |
|
|
|
|
|
/** Used to match leading and trailing whitespace. */ |
|
|
var reTrim = /^\s+|\s+$/g; |
|
|
|
|
|
/** Used to match wrap detail comments. */ |
|
|
var reWrapComment = /\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/, |
|
|
reWrapDetails = /\{\n\/\* \[wrapped with (.+)\] \*/, |
|
|
reSplitDetails = /,? & /; |
|
|
|
|
|
/** Used to match backslashes in property paths. */ |
|
|
var reEscapeChar = /\\(\\)?/g; |
|
|
|
|
|
/** Used to match `RegExp` flags from their coerced string values. */ |
|
|
var reFlags = /\w*$/; |
|
|
|
|
|
/** Used to detect bad signed hexadecimal string values. */ |
|
|
var reIsBadHex = /^[-+]0x[0-9a-f]+$/i; |
|
|
|
|
|
/** Used to detect binary string values. */ |
|
|
var reIsBinary = /^0b[01]+$/i; |
|
|
|
|
|
/** Used to detect host constructors (Safari). */ |
|
|
var reIsHostCtor = /^\[object .+?Constructor\]$/; |
|
|
|
|
|
/** Used to detect octal string values. */ |
|
|
var reIsOctal = /^0o[0-7]+$/i; |
|
|
|
|
|
/** Used to detect unsigned integer values. */ |
|
|
var reIsUint = /^(?:0|[1-9]\d*)$/; |
|
|
|
|
|
/** Used to compose unicode character classes. */ |
|
|
var rsAstralRange = '\\ud800-\\udfff', |
|
|
rsComboMarksRange = '\\u0300-\\u036f', |
|
|
reComboHalfMarksRange = '\\ufe20-\\ufe2f', |
|
|
rsComboSymbolsRange = '\\u20d0-\\u20ff', |
|
|
rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange, |
|
|
rsVarRange = '\\ufe0e\\ufe0f'; |
|
|
|
|
|
/** Used to compose unicode capture groups. */ |
|
|
var rsAstral = '[' + rsAstralRange + ']', |
|
|
rsCombo = '[' + rsComboRange + ']', |
|
|
rsFitz = '\\ud83c[\\udffb-\\udfff]', |
|
|
rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')', |
|
|
rsNonAstral = '[^' + rsAstralRange + ']', |
|
|
rsRegional = '(?:\\ud83c[\\udde6-\\uddff]){2}', |
|
|
rsSurrPair = '[\\ud800-\\udbff][\\udc00-\\udfff]', |
|
|
rsZWJ = '\\u200d'; |
|
|
|
|
|
/** Used to compose unicode regexes. */ |
|
|
var reOptMod = rsModifier + '?', |
|
|
rsOptVar = '[' + rsVarRange + ']?', |
|
|
rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*', |
|
|
rsSeq = rsOptVar + reOptMod + rsOptJoin, |
|
|
rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')'; |
|
|
|
|
|
/** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */ |
|
|
var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g'); |
|
|
|
|
|
/** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */ |
|
|
var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange + rsComboRange + rsVarRange + ']'); |
|
|
|
|
|
/** Used to identify `toStringTag` values of typed arrays. */ |
|
|
var typedArrayTags = {}; |
|
|
typedArrayTags[float32Tag] = typedArrayTags[float64Tag] = |
|
|
typedArrayTags[int8Tag] = typedArrayTags[int16Tag] = |
|
|
typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] = |
|
|
typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] = |
|
|
typedArrayTags[uint32Tag] = true; |
|
|
typedArrayTags[argsTag] = typedArrayTags[arrayTag] = |
|
|
typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] = |
|
|
typedArrayTags[dataViewTag] = typedArrayTags[dateTag] = |
|
|
typedArrayTags[errorTag] = typedArrayTags[funcTag] = |
|
|
typedArrayTags[mapTag] = typedArrayTags[numberTag] = |
|
|
typedArrayTags[objectTag] = typedArrayTags[regexpTag] = |
|
|
typedArrayTags[setTag] = typedArrayTags[stringTag] = |
|
|
typedArrayTags[weakMapTag] = false; |
|
|
|
|
|
/** Used to identify `toStringTag` values supported by `_.clone`. */ |
|
|
var cloneableTags = {}; |
|
|
cloneableTags[argsTag] = cloneableTags[arrayTag] = |
|
|
cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] = |
|
|
cloneableTags[boolTag] = cloneableTags[dateTag] = |
|
|
cloneableTags[float32Tag] = cloneableTags[float64Tag] = |
|
|
cloneableTags[int8Tag] = cloneableTags[int16Tag] = |
|
|
cloneableTags[int32Tag] = cloneableTags[mapTag] = |
|
|
cloneableTags[numberTag] = cloneableTags[objectTag] = |
|
|
cloneableTags[regexpTag] = cloneableTags[setTag] = |
|
|
cloneableTags[stringTag] = cloneableTags[symbolTag] = |
|
|
cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] = |
|
|
cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true; |
|
|
cloneableTags[errorTag] = cloneableTags[funcTag] = |
|
|
cloneableTags[weakMapTag] = false; |
|
|
|
|
|
/** Used to map characters to HTML entities. */ |
|
|
var htmlEscapes = { |
|
|
'&': '&', |
|
|
'<': '<', |
|
|
'>': '>', |
|
|
'"': '"', |
|
|
"'": ''' |
|
|
}; |
|
|
|
|
|
/** Built-in method references without a dependency on `root`. */ |
|
|
var freeParseFloat = parseFloat, |
|
|
freeParseInt = parseInt; |
|
|
|
|
|
/** Detect free variable `global` from Node.js. */ |
|
|
var freeGlobal = typeof global == 'object' && global && global.Object === Object && global; |
|
|
|
|
|
/** Detect free variable `self`. */ |
|
|
var freeSelf = typeof self == 'object' && self && self.Object === Object && self; |
|
|
|
|
|
/** Used as a reference to the global object. */ |
|
|
var root = freeGlobal || freeSelf || Function('return this')(); |
|
|
|
|
|
/** Detect free variable `exports`. */ |
|
|
var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports; |
|
|
|
|
|
/** Detect free variable `module`. */ |
|
|
var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module; |
|
|
|
|
|
/** Detect the popular CommonJS extension `module.exports`. */ |
|
|
var moduleExports = freeModule && freeModule.exports === freeExports; |
|
|
|
|
|
/** Detect free variable `process` from Node.js. */ |
|
|
var freeProcess = moduleExports && freeGlobal.process; |
|
|
|
|
|
/** Used to access faster Node.js helpers. */ |
|
|
var nodeUtil = (function() { |
|
|
try { |
|
|
return freeProcess && freeProcess.binding && freeProcess.binding('util'); |
|
|
} catch (e) {} |
|
|
}()); |
|
|
|
|
|
/* Node.js helper references. */ |
|
|
var nodeIsDate = nodeUtil && nodeUtil.isDate, |
|
|
nodeIsMap = nodeUtil && nodeUtil.isMap, |
|
|
nodeIsRegExp = nodeUtil && nodeUtil.isRegExp, |
|
|
nodeIsSet = nodeUtil && nodeUtil.isSet, |
|
|
nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray; |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* A faster alternative to `Function#apply`, this function invokes `func` |
|
|
* with the `this` binding of `thisArg` and the arguments of `args`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to invoke. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {Array} args The arguments to invoke `func` with. |
|
|
* @returns {*} Returns the result of `func`. |
|
|
*/ |
|
|
function apply(func, thisArg, args) { |
|
|
switch (args.length) { |
|
|
case 0: return func.call(thisArg); |
|
|
case 1: return func.call(thisArg, args[0]); |
|
|
case 2: return func.call(thisArg, args[0], args[1]); |
|
|
case 3: return func.call(thisArg, args[0], args[1], args[2]); |
|
|
} |
|
|
return func.apply(thisArg, args); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseAggregator` for arrays. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform keys. |
|
|
* @param {Object} accumulator The initial aggregated object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function arrayAggregator(array, setter, iteratee, accumulator) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
setter(accumulator, value, iteratee(value), array); |
|
|
} |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.forEach` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function arrayEach(array, iteratee) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (iteratee(array[index], index, array) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.every` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function arrayEvery(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (!predicate(array[index], index, array)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.filter` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
*/ |
|
|
function arrayFilter(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (predicate(value, index, array)) { |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.includes` for arrays without support for |
|
|
* specifying an index to search from. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to inspect. |
|
|
* @param {*} target The value to search for. |
|
|
* @returns {boolean} Returns `true` if `target` is found, else `false`. |
|
|
*/ |
|
|
function arrayIncludes(array, value) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return !!length && baseIndexOf(array, value, 0) > -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like `arrayIncludes` except that it accepts a comparator. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to inspect. |
|
|
* @param {*} target The value to search for. |
|
|
* @param {Function} comparator The comparator invoked per element. |
|
|
* @returns {boolean} Returns `true` if `target` is found, else `false`. |
|
|
*/ |
|
|
function arrayIncludesWith(array, value, comparator) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (comparator(value, array[index])) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.map` for arrays without support for iteratee |
|
|
* shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
*/ |
|
|
function arrayMap(array, iteratee) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
result = Array(length); |
|
|
|
|
|
while (++index < length) { |
|
|
result[index] = iteratee(array[index], index, array); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Appends the elements of `values` to `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to modify. |
|
|
* @param {Array} values The values to append. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function arrayPush(array, values) { |
|
|
var index = -1, |
|
|
length = values.length, |
|
|
offset = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
array[offset + index] = values[index]; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.reduce` for arrays without support for |
|
|
* iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {*} [accumulator] The initial value. |
|
|
* @param {boolean} [initAccum] Specify using the first element of `array` as |
|
|
* the initial value. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
*/ |
|
|
function arrayReduce(array, iteratee, accumulator, initAccum) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
if (initAccum && length) { |
|
|
accumulator = array[++index]; |
|
|
} |
|
|
while (++index < length) { |
|
|
accumulator = iteratee(accumulator, array[index], index, array); |
|
|
} |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.some` for arrays without support for iteratee |
|
|
* shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} [array] The array to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function arraySome(array, predicate) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (predicate(array[index], index, array)) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of an ASCII `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
var asciiSize = baseProperty('length'); |
|
|
|
|
|
/** |
|
|
* Converts an ASCII `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function asciiToArray(string) { |
|
|
return string.split(''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.findKey` and `_.findLastKey`, |
|
|
* without support for iteratee shorthands, which iterates over `collection` |
|
|
* using `eachFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to inspect. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @param {Function} eachFunc The function to iterate over `collection`. |
|
|
* @returns {*} Returns the found element or its key, else `undefined`. |
|
|
*/ |
|
|
function baseFindKey(collection, predicate, eachFunc) { |
|
|
var result; |
|
|
eachFunc(collection, function(value, key, collection) { |
|
|
if (predicate(value, key, collection)) { |
|
|
result = key; |
|
|
return false; |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.findIndex` and `_.findLastIndex` without |
|
|
* support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function baseFindIndex(array, predicate, fromIndex, fromRight) { |
|
|
var length = array.length, |
|
|
index = fromIndex + (fromRight ? 1 : -1); |
|
|
|
|
|
while ((fromRight ? index-- : ++index < length)) { |
|
|
if (predicate(array[index], index, array)) { |
|
|
return index; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.indexOf` without `fromIndex` bounds checks. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function baseIndexOf(array, value, fromIndex) { |
|
|
return value === value |
|
|
? strictIndexOf(array, value, fromIndex) |
|
|
: baseFindIndex(array, baseIsNaN, fromIndex); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isNaN` without support for number objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `NaN`, else `false`. |
|
|
*/ |
|
|
function baseIsNaN(value) { |
|
|
return value !== value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.property` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {string} key The key of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function baseProperty(key) { |
|
|
return function(object) { |
|
|
return object == null ? undefined : object[key]; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.propertyOf` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function basePropertyOf(object) { |
|
|
return function(key) { |
|
|
return object == null ? undefined : object[key]; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.reduce` and `_.reduceRight`, without support |
|
|
* for iteratee shorthands, which iterates over `collection` using `eachFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {*} accumulator The initial value. |
|
|
* @param {boolean} initAccum Specify using the first or last element of |
|
|
* `collection` as the initial value. |
|
|
* @param {Function} eachFunc The function to iterate over `collection`. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
*/ |
|
|
function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) { |
|
|
eachFunc(collection, function(value, index, collection) { |
|
|
accumulator = initAccum |
|
|
? (initAccum = false, value) |
|
|
: iteratee(accumulator, value, index, collection); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.sortBy` which uses `comparer` to define the |
|
|
* sort order of `array` and replaces criteria objects with their corresponding |
|
|
* values. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to sort. |
|
|
* @param {Function} comparer The function to define sort order. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function baseSortBy(array, comparer) { |
|
|
var length = array.length; |
|
|
|
|
|
array.sort(comparer); |
|
|
while (length--) { |
|
|
array[length] = array[length].value; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.times` without support for iteratee shorthands |
|
|
* or max array length checks. |
|
|
* |
|
|
* @private |
|
|
* @param {number} n The number of times to invoke `iteratee`. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the array of results. |
|
|
*/ |
|
|
function baseTimes(n, iteratee) { |
|
|
var index = -1, |
|
|
result = Array(n); |
|
|
|
|
|
while (++index < n) { |
|
|
result[index] = iteratee(index); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.unary` without support for storing metadata. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to cap arguments for. |
|
|
* @returns {Function} Returns the new capped function. |
|
|
*/ |
|
|
function baseUnary(func) { |
|
|
return function(value) { |
|
|
return func(value); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.values` and `_.valuesIn` which creates an |
|
|
* array of `object` property values corresponding to the property names |
|
|
* of `props`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array} props The property names to get values for. |
|
|
* @returns {Object} Returns the array of property values. |
|
|
*/ |
|
|
function baseValues(object, props) { |
|
|
return arrayMap(props, function(key) { |
|
|
return object[key]; |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a `cache` value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} cache The cache to query. |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function cacheHas(cache, key) { |
|
|
return cache.has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the number of `placeholder` occurrences in `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} placeholder The placeholder to search for. |
|
|
* @returns {number} Returns the placeholder count. |
|
|
*/ |
|
|
function countHolders(array, placeholder) { |
|
|
var length = array.length, |
|
|
result = 0; |
|
|
|
|
|
while (length--) { |
|
|
if (array[length] === placeholder) { |
|
|
++result; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.escape` to convert characters to HTML entities. |
|
|
* |
|
|
* @private |
|
|
* @param {string} chr The matched character to escape. |
|
|
* @returns {string} Returns the escaped character. |
|
|
*/ |
|
|
var escapeHtmlChar = basePropertyOf(htmlEscapes); |
|
|
|
|
|
/** |
|
|
* Gets the value at `key` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {string} key The key of the property to get. |
|
|
* @returns {*} Returns the property value. |
|
|
*/ |
|
|
function getValue(object, key) { |
|
|
return object == null ? undefined : object[key]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `string` contains Unicode symbols. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to inspect. |
|
|
* @returns {boolean} Returns `true` if a symbol is found, else `false`. |
|
|
*/ |
|
|
function hasUnicode(string) { |
|
|
return reHasUnicode.test(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `iterator` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} iterator The iterator to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function iteratorToArray(iterator) { |
|
|
var data, |
|
|
result = []; |
|
|
|
|
|
while (!(data = iterator.next()).done) { |
|
|
result.push(data.value); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `map` to its key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} map The map to convert. |
|
|
* @returns {Array} Returns the key-value pairs. |
|
|
*/ |
|
|
function mapToArray(map) { |
|
|
var index = -1, |
|
|
result = Array(map.size); |
|
|
|
|
|
map.forEach(function(value, key) { |
|
|
result[++index] = [key, value]; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a unary function that invokes `func` with its argument transformed. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {Function} transform The argument transform. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function overArg(func, transform) { |
|
|
return function(arg) { |
|
|
return func(transform(arg)); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Replaces all `placeholder` elements in `array` with an internal placeholder |
|
|
* and returns an array of their indexes. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to modify. |
|
|
* @param {*} placeholder The placeholder to replace. |
|
|
* @returns {Array} Returns the new array of placeholder indexes. |
|
|
*/ |
|
|
function replaceHolders(array, placeholder) { |
|
|
var index = -1, |
|
|
length = array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (value === placeholder || value === PLACEHOLDER) { |
|
|
array[index] = PLACEHOLDER; |
|
|
result[resIndex++] = index; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the value at `key`, unless `key` is "__proto__". |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {string} key The key of the property to get. |
|
|
* @returns {*} Returns the property value. |
|
|
*/ |
|
|
function safeGet(object, key) { |
|
|
return key == '__proto__' |
|
|
? undefined |
|
|
: object[key]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `set` to an array of its values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} set The set to convert. |
|
|
* @returns {Array} Returns the values. |
|
|
*/ |
|
|
function setToArray(set) { |
|
|
var index = -1, |
|
|
result = Array(set.size); |
|
|
|
|
|
set.forEach(function(value) { |
|
|
result[++index] = value; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.indexOf` which performs strict equality |
|
|
* comparisons of values, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} fromIndex The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function strictIndexOf(array, value, fromIndex) { |
|
|
var index = fromIndex - 1, |
|
|
length = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
if (array[index] === value) { |
|
|
return index; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the number of symbols in `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
function stringSize(string) { |
|
|
return hasUnicode(string) |
|
|
? unicodeSize(string) |
|
|
: asciiSize(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function stringToArray(string) { |
|
|
return hasUnicode(string) |
|
|
? unicodeToArray(string) |
|
|
: asciiToArray(string); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of a Unicode `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string inspect. |
|
|
* @returns {number} Returns the string size. |
|
|
*/ |
|
|
function unicodeSize(string) { |
|
|
var result = reUnicode.lastIndex = 0; |
|
|
while (reUnicode.test(string)) { |
|
|
++result; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts a Unicode `string` to an array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
*/ |
|
|
function unicodeToArray(string) { |
|
|
return string.match(reUnicode) || []; |
|
|
} |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
/** Used for built-in method references. */ |
|
|
var arrayProto = Array.prototype, |
|
|
funcProto = Function.prototype, |
|
|
objectProto = Object.prototype; |
|
|
|
|
|
/** Used to detect overreaching core-js shims. */ |
|
|
var coreJsData = root['__core-js_shared__']; |
|
|
|
|
|
/** Used to resolve the decompiled source of functions. */ |
|
|
var funcToString = funcProto.toString; |
|
|
|
|
|
/** Used to check objects for own properties. */ |
|
|
var hasOwnProperty = objectProto.hasOwnProperty; |
|
|
|
|
|
/** Used to generate unique IDs. */ |
|
|
var idCounter = 0; |
|
|
|
|
|
/** Used to detect methods masquerading as native. */ |
|
|
var maskSrcKey = (function() { |
|
|
var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || ''); |
|
|
return uid ? ('Symbol(src)_1.' + uid) : ''; |
|
|
}()); |
|
|
|
|
|
/** |
|
|
* Used to resolve the |
|
|
* [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring) |
|
|
* of values. |
|
|
*/ |
|
|
var nativeObjectToString = objectProto.toString; |
|
|
|
|
|
/** Used to infer the `Object` constructor. */ |
|
|
var objectCtorString = funcToString.call(Object); |
|
|
|
|
|
/** Used to restore the original `_` reference in `_.noConflict`. */ |
|
|
var oldDash = root._; |
|
|
|
|
|
/** Used to detect if a method is native. */ |
|
|
var reIsNative = RegExp('^' + |
|
|
funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\$&') |
|
|
.replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g, '$1.*?') + '$' |
|
|
); |
|
|
|
|
|
/** Built-in value references. */ |
|
|
var Buffer = moduleExports ? root.Buffer : undefined, |
|
|
Symbol = root.Symbol, |
|
|
Uint8Array = root.Uint8Array, |
|
|
allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined, |
|
|
getPrototype = overArg(Object.getPrototypeOf, Object), |
|
|
objectCreate = Object.create, |
|
|
propertyIsEnumerable = objectProto.propertyIsEnumerable, |
|
|
splice = arrayProto.splice, |
|
|
spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined, |
|
|
symIterator = Symbol ? Symbol.iterator : undefined, |
|
|
symToStringTag = Symbol ? Symbol.toStringTag : undefined; |
|
|
|
|
|
var defineProperty = (function() { |
|
|
try { |
|
|
var func = getNative(Object, 'defineProperty'); |
|
|
func({}, '', {}); |
|
|
return func; |
|
|
} catch (e) {} |
|
|
}()); |
|
|
|
|
|
/* Built-in method references for those with the same name as other `lodash` methods. */ |
|
|
var nativeCeil = Math.ceil, |
|
|
nativeFloor = Math.floor, |
|
|
nativeGetSymbols = Object.getOwnPropertySymbols, |
|
|
nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined, |
|
|
nativeIsFinite = root.isFinite, |
|
|
nativeKeys = overArg(Object.keys, Object), |
|
|
nativeMax = Math.max, |
|
|
nativeMin = Math.min, |
|
|
nativeNow = Date.now, |
|
|
nativeRandom = Math.random, |
|
|
nativeReverse = arrayProto.reverse; |
|
|
|
|
|
/* Built-in method references that are verified to be native. */ |
|
|
var DataView = getNative(root, 'DataView'), |
|
|
Map = getNative(root, 'Map'), |
|
|
Promise = getNative(root, 'Promise'), |
|
|
Set = getNative(root, 'Set'), |
|
|
WeakMap = getNative(root, 'WeakMap'), |
|
|
nativeCreate = getNative(Object, 'create'); |
|
|
|
|
|
/** Used to store function metadata. */ |
|
|
var metaMap = WeakMap && new WeakMap; |
|
|
|
|
|
/** Used to lookup unminified function names. */ |
|
|
var realNames = {}; |
|
|
|
|
|
/** Used to detect maps, sets, and weakmaps. */ |
|
|
var dataViewCtorString = toSource(DataView), |
|
|
mapCtorString = toSource(Map), |
|
|
promiseCtorString = toSource(Promise), |
|
|
setCtorString = toSource(Set), |
|
|
weakMapCtorString = toSource(WeakMap); |
|
|
|
|
|
/** Used to convert symbols to primitives and strings. */ |
|
|
var symbolProto = Symbol ? Symbol.prototype : undefined, |
|
|
symbolValueOf = symbolProto ? symbolProto.valueOf : undefined, |
|
|
symbolToString = symbolProto ? symbolProto.toString : undefined; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` object which wraps `value` to enable implicit method |
|
|
* chain sequences. Methods that operate on and return arrays, collections, |
|
|
* and functions can be chained together. Methods that retrieve a single value |
|
|
* or may return a primitive value will automatically end the chain sequence |
|
|
* and return the unwrapped value. Otherwise, the value must be unwrapped |
|
|
* with `_#value`. |
|
|
* |
|
|
* Explicit chain sequences, which must be unwrapped with `_#value`, may be |
|
|
* enabled using `_.chain`. |
|
|
* |
|
|
* The execution of chained methods is lazy, that is, it's deferred until |
|
|
* `_#value` is implicitly or explicitly called. |
|
|
* |
|
|
* Lazy evaluation allows several methods to support shortcut fusion. |
|
|
* Shortcut fusion is an optimization to merge iteratee calls; this avoids |
|
|
* the creation of intermediate arrays and can greatly reduce the number of |
|
|
* iteratee executions. Sections of a chain sequence qualify for shortcut |
|
|
* fusion if the section is applied to an array and iteratees accept only |
|
|
* one argument. The heuristic for whether a section qualifies for shortcut |
|
|
* fusion is subject to change. |
|
|
* |
|
|
* Chaining is supported in custom builds as long as the `_#value` method is |
|
|
* directly or indirectly included in the build. |
|
|
* |
|
|
* In addition to lodash methods, wrappers have `Array` and `String` methods. |
|
|
* |
|
|
* The wrapper `Array` methods are: |
|
|
* `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift` |
|
|
* |
|
|
* The wrapper `String` methods are: |
|
|
* `replace` and `split` |
|
|
* |
|
|
* The wrapper methods that support shortcut fusion are: |
|
|
* `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`, |
|
|
* `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`, |
|
|
* `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray` |
|
|
* |
|
|
* The chainable wrapper methods are: |
|
|
* `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`, |
|
|
* `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`, |
|
|
* `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`, |
|
|
* `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`, |
|
|
* `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`, |
|
|
* `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`, |
|
|
* `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`, |
|
|
* `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`, |
|
|
* `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`, |
|
|
* `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`, |
|
|
* `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`, |
|
|
* `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`, |
|
|
* `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`, |
|
|
* `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`, |
|
|
* `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`, |
|
|
* `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`, |
|
|
* `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`, |
|
|
* `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`, |
|
|
* `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`, |
|
|
* `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`, |
|
|
* `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`, |
|
|
* `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`, |
|
|
* `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`, |
|
|
* `zipObject`, `zipObjectDeep`, and `zipWith` |
|
|
* |
|
|
* The wrapper methods that are **not** chainable by default are: |
|
|
* `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`, |
|
|
* `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`, |
|
|
* `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`, |
|
|
* `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`, |
|
|
* `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`, |
|
|
* `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`, |
|
|
* `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`, |
|
|
* `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`, |
|
|
* `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`, |
|
|
* `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`, |
|
|
* `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`, |
|
|
* `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`, |
|
|
* `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`, |
|
|
* `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`, |
|
|
* `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`, |
|
|
* `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`, |
|
|
* `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`, |
|
|
* `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`, |
|
|
* `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`, |
|
|
* `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`, |
|
|
* `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`, |
|
|
* `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`, |
|
|
* `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`, |
|
|
* `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`, |
|
|
* `upperFirst`, `value`, and `words` |
|
|
* |
|
|
* @name _ |
|
|
* @constructor |
|
|
* @category Seq |
|
|
* @param {*} value The value to wrap in a `lodash` instance. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* var wrapped = _([1, 2, 3]); |
|
|
* |
|
|
* // Returns an unwrapped value. |
|
|
* wrapped.reduce(_.add); |
|
|
* // => 6 |
|
|
* |
|
|
* // Returns a wrapped value. |
|
|
* var squares = wrapped.map(square); |
|
|
* |
|
|
* _.isArray(squares); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray(squares.value()); |
|
|
* // => true |
|
|
*/ |
|
|
function lodash(value) { |
|
|
if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) { |
|
|
if (value instanceof LodashWrapper) { |
|
|
return value; |
|
|
} |
|
|
if (hasOwnProperty.call(value, '__wrapped__')) { |
|
|
return wrapperClone(value); |
|
|
} |
|
|
} |
|
|
return new LodashWrapper(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.create` without support for assigning |
|
|
* properties to the created object. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} proto The object to inherit from. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
var baseCreate = (function() { |
|
|
function object() {} |
|
|
return function(proto) { |
|
|
if (!isObject(proto)) { |
|
|
return {}; |
|
|
} |
|
|
if (objectCreate) { |
|
|
return objectCreate(proto); |
|
|
} |
|
|
object.prototype = proto; |
|
|
var result = new object; |
|
|
object.prototype = undefined; |
|
|
return result; |
|
|
}; |
|
|
}()); |
|
|
|
|
|
/** |
|
|
* The function whose prototype chain sequence wrappers inherit from. |
|
|
* |
|
|
* @private |
|
|
*/ |
|
|
function baseLodash() { |
|
|
// No operation performed. |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base constructor for creating `lodash` wrapper objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to wrap. |
|
|
* @param {boolean} [chainAll] Enable explicit method chain sequences. |
|
|
*/ |
|
|
function LodashWrapper(value, chainAll) { |
|
|
this.__wrapped__ = value; |
|
|
this.__actions__ = []; |
|
|
this.__chain__ = !!chainAll; |
|
|
this.__index__ = 0; |
|
|
this.__values__ = undefined; |
|
|
} |
|
|
|
|
|
// Ensure wrappers are instances of `baseLodash`. |
|
|
lodash.prototype = baseLodash.prototype; |
|
|
lodash.prototype.constructor = lodash; |
|
|
|
|
|
LodashWrapper.prototype = baseCreate(baseLodash.prototype); |
|
|
LodashWrapper.prototype.constructor = LodashWrapper; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a lazy wrapper object which wraps `value` to enable lazy evaluation. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {*} value The value to wrap. |
|
|
*/ |
|
|
function LazyWrapper(value) { |
|
|
this.__wrapped__ = value; |
|
|
this.__actions__ = []; |
|
|
this.__dir__ = 1; |
|
|
this.__filtered__ = false; |
|
|
this.__iteratees__ = []; |
|
|
this.__takeCount__ = MAX_ARRAY_LENGTH; |
|
|
this.__views__ = []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the lazy wrapper object. |
|
|
* |
|
|
* @private |
|
|
* @name clone |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {Object} Returns the cloned `LazyWrapper` object. |
|
|
*/ |
|
|
function lazyClone() { |
|
|
var result = new LazyWrapper(this.__wrapped__); |
|
|
result.__actions__ = copyArray(this.__actions__); |
|
|
result.__dir__ = this.__dir__; |
|
|
result.__filtered__ = this.__filtered__; |
|
|
result.__iteratees__ = copyArray(this.__iteratees__); |
|
|
result.__takeCount__ = this.__takeCount__; |
|
|
result.__views__ = copyArray(this.__views__); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverses the direction of lazy iteration. |
|
|
* |
|
|
* @private |
|
|
* @name reverse |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {Object} Returns the new reversed `LazyWrapper` object. |
|
|
*/ |
|
|
function lazyReverse() { |
|
|
if (this.__filtered__) { |
|
|
var result = new LazyWrapper(this); |
|
|
result.__dir__ = -1; |
|
|
result.__filtered__ = true; |
|
|
} else { |
|
|
result = this.clone(); |
|
|
result.__dir__ *= -1; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Extracts the unwrapped value from its lazy wrapper. |
|
|
* |
|
|
* @private |
|
|
* @name value |
|
|
* @memberOf LazyWrapper |
|
|
* @returns {*} Returns the unwrapped value. |
|
|
*/ |
|
|
function lazyValue() { |
|
|
var array = this.__wrapped__.value(), |
|
|
dir = this.__dir__, |
|
|
isArr = isArray(array), |
|
|
isRight = dir < 0, |
|
|
arrLength = isArr ? array.length : 0, |
|
|
view = getView(0, arrLength, this.__views__), |
|
|
start = view.start, |
|
|
end = view.end, |
|
|
length = end - start, |
|
|
index = isRight ? end : (start - 1), |
|
|
iteratees = this.__iteratees__, |
|
|
iterLength = iteratees.length, |
|
|
resIndex = 0, |
|
|
takeCount = nativeMin(length, this.__takeCount__); |
|
|
|
|
|
if (!isArr || (!isRight && arrLength == length && takeCount == length)) { |
|
|
return baseWrapperValue(array, this.__actions__); |
|
|
} |
|
|
var result = []; |
|
|
|
|
|
outer: |
|
|
while (length-- && resIndex < takeCount) { |
|
|
index += dir; |
|
|
|
|
|
var iterIndex = -1, |
|
|
value = array[index]; |
|
|
|
|
|
while (++iterIndex < iterLength) { |
|
|
var data = iteratees[iterIndex], |
|
|
iteratee = data.iteratee, |
|
|
type = data.type, |
|
|
computed = iteratee(value); |
|
|
|
|
|
if (type == LAZY_MAP_FLAG) { |
|
|
value = computed; |
|
|
} else if (!computed) { |
|
|
if (type == LAZY_FILTER_FLAG) { |
|
|
continue outer; |
|
|
} else { |
|
|
break outer; |
|
|
} |
|
|
} |
|
|
} |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
// Ensure `LazyWrapper` is an instance of `baseLodash`. |
|
|
LazyWrapper.prototype = baseCreate(baseLodash.prototype); |
|
|
LazyWrapper.prototype.constructor = LazyWrapper; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a hash object. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function Hash(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the hash. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf Hash |
|
|
*/ |
|
|
function hashClear() { |
|
|
this.__data__ = nativeCreate ? nativeCreate(null) : {}; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the hash. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf Hash |
|
|
* @param {Object} hash The hash to modify. |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function hashDelete(key) { |
|
|
var result = this.has(key) && delete this.__data__[key]; |
|
|
this.size -= result ? 1 : 0; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the hash value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function hashGet(key) { |
|
|
var data = this.__data__; |
|
|
if (nativeCreate) { |
|
|
var result = data[key]; |
|
|
return result === HASH_UNDEFINED ? undefined : result; |
|
|
} |
|
|
return hasOwnProperty.call(data, key) ? data[key] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a hash value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function hashHas(key) { |
|
|
var data = this.__data__; |
|
|
return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the hash `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf Hash |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the hash instance. |
|
|
*/ |
|
|
function hashSet(key, value) { |
|
|
var data = this.__data__; |
|
|
this.size += this.has(key) ? 0 : 1; |
|
|
data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `Hash`. |
|
|
Hash.prototype.clear = hashClear; |
|
|
Hash.prototype['delete'] = hashDelete; |
|
|
Hash.prototype.get = hashGet; |
|
|
Hash.prototype.has = hashHas; |
|
|
Hash.prototype.set = hashSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an list cache object. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function ListCache(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the list cache. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf ListCache |
|
|
*/ |
|
|
function listCacheClear() { |
|
|
this.__data__ = []; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the list cache. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function listCacheDelete(key) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
if (index < 0) { |
|
|
return false; |
|
|
} |
|
|
var lastIndex = data.length - 1; |
|
|
if (index == lastIndex) { |
|
|
data.pop(); |
|
|
} else { |
|
|
splice.call(data, index, 1); |
|
|
} |
|
|
--this.size; |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the list cache value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function listCacheGet(key) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
return index < 0 ? undefined : data[index][1]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a list cache value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function listCacheHas(key) { |
|
|
return assocIndexOf(this.__data__, key) > -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the list cache `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf ListCache |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the list cache instance. |
|
|
*/ |
|
|
function listCacheSet(key, value) { |
|
|
var data = this.__data__, |
|
|
index = assocIndexOf(data, key); |
|
|
|
|
|
if (index < 0) { |
|
|
++this.size; |
|
|
data.push([key, value]); |
|
|
} else { |
|
|
data[index][1] = value; |
|
|
} |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `ListCache`. |
|
|
ListCache.prototype.clear = listCacheClear; |
|
|
ListCache.prototype['delete'] = listCacheDelete; |
|
|
ListCache.prototype.get = listCacheGet; |
|
|
ListCache.prototype.has = listCacheHas; |
|
|
ListCache.prototype.set = listCacheSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a map cache object to store key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function MapCache(entries) { |
|
|
var index = -1, |
|
|
length = entries == null ? 0 : entries.length; |
|
|
|
|
|
this.clear(); |
|
|
while (++index < length) { |
|
|
var entry = entries[index]; |
|
|
this.set(entry[0], entry[1]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the map. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf MapCache |
|
|
*/ |
|
|
function mapCacheClear() { |
|
|
this.size = 0; |
|
|
this.__data__ = { |
|
|
'hash': new Hash, |
|
|
'map': new (Map || ListCache), |
|
|
'string': new Hash |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the map. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function mapCacheDelete(key) { |
|
|
var result = getMapData(this, key)['delete'](key); |
|
|
this.size -= result ? 1 : 0; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the map value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function mapCacheGet(key) { |
|
|
return getMapData(this, key).get(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a map value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function mapCacheHas(key) { |
|
|
return getMapData(this, key).has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the map `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf MapCache |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the map cache instance. |
|
|
*/ |
|
|
function mapCacheSet(key, value) { |
|
|
var data = getMapData(this, key), |
|
|
size = data.size; |
|
|
|
|
|
data.set(key, value); |
|
|
this.size += data.size == size ? 0 : 1; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `MapCache`. |
|
|
MapCache.prototype.clear = mapCacheClear; |
|
|
MapCache.prototype['delete'] = mapCacheDelete; |
|
|
MapCache.prototype.get = mapCacheGet; |
|
|
MapCache.prototype.has = mapCacheHas; |
|
|
MapCache.prototype.set = mapCacheSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* |
|
|
* Creates an array cache object to store unique values. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [values] The values to cache. |
|
|
*/ |
|
|
function SetCache(values) { |
|
|
var index = -1, |
|
|
length = values == null ? 0 : values.length; |
|
|
|
|
|
this.__data__ = new MapCache; |
|
|
while (++index < length) { |
|
|
this.add(values[index]); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Adds `value` to the array cache. |
|
|
* |
|
|
* @private |
|
|
* @name add |
|
|
* @memberOf SetCache |
|
|
* @alias push |
|
|
* @param {*} value The value to cache. |
|
|
* @returns {Object} Returns the cache instance. |
|
|
*/ |
|
|
function setCacheAdd(value) { |
|
|
this.__data__.set(value, HASH_UNDEFINED); |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is in the array cache. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf SetCache |
|
|
* @param {*} value The value to search for. |
|
|
* @returns {number} Returns `true` if `value` is found, else `false`. |
|
|
*/ |
|
|
function setCacheHas(value) { |
|
|
return this.__data__.has(value); |
|
|
} |
|
|
|
|
|
// Add methods to `SetCache`. |
|
|
SetCache.prototype.add = SetCache.prototype.push = setCacheAdd; |
|
|
SetCache.prototype.has = setCacheHas; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a stack cache object to store key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @constructor |
|
|
* @param {Array} [entries] The key-value pairs to cache. |
|
|
*/ |
|
|
function Stack(entries) { |
|
|
var data = this.__data__ = new ListCache(entries); |
|
|
this.size = data.size; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes all key-value entries from the stack. |
|
|
* |
|
|
* @private |
|
|
* @name clear |
|
|
* @memberOf Stack |
|
|
*/ |
|
|
function stackClear() { |
|
|
this.__data__ = new ListCache; |
|
|
this.size = 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Removes `key` and its value from the stack. |
|
|
* |
|
|
* @private |
|
|
* @name delete |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to remove. |
|
|
* @returns {boolean} Returns `true` if the entry was removed, else `false`. |
|
|
*/ |
|
|
function stackDelete(key) { |
|
|
var data = this.__data__, |
|
|
result = data['delete'](key); |
|
|
|
|
|
this.size = data.size; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the stack value for `key`. |
|
|
* |
|
|
* @private |
|
|
* @name get |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to get. |
|
|
* @returns {*} Returns the entry value. |
|
|
*/ |
|
|
function stackGet(key) { |
|
|
return this.__data__.get(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if a stack value for `key` exists. |
|
|
* |
|
|
* @private |
|
|
* @name has |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the entry to check. |
|
|
* @returns {boolean} Returns `true` if an entry for `key` exists, else `false`. |
|
|
*/ |
|
|
function stackHas(key) { |
|
|
return this.__data__.has(key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets the stack `key` to `value`. |
|
|
* |
|
|
* @private |
|
|
* @name set |
|
|
* @memberOf Stack |
|
|
* @param {string} key The key of the value to set. |
|
|
* @param {*} value The value to set. |
|
|
* @returns {Object} Returns the stack cache instance. |
|
|
*/ |
|
|
function stackSet(key, value) { |
|
|
var data = this.__data__; |
|
|
if (data instanceof ListCache) { |
|
|
var pairs = data.__data__; |
|
|
if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) { |
|
|
pairs.push([key, value]); |
|
|
this.size = ++data.size; |
|
|
return this; |
|
|
} |
|
|
data = this.__data__ = new MapCache(pairs); |
|
|
} |
|
|
data.set(key, value); |
|
|
this.size = data.size; |
|
|
return this; |
|
|
} |
|
|
|
|
|
// Add methods to `Stack`. |
|
|
Stack.prototype.clear = stackClear; |
|
|
Stack.prototype['delete'] = stackDelete; |
|
|
Stack.prototype.get = stackGet; |
|
|
Stack.prototype.has = stackHas; |
|
|
Stack.prototype.set = stackSet; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an array of the enumerable property names of the array-like `value`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @param {boolean} inherited Specify returning inherited property names. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function arrayLikeKeys(value, inherited) { |
|
|
var isArr = isArray(value), |
|
|
isArg = !isArr && isArguments(value), |
|
|
isBuff = !isArr && !isArg && isBuffer(value), |
|
|
isType = !isArr && !isArg && !isBuff && isTypedArray(value), |
|
|
skipIndexes = isArr || isArg || isBuff || isType, |
|
|
result = skipIndexes ? baseTimes(value.length, String) : [], |
|
|
length = result.length; |
|
|
|
|
|
for (var key in value) { |
|
|
if ((inherited || hasOwnProperty.call(value, key)) && |
|
|
!(skipIndexes && ( |
|
|
// Safari 9 has enumerable `arguments.length` in strict mode. |
|
|
key == 'length' || |
|
|
// Node.js 0.10 has enumerable non-index properties on buffers. |
|
|
(isBuff && (key == 'offset' || key == 'parent')) || |
|
|
// PhantomJS 2 has enumerable non-index properties on typed arrays. |
|
|
(isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) || |
|
|
// Skip index properties. |
|
|
isIndex(key, length) |
|
|
))) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like `assignValue` except that it doesn't assign |
|
|
* `undefined` values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {string} key The key of the property to assign. |
|
|
* @param {*} value The value to assign. |
|
|
*/ |
|
|
function assignMergeValue(object, key, value) { |
|
|
if ((value !== undefined && !eq(object[key], value)) || |
|
|
(value === undefined && !(key in object))) { |
|
|
baseAssignValue(object, key, value); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Assigns `value` to `key` of `object` if the existing value is not equivalent |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {string} key The key of the property to assign. |
|
|
* @param {*} value The value to assign. |
|
|
*/ |
|
|
function assignValue(object, key, value) { |
|
|
var objValue = object[key]; |
|
|
if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) || |
|
|
(value === undefined && !(key in object))) { |
|
|
baseAssignValue(object, key, value); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the index at which the `key` is found in `array` of key-value pairs. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} key The key to search for. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
*/ |
|
|
function assocIndexOf(array, key) { |
|
|
var length = array.length; |
|
|
while (length--) { |
|
|
if (eq(array[length][0], key)) { |
|
|
return length; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Aggregates elements of `collection` on `accumulator` with keys transformed |
|
|
* by `iteratee` and values set by `setter`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform keys. |
|
|
* @param {Object} accumulator The initial aggregated object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function baseAggregator(collection, setter, iteratee, accumulator) { |
|
|
baseEach(collection, function(value, key, collection) { |
|
|
setter(accumulator, value, iteratee(value), collection); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.assign` without support for multiple sources |
|
|
* or `customizer` functions. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseAssign(object, source) { |
|
|
return object && copyObject(source, keys(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.assignIn` without support for multiple sources |
|
|
* or `customizer` functions. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseAssignIn(object, source) { |
|
|
return object && copyObject(source, keysIn(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `assignValue` and `assignMergeValue` without |
|
|
* value checks. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {string} key The key of the property to assign. |
|
|
* @param {*} value The value to assign. |
|
|
*/ |
|
|
function baseAssignValue(object, key, value) { |
|
|
if (key == '__proto__' && defineProperty) { |
|
|
defineProperty(object, key, { |
|
|
'configurable': true, |
|
|
'enumerable': true, |
|
|
'value': value, |
|
|
'writable': true |
|
|
}); |
|
|
} else { |
|
|
object[key] = value; |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.at` without support for individual paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @returns {Array} Returns the picked elements. |
|
|
*/ |
|
|
function baseAt(object, paths) { |
|
|
var index = -1, |
|
|
length = paths.length, |
|
|
result = Array(length), |
|
|
skip = object == null; |
|
|
|
|
|
while (++index < length) { |
|
|
result[index] = skip ? undefined : get(object, paths[index]); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.clamp` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {number} number The number to clamp. |
|
|
* @param {number} [lower] The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the clamped number. |
|
|
*/ |
|
|
function baseClamp(number, lower, upper) { |
|
|
if (number === number) { |
|
|
if (upper !== undefined) { |
|
|
number = number <= upper ? number : upper; |
|
|
} |
|
|
if (lower !== undefined) { |
|
|
number = number >= lower ? number : lower; |
|
|
} |
|
|
} |
|
|
return number; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.clone` and `_.cloneDeep` which tracks |
|
|
* traversed objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to clone. |
|
|
* @param {boolean} bitmask The bitmask flags. |
|
|
* 1 - Deep clone |
|
|
* 2 - Flatten inherited properties |
|
|
* 4 - Clone symbols |
|
|
* @param {Function} [customizer] The function to customize cloning. |
|
|
* @param {string} [key] The key of `value`. |
|
|
* @param {Object} [object] The parent object of `value`. |
|
|
* @param {Object} [stack] Tracks traversed objects and their clone counterparts. |
|
|
* @returns {*} Returns the cloned value. |
|
|
*/ |
|
|
function baseClone(value, bitmask, customizer, key, object, stack) { |
|
|
var result, |
|
|
isDeep = bitmask & CLONE_DEEP_FLAG, |
|
|
isFlat = bitmask & CLONE_FLAT_FLAG, |
|
|
isFull = bitmask & CLONE_SYMBOLS_FLAG; |
|
|
|
|
|
if (customizer) { |
|
|
result = object ? customizer(value, key, object, stack) : customizer(value); |
|
|
} |
|
|
if (result !== undefined) { |
|
|
return result; |
|
|
} |
|
|
if (!isObject(value)) { |
|
|
return value; |
|
|
} |
|
|
var isArr = isArray(value); |
|
|
if (isArr) { |
|
|
result = initCloneArray(value); |
|
|
if (!isDeep) { |
|
|
return copyArray(value, result); |
|
|
} |
|
|
} else { |
|
|
var tag = getTag(value), |
|
|
isFunc = tag == funcTag || tag == genTag; |
|
|
|
|
|
if (isBuffer(value)) { |
|
|
return cloneBuffer(value, isDeep); |
|
|
} |
|
|
if (tag == objectTag || tag == argsTag || (isFunc && !object)) { |
|
|
result = (isFlat || isFunc) ? {} : initCloneObject(value); |
|
|
if (!isDeep) { |
|
|
return isFlat |
|
|
? copySymbolsIn(value, baseAssignIn(result, value)) |
|
|
: copySymbols(value, baseAssign(result, value)); |
|
|
} |
|
|
} else { |
|
|
if (!cloneableTags[tag]) { |
|
|
return object ? value : {}; |
|
|
} |
|
|
result = initCloneByTag(value, tag, isDeep); |
|
|
} |
|
|
} |
|
|
// Check for circular references and return its corresponding clone. |
|
|
stack || (stack = new Stack); |
|
|
var stacked = stack.get(value); |
|
|
if (stacked) { |
|
|
return stacked; |
|
|
} |
|
|
stack.set(value, result); |
|
|
|
|
|
if (isSet(value)) { |
|
|
value.forEach(function(subValue) { |
|
|
result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack)); |
|
|
}); |
|
|
|
|
|
return result; |
|
|
} |
|
|
|
|
|
if (isMap(value)) { |
|
|
value.forEach(function(subValue, key) { |
|
|
result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack)); |
|
|
}); |
|
|
|
|
|
return result; |
|
|
} |
|
|
|
|
|
var keysFunc = isFull |
|
|
? (isFlat ? getAllKeysIn : getAllKeys) |
|
|
: (isFlat ? keysIn : keys); |
|
|
|
|
|
var props = isArr ? undefined : keysFunc(value); |
|
|
arrayEach(props || value, function(subValue, key) { |
|
|
if (props) { |
|
|
key = subValue; |
|
|
subValue = value[key]; |
|
|
} |
|
|
// Recursively populate clone (susceptible to call stack limits). |
|
|
assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack)); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.delay` and `_.defer` which accepts `args` |
|
|
* to provide to `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to delay. |
|
|
* @param {number} wait The number of milliseconds to delay invocation. |
|
|
* @param {Array} args The arguments to provide to `func`. |
|
|
* @returns {number|Object} Returns the timer id or timeout object. |
|
|
*/ |
|
|
function baseDelay(func, wait, args) { |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
return setTimeout(function() { func.apply(undefined, args); }, wait); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.difference` without support |
|
|
* for excluding multiple arrays or iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Array} values The values to exclude. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
*/ |
|
|
function baseDifference(array, values, iteratee, comparator) { |
|
|
var index = -1, |
|
|
includes = arrayIncludes, |
|
|
isCommon = true, |
|
|
length = array.length, |
|
|
result = [], |
|
|
valuesLength = values.length; |
|
|
|
|
|
if (!length) { |
|
|
return result; |
|
|
} |
|
|
if (iteratee) { |
|
|
values = arrayMap(values, baseUnary(iteratee)); |
|
|
} |
|
|
if (comparator) { |
|
|
includes = arrayIncludesWith; |
|
|
isCommon = false; |
|
|
} |
|
|
else if (values.length >= LARGE_ARRAY_SIZE) { |
|
|
includes = cacheHas; |
|
|
isCommon = false; |
|
|
values = new SetCache(values); |
|
|
} |
|
|
outer: |
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
computed = iteratee == null ? value : iteratee(value); |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (isCommon && computed === computed) { |
|
|
var valuesIndex = valuesLength; |
|
|
while (valuesIndex--) { |
|
|
if (values[valuesIndex] === computed) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
else if (!includes(values, computed, comparator)) { |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forEach` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array|Object} Returns `collection`. |
|
|
*/ |
|
|
var baseEach = createBaseEach(baseForOwn); |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.every` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false` |
|
|
*/ |
|
|
function baseEvery(collection, predicate) { |
|
|
var result = true; |
|
|
baseEach(collection, function(value, index, collection) { |
|
|
result = !!predicate(value, index, collection); |
|
|
return result; |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.max` and `_.min` which accepts a |
|
|
* `comparator` to determine the extremum value. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @param {Function} iteratee The iteratee invoked per iteration. |
|
|
* @param {Function} comparator The comparator used to compare values. |
|
|
* @returns {*} Returns the extremum value. |
|
|
*/ |
|
|
function baseExtremum(array, iteratee, comparator) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
current = iteratee(value); |
|
|
|
|
|
if (current != null && (computed === undefined |
|
|
? (current === current && !isSymbol(current)) |
|
|
: comparator(current, computed) |
|
|
)) { |
|
|
var computed = current, |
|
|
result = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.filter` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
*/ |
|
|
function baseFilter(collection, predicate) { |
|
|
var result = []; |
|
|
baseEach(collection, function(value, index, collection) { |
|
|
if (predicate(value, index, collection)) { |
|
|
result.push(value); |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.flatten` with support for restricting flattening. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to flatten. |
|
|
* @param {number} depth The maximum recursion depth. |
|
|
* @param {boolean} [predicate=isFlattenable] The function invoked per iteration. |
|
|
* @param {boolean} [isStrict] Restrict to values that pass `predicate` checks. |
|
|
* @param {Array} [result=[]] The initial result value. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
*/ |
|
|
function baseFlatten(array, depth, predicate, isStrict, result) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
predicate || (predicate = isFlattenable); |
|
|
result || (result = []); |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (depth > 0 && predicate(value)) { |
|
|
if (depth > 1) { |
|
|
// Recursively flatten arrays (susceptible to call stack limits). |
|
|
baseFlatten(value, depth - 1, predicate, isStrict, result); |
|
|
} else { |
|
|
arrayPush(result, value); |
|
|
} |
|
|
} else if (!isStrict) { |
|
|
result[result.length] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `baseForOwn` which iterates over `object` |
|
|
* properties returned by `keysFunc` and invokes `iteratee` for each property. |
|
|
* Iteratee functions may exit iteration early by explicitly returning `false`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
var baseFor = createBaseFor(); |
|
|
|
|
|
/** |
|
|
* This function is like `baseFor` except that it iterates over properties |
|
|
* in the opposite order. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
var baseForRight = createBaseFor(true); |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forOwn` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseForOwn(object, iteratee) { |
|
|
return object && baseFor(object, iteratee, keys); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.forOwnRight` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseForOwnRight(object, iteratee) { |
|
|
return object && baseForRight(object, iteratee, keys); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.functions` which creates an array of |
|
|
* `object` function property names filtered from `props`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Array} props The property names to filter. |
|
|
* @returns {Array} Returns the function names. |
|
|
*/ |
|
|
function baseFunctions(object, props) { |
|
|
return arrayFilter(props, function(key) { |
|
|
return isFunction(object[key]); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.get` without support for default values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {*} Returns the resolved value. |
|
|
*/ |
|
|
function baseGet(object, path) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = 0, |
|
|
length = path.length; |
|
|
|
|
|
while (object != null && index < length) { |
|
|
object = object[toKey(path[index++])]; |
|
|
} |
|
|
return (index && index == length) ? object : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `getAllKeys` and `getAllKeysIn` which uses |
|
|
* `keysFunc` and `symbolsFunc` to get the enumerable property names and |
|
|
* symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Function} keysFunc The function to get the keys of `object`. |
|
|
* @param {Function} symbolsFunc The function to get the symbols of `object`. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function baseGetAllKeys(object, keysFunc, symbolsFunc) { |
|
|
var result = keysFunc(object); |
|
|
return isArray(object) ? result : arrayPush(result, symbolsFunc(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `getTag` without fallbacks for buggy environments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the `toStringTag`. |
|
|
*/ |
|
|
function baseGetTag(value) { |
|
|
if (value == null) { |
|
|
return value === undefined ? undefinedTag : nullTag; |
|
|
} |
|
|
return (symToStringTag && symToStringTag in Object(value)) |
|
|
? getRawTag(value) |
|
|
: objectToString(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.gt` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if `value` is greater than `other`, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseGt(value, other) { |
|
|
return value > other; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.has` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {Array|string} key The key to check. |
|
|
* @returns {boolean} Returns `true` if `key` exists, else `false`. |
|
|
*/ |
|
|
function baseHas(object, key) { |
|
|
return object != null && hasOwnProperty.call(object, key); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.hasIn` without support for deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} [object] The object to query. |
|
|
* @param {Array|string} key The key to check. |
|
|
* @returns {boolean} Returns `true` if `key` exists, else `false`. |
|
|
*/ |
|
|
function baseHasIn(object, key) { |
|
|
return object != null && key in Object(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of methods like `_.intersection`, without support |
|
|
* for iteratee shorthands, that accepts an array of arrays to inspect. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} arrays The arrays to inspect. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new array of shared values. |
|
|
*/ |
|
|
function baseIntersection(arrays, iteratee, comparator) { |
|
|
var includes = comparator ? arrayIncludesWith : arrayIncludes, |
|
|
length = arrays[0].length, |
|
|
othLength = arrays.length, |
|
|
othIndex = othLength, |
|
|
caches = Array(othLength), |
|
|
maxLength = Infinity, |
|
|
result = []; |
|
|
|
|
|
while (othIndex--) { |
|
|
var array = arrays[othIndex]; |
|
|
if (othIndex && iteratee) { |
|
|
array = arrayMap(array, baseUnary(iteratee)); |
|
|
} |
|
|
maxLength = nativeMin(array.length, maxLength); |
|
|
caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120)) |
|
|
? new SetCache(othIndex && array) |
|
|
: undefined; |
|
|
} |
|
|
array = arrays[0]; |
|
|
|
|
|
var index = -1, |
|
|
seen = caches[0]; |
|
|
|
|
|
outer: |
|
|
while (++index < length && result.length < maxLength) { |
|
|
var value = array[index], |
|
|
computed = iteratee ? iteratee(value) : value; |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (!(seen |
|
|
? cacheHas(seen, computed) |
|
|
: includes(result, computed, comparator) |
|
|
)) { |
|
|
othIndex = othLength; |
|
|
while (--othIndex) { |
|
|
var cache = caches[othIndex]; |
|
|
if (!(cache |
|
|
? cacheHas(cache, computed) |
|
|
: includes(arrays[othIndex], computed, comparator)) |
|
|
) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
if (seen) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.invert` and `_.invertBy` which inverts |
|
|
* `object` with values transformed by `iteratee` and set by `setter`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to iterate over. |
|
|
* @param {Function} setter The function to set `accumulator` values. |
|
|
* @param {Function} iteratee The iteratee to transform values. |
|
|
* @param {Object} accumulator The initial inverted object. |
|
|
* @returns {Function} Returns `accumulator`. |
|
|
*/ |
|
|
function baseInverter(object, setter, iteratee, accumulator) { |
|
|
baseForOwn(object, function(value, key, object) { |
|
|
setter(accumulator, iteratee(value), key, object); |
|
|
}); |
|
|
return accumulator; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.invoke` without support for individual |
|
|
* method arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the method to invoke. |
|
|
* @param {Array} args The arguments to invoke the method with. |
|
|
* @returns {*} Returns the result of the invoked method. |
|
|
*/ |
|
|
function baseInvoke(object, path, args) { |
|
|
path = castPath(path, object); |
|
|
object = parent(object, path); |
|
|
var func = object == null ? object : object[toKey(last(path))]; |
|
|
return func == null ? undefined : apply(func, object, args); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isArguments`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an `arguments` object, |
|
|
*/ |
|
|
function baseIsArguments(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == argsTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isDate` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a date object, else `false`. |
|
|
*/ |
|
|
function baseIsDate(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == dateTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isEqual` which supports partial comparisons |
|
|
* and tracks traversed objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @param {boolean} bitmask The bitmask flags. |
|
|
* 1 - Unordered comparison |
|
|
* 2 - Partial comparison |
|
|
* @param {Function} [customizer] The function to customize comparisons. |
|
|
* @param {Object} [stack] Tracks traversed `value` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
*/ |
|
|
function baseIsEqual(value, other, bitmask, customizer, stack) { |
|
|
if (value === other) { |
|
|
return true; |
|
|
} |
|
|
if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) { |
|
|
return value !== value && other !== other; |
|
|
} |
|
|
return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqual` for arrays and objects which performs |
|
|
* deep comparisons and tracks traversed objects enabling objects with circular |
|
|
* references to be compared. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} [stack] Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) { |
|
|
var objIsArr = isArray(object), |
|
|
othIsArr = isArray(other), |
|
|
objTag = objIsArr ? arrayTag : getTag(object), |
|
|
othTag = othIsArr ? arrayTag : getTag(other); |
|
|
|
|
|
objTag = objTag == argsTag ? objectTag : objTag; |
|
|
othTag = othTag == argsTag ? objectTag : othTag; |
|
|
|
|
|
var objIsObj = objTag == objectTag, |
|
|
othIsObj = othTag == objectTag, |
|
|
isSameTag = objTag == othTag; |
|
|
|
|
|
if (isSameTag && isBuffer(object)) { |
|
|
if (!isBuffer(other)) { |
|
|
return false; |
|
|
} |
|
|
objIsArr = true; |
|
|
objIsObj = false; |
|
|
} |
|
|
if (isSameTag && !objIsObj) { |
|
|
stack || (stack = new Stack); |
|
|
return (objIsArr || isTypedArray(object)) |
|
|
? equalArrays(object, other, bitmask, customizer, equalFunc, stack) |
|
|
: equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack); |
|
|
} |
|
|
if (!(bitmask & COMPARE_PARTIAL_FLAG)) { |
|
|
var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'), |
|
|
othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__'); |
|
|
|
|
|
if (objIsWrapped || othIsWrapped) { |
|
|
var objUnwrapped = objIsWrapped ? object.value() : object, |
|
|
othUnwrapped = othIsWrapped ? other.value() : other; |
|
|
|
|
|
stack || (stack = new Stack); |
|
|
return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack); |
|
|
} |
|
|
} |
|
|
if (!isSameTag) { |
|
|
return false; |
|
|
} |
|
|
stack || (stack = new Stack); |
|
|
return equalObjects(object, other, bitmask, customizer, equalFunc, stack); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isMap` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a map, else `false`. |
|
|
*/ |
|
|
function baseIsMap(value) { |
|
|
return isObjectLike(value) && getTag(value) == mapTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isMatch` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @param {Array} matchData The property names, values, and compare flags to match. |
|
|
* @param {Function} [customizer] The function to customize comparisons. |
|
|
* @returns {boolean} Returns `true` if `object` is a match, else `false`. |
|
|
*/ |
|
|
function baseIsMatch(object, source, matchData, customizer) { |
|
|
var index = matchData.length, |
|
|
length = index, |
|
|
noCustomizer = !customizer; |
|
|
|
|
|
if (object == null) { |
|
|
return !length; |
|
|
} |
|
|
object = Object(object); |
|
|
while (index--) { |
|
|
var data = matchData[index]; |
|
|
if ((noCustomizer && data[2]) |
|
|
? data[1] !== object[data[0]] |
|
|
: !(data[0] in object) |
|
|
) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
while (++index < length) { |
|
|
data = matchData[index]; |
|
|
var key = data[0], |
|
|
objValue = object[key], |
|
|
srcValue = data[1]; |
|
|
|
|
|
if (noCustomizer && data[2]) { |
|
|
if (objValue === undefined && !(key in object)) { |
|
|
return false; |
|
|
} |
|
|
} else { |
|
|
var stack = new Stack; |
|
|
if (customizer) { |
|
|
var result = customizer(objValue, srcValue, key, object, source, stack); |
|
|
} |
|
|
if (!(result === undefined |
|
|
? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack) |
|
|
: result |
|
|
)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isNative` without bad shim checks. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a native function, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseIsNative(value) { |
|
|
if (!isObject(value) || isMasked(value)) { |
|
|
return false; |
|
|
} |
|
|
var pattern = isFunction(value) ? reIsNative : reIsHostCtor; |
|
|
return pattern.test(toSource(value)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isRegExp` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a regexp, else `false`. |
|
|
*/ |
|
|
function baseIsRegExp(value) { |
|
|
return isObjectLike(value) && baseGetTag(value) == regexpTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isSet` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a set, else `false`. |
|
|
*/ |
|
|
function baseIsSet(value) { |
|
|
return isObjectLike(value) && getTag(value) == setTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.isTypedArray` without Node.js optimizations. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a typed array, else `false`. |
|
|
*/ |
|
|
function baseIsTypedArray(value) { |
|
|
return isObjectLike(value) && |
|
|
isLength(value.length) && !!typedArrayTags[baseGetTag(value)]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.iteratee`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} [value=_.identity] The value to convert to an iteratee. |
|
|
* @returns {Function} Returns the iteratee. |
|
|
*/ |
|
|
function baseIteratee(value) { |
|
|
// Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9. |
|
|
// See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details. |
|
|
if (typeof value == 'function') { |
|
|
return value; |
|
|
} |
|
|
if (value == null) { |
|
|
return identity; |
|
|
} |
|
|
if (typeof value == 'object') { |
|
|
return isArray(value) |
|
|
? baseMatchesProperty(value[0], value[1]) |
|
|
: baseMatches(value); |
|
|
} |
|
|
return property(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.keys` which doesn't treat sparse arrays as dense. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function baseKeys(object) { |
|
|
if (!isPrototype(object)) { |
|
|
return nativeKeys(object); |
|
|
} |
|
|
var result = []; |
|
|
for (var key in Object(object)) { |
|
|
if (hasOwnProperty.call(object, key) && key != 'constructor') { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function baseKeysIn(object) { |
|
|
if (!isObject(object)) { |
|
|
return nativeKeysIn(object); |
|
|
} |
|
|
var isProto = isPrototype(object), |
|
|
result = []; |
|
|
|
|
|
for (var key in object) { |
|
|
if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.lt` which doesn't coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if `value` is less than `other`, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseLt(value, other) { |
|
|
return value < other; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.map` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} iteratee The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
*/ |
|
|
function baseMap(collection, iteratee) { |
|
|
var index = -1, |
|
|
result = isArrayLike(collection) ? Array(collection.length) : []; |
|
|
|
|
|
baseEach(collection, function(value, key, collection) { |
|
|
result[++index] = iteratee(value, key, collection); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.matches` which doesn't clone `source`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function baseMatches(source) { |
|
|
var matchData = getMatchData(source); |
|
|
if (matchData.length == 1 && matchData[0][2]) { |
|
|
return matchesStrictComparable(matchData[0][0], matchData[0][1]); |
|
|
} |
|
|
return function(object) { |
|
|
return object === source || baseIsMatch(object, source, matchData); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.matchesProperty` which doesn't clone `srcValue`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} path The path of the property to get. |
|
|
* @param {*} srcValue The value to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function baseMatchesProperty(path, srcValue) { |
|
|
if (isKey(path) && isStrictComparable(srcValue)) { |
|
|
return matchesStrictComparable(toKey(path), srcValue); |
|
|
} |
|
|
return function(object) { |
|
|
var objValue = get(object, path); |
|
|
return (objValue === undefined && objValue === srcValue) |
|
|
? hasIn(object, path) |
|
|
: baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.merge` without support for multiple sources. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @param {number} srcIndex The index of `source`. |
|
|
* @param {Function} [customizer] The function to customize merged values. |
|
|
* @param {Object} [stack] Tracks traversed source values and their merged |
|
|
* counterparts. |
|
|
*/ |
|
|
function baseMerge(object, source, srcIndex, customizer, stack) { |
|
|
if (object === source) { |
|
|
return; |
|
|
} |
|
|
baseFor(source, function(srcValue, key) { |
|
|
if (isObject(srcValue)) { |
|
|
stack || (stack = new Stack); |
|
|
baseMergeDeep(object, source, key, srcIndex, baseMerge, customizer, stack); |
|
|
} |
|
|
else { |
|
|
var newValue = customizer |
|
|
? customizer(safeGet(object, key), srcValue, (key + ''), object, source, stack) |
|
|
: undefined; |
|
|
|
|
|
if (newValue === undefined) { |
|
|
newValue = srcValue; |
|
|
} |
|
|
assignMergeValue(object, key, newValue); |
|
|
} |
|
|
}, keysIn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseMerge` for arrays and objects which performs |
|
|
* deep merges and tracks traversed objects enabling objects with circular |
|
|
* references to be merged. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The destination object. |
|
|
* @param {Object} source The source object. |
|
|
* @param {string} key The key of the value to merge. |
|
|
* @param {number} srcIndex The index of `source`. |
|
|
* @param {Function} mergeFunc The function to merge values. |
|
|
* @param {Function} [customizer] The function to customize assigned values. |
|
|
* @param {Object} [stack] Tracks traversed source values and their merged |
|
|
* counterparts. |
|
|
*/ |
|
|
function baseMergeDeep(object, source, key, srcIndex, mergeFunc, customizer, stack) { |
|
|
var objValue = safeGet(object, key), |
|
|
srcValue = safeGet(source, key), |
|
|
stacked = stack.get(srcValue); |
|
|
|
|
|
if (stacked) { |
|
|
assignMergeValue(object, key, stacked); |
|
|
return; |
|
|
} |
|
|
var newValue = customizer |
|
|
? customizer(objValue, srcValue, (key + ''), object, source, stack) |
|
|
: undefined; |
|
|
|
|
|
var isCommon = newValue === undefined; |
|
|
|
|
|
if (isCommon) { |
|
|
var isArr = isArray(srcValue), |
|
|
isBuff = !isArr && isBuffer(srcValue), |
|
|
isTyped = !isArr && !isBuff && isTypedArray(srcValue); |
|
|
|
|
|
newValue = srcValue; |
|
|
if (isArr || isBuff || isTyped) { |
|
|
if (isArray(objValue)) { |
|
|
newValue = objValue; |
|
|
} |
|
|
else if (isArrayLikeObject(objValue)) { |
|
|
newValue = copyArray(objValue); |
|
|
} |
|
|
else if (isBuff) { |
|
|
isCommon = false; |
|
|
newValue = cloneBuffer(srcValue, true); |
|
|
} |
|
|
else if (isTyped) { |
|
|
isCommon = false; |
|
|
newValue = cloneTypedArray(srcValue, true); |
|
|
} |
|
|
else { |
|
|
newValue = []; |
|
|
} |
|
|
} |
|
|
else if (isPlainObject(srcValue) || isArguments(srcValue)) { |
|
|
newValue = objValue; |
|
|
if (isArguments(objValue)) { |
|
|
newValue = toPlainObject(objValue); |
|
|
} |
|
|
else if (!isObject(objValue) || (srcIndex && isFunction(objValue))) { |
|
|
newValue = initCloneObject(srcValue); |
|
|
} |
|
|
} |
|
|
else { |
|
|
isCommon = false; |
|
|
} |
|
|
} |
|
|
if (isCommon) { |
|
|
// Recursively merge objects and arrays (susceptible to call stack limits). |
|
|
stack.set(srcValue, newValue); |
|
|
mergeFunc(newValue, srcValue, srcIndex, customizer, stack); |
|
|
stack['delete'](srcValue); |
|
|
} |
|
|
assignMergeValue(object, key, newValue); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.orderBy` without param guards. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by. |
|
|
* @param {string[]} orders The sort orders of `iteratees`. |
|
|
* @returns {Array} Returns the new sorted array. |
|
|
*/ |
|
|
function baseOrderBy(collection, iteratees, orders) { |
|
|
var index = -1; |
|
|
iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee)); |
|
|
|
|
|
var result = baseMap(collection, function(value, key, collection) { |
|
|
var criteria = arrayMap(iteratees, function(iteratee) { |
|
|
return iteratee(value); |
|
|
}); |
|
|
return { 'criteria': criteria, 'index': ++index, 'value': value }; |
|
|
}); |
|
|
|
|
|
return baseSortBy(result, function(object, other) { |
|
|
return compareMultiple(object, other, orders); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.pick` without support for individual |
|
|
* property identifiers. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The source object. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function basePick(object, paths) { |
|
|
return basePickBy(object, paths, function(value, path) { |
|
|
return hasIn(object, path); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.pickBy` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The source object. |
|
|
* @param {string[]} paths The property paths to pick. |
|
|
* @param {Function} predicate The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function basePickBy(object, paths, predicate) { |
|
|
var index = -1, |
|
|
length = paths.length, |
|
|
result = {}; |
|
|
|
|
|
while (++index < length) { |
|
|
var path = paths[index], |
|
|
value = baseGet(object, path); |
|
|
|
|
|
if (predicate(value, path)) { |
|
|
baseSet(result, castPath(path, object), value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseProperty` which supports deep paths. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
*/ |
|
|
function basePropertyDeep(path) { |
|
|
return function(object) { |
|
|
return baseGet(object, path); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.random` without support for returning |
|
|
* floating-point numbers. |
|
|
* |
|
|
* @private |
|
|
* @param {number} lower The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the random number. |
|
|
*/ |
|
|
function baseRandom(lower, upper) { |
|
|
return lower + nativeFloor(nativeRandom() * (upper - lower + 1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.range` and `_.rangeRight` which doesn't |
|
|
* coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {number} start The start of the range. |
|
|
* @param {number} end The end of the range. |
|
|
* @param {number} step The value to increment or decrement by. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Array} Returns the range of numbers. |
|
|
*/ |
|
|
function baseRange(start, end, step, fromRight) { |
|
|
var index = -1, |
|
|
length = nativeMax(nativeCeil((end - start) / (step || 1)), 0), |
|
|
result = Array(length); |
|
|
|
|
|
while (length--) { |
|
|
result[fromRight ? length : ++index] = start; |
|
|
start += step; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.rest` which doesn't validate or coerce arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function baseRest(func, start) { |
|
|
return setToString(overRest(func, start, identity), func + ''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.set`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {Array|string} path The path of the property to set. |
|
|
* @param {*} value The value to set. |
|
|
* @param {Function} [customizer] The function to customize path creation. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function baseSet(object, path, value, customizer) { |
|
|
if (!isObject(object)) { |
|
|
return object; |
|
|
} |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length, |
|
|
lastIndex = length - 1, |
|
|
nested = object; |
|
|
|
|
|
while (nested != null && ++index < length) { |
|
|
var key = toKey(path[index]), |
|
|
newValue = value; |
|
|
|
|
|
if (index != lastIndex) { |
|
|
var objValue = nested[key]; |
|
|
newValue = customizer ? customizer(objValue, key, nested) : undefined; |
|
|
if (newValue === undefined) { |
|
|
newValue = isObject(objValue) |
|
|
? objValue |
|
|
: (isIndex(path[index + 1]) ? [] : {}); |
|
|
} |
|
|
} |
|
|
assignValue(nested, key, newValue); |
|
|
nested = nested[key]; |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `setData` without support for hot loop shorting. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to associate metadata with. |
|
|
* @param {*} data The metadata. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var baseSetData = !metaMap ? identity : function(func, data) { |
|
|
metaMap.set(func, data); |
|
|
return func; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* The base implementation of `setToString` without support for hot loop shorting. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to modify. |
|
|
* @param {Function} string The `toString` result. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var baseSetToString = !defineProperty ? identity : function(func, string) { |
|
|
return defineProperty(func, 'toString', { |
|
|
'configurable': true, |
|
|
'enumerable': false, |
|
|
'value': constant(string), |
|
|
'writable': true |
|
|
}); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.slice` without an iteratee call guard. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to slice. |
|
|
* @param {number} [start=0] The start position. |
|
|
* @param {number} [end=array.length] The end position. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
*/ |
|
|
function baseSlice(array, start, end) { |
|
|
var index = -1, |
|
|
length = array.length; |
|
|
|
|
|
if (start < 0) { |
|
|
start = -start > length ? 0 : (length + start); |
|
|
} |
|
|
end = end > length ? length : end; |
|
|
if (end < 0) { |
|
|
end += length; |
|
|
} |
|
|
length = start > end ? 0 : ((end - start) >>> 0); |
|
|
start >>>= 0; |
|
|
|
|
|
var result = Array(length); |
|
|
while (++index < length) { |
|
|
result[index] = array[index + start]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.some` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} predicate The function invoked per iteration. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
*/ |
|
|
function baseSome(collection, predicate) { |
|
|
var result; |
|
|
|
|
|
baseEach(collection, function(value, index, collection) { |
|
|
result = predicate(value, index, collection); |
|
|
return !result; |
|
|
}); |
|
|
return !!result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.toString` which doesn't convert nullish |
|
|
* values to empty strings. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to process. |
|
|
* @returns {string} Returns the string. |
|
|
*/ |
|
|
function baseToString(value) { |
|
|
// Exit early for strings to avoid a performance hit in some environments. |
|
|
if (typeof value == 'string') { |
|
|
return value; |
|
|
} |
|
|
if (isArray(value)) { |
|
|
// Recursively convert values (susceptible to call stack limits). |
|
|
return arrayMap(value, baseToString) + ''; |
|
|
} |
|
|
if (isSymbol(value)) { |
|
|
return symbolToString ? symbolToString.call(value) : ''; |
|
|
} |
|
|
var result = (value + ''); |
|
|
return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.uniqBy` without support for iteratee shorthands. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [iteratee] The iteratee invoked per element. |
|
|
* @param {Function} [comparator] The comparator invoked per element. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
*/ |
|
|
function baseUniq(array, iteratee, comparator) { |
|
|
var index = -1, |
|
|
includes = arrayIncludes, |
|
|
length = array.length, |
|
|
isCommon = true, |
|
|
result = [], |
|
|
seen = result; |
|
|
|
|
|
if (comparator) { |
|
|
isCommon = false; |
|
|
includes = arrayIncludesWith; |
|
|
} |
|
|
else if (length >= LARGE_ARRAY_SIZE) { |
|
|
var set = iteratee ? null : createSet(array); |
|
|
if (set) { |
|
|
return setToArray(set); |
|
|
} |
|
|
isCommon = false; |
|
|
includes = cacheHas; |
|
|
seen = new SetCache; |
|
|
} |
|
|
else { |
|
|
seen = iteratee ? [] : result; |
|
|
} |
|
|
outer: |
|
|
while (++index < length) { |
|
|
var value = array[index], |
|
|
computed = iteratee ? iteratee(value) : value; |
|
|
|
|
|
value = (comparator || value !== 0) ? value : 0; |
|
|
if (isCommon && computed === computed) { |
|
|
var seenIndex = seen.length; |
|
|
while (seenIndex--) { |
|
|
if (seen[seenIndex] === computed) { |
|
|
continue outer; |
|
|
} |
|
|
} |
|
|
if (iteratee) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
else if (!includes(seen, computed, comparator)) { |
|
|
if (seen !== result) { |
|
|
seen.push(computed); |
|
|
} |
|
|
result.push(value); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `_.unset`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to modify. |
|
|
* @param {Array|string} path The property path to unset. |
|
|
* @returns {boolean} Returns `true` if the property is deleted, else `false`. |
|
|
*/ |
|
|
function baseUnset(object, path) { |
|
|
path = castPath(path, object); |
|
|
object = parent(object, path); |
|
|
return object == null || delete object[toKey(last(path))]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* The base implementation of `wrapperValue` which returns the result of |
|
|
* performing a sequence of actions on the unwrapped `value`, where each |
|
|
* successive action is supplied the return value of the previous. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The unwrapped value. |
|
|
* @param {Array} actions Actions to perform to resolve the unwrapped value. |
|
|
* @returns {*} Returns the resolved value. |
|
|
*/ |
|
|
function baseWrapperValue(value, actions) { |
|
|
var result = value; |
|
|
if (result instanceof LazyWrapper) { |
|
|
result = result.value(); |
|
|
} |
|
|
return arrayReduce(actions, function(result, action) { |
|
|
return action.func.apply(action.thisArg, arrayPush([result], action.args)); |
|
|
}, result); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This base implementation of `_.zipObject` which assigns values using `assignFunc`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} props The property identifiers. |
|
|
* @param {Array} values The property values. |
|
|
* @param {Function} assignFunc The function to assign values. |
|
|
* @returns {Object} Returns the new object. |
|
|
*/ |
|
|
function baseZipObject(props, values, assignFunc) { |
|
|
var index = -1, |
|
|
length = props.length, |
|
|
valsLength = values.length, |
|
|
result = {}; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = index < valsLength ? values[index] : undefined; |
|
|
assignFunc(result, props[index], value); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Casts `value` to an empty array if it's not an array like object. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @returns {Array|Object} Returns the cast array-like object. |
|
|
*/ |
|
|
function castArrayLikeObject(value) { |
|
|
return isArrayLikeObject(value) ? value : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Casts `value` to a path array if it's not one. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @param {Object} [object] The object to query keys on. |
|
|
* @returns {Array} Returns the cast property path array. |
|
|
*/ |
|
|
function castPath(value, object) { |
|
|
if (isArray(value)) { |
|
|
return value; |
|
|
} |
|
|
return isKey(value, object) ? [value] : stringToPath(toString(value)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `buffer`. |
|
|
* |
|
|
* @private |
|
|
* @param {Buffer} buffer The buffer to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Buffer} Returns the cloned buffer. |
|
|
*/ |
|
|
function cloneBuffer(buffer, isDeep) { |
|
|
if (isDeep) { |
|
|
return buffer.slice(); |
|
|
} |
|
|
var length = buffer.length, |
|
|
result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length); |
|
|
|
|
|
buffer.copy(result); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `arrayBuffer`. |
|
|
* |
|
|
* @private |
|
|
* @param {ArrayBuffer} arrayBuffer The array buffer to clone. |
|
|
* @returns {ArrayBuffer} Returns the cloned array buffer. |
|
|
*/ |
|
|
function cloneArrayBuffer(arrayBuffer) { |
|
|
var result = new arrayBuffer.constructor(arrayBuffer.byteLength); |
|
|
new Uint8Array(result).set(new Uint8Array(arrayBuffer)); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `dataView`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} dataView The data view to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the cloned data view. |
|
|
*/ |
|
|
function cloneDataView(dataView, isDeep) { |
|
|
var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer; |
|
|
return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `regexp`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} regexp The regexp to clone. |
|
|
* @returns {Object} Returns the cloned regexp. |
|
|
*/ |
|
|
function cloneRegExp(regexp) { |
|
|
var result = new regexp.constructor(regexp.source, reFlags.exec(regexp)); |
|
|
result.lastIndex = regexp.lastIndex; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the `symbol` object. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} symbol The symbol object to clone. |
|
|
* @returns {Object} Returns the cloned symbol object. |
|
|
*/ |
|
|
function cloneSymbol(symbol) { |
|
|
return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `typedArray`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} typedArray The typed array to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the cloned typed array. |
|
|
*/ |
|
|
function cloneTypedArray(typedArray, isDeep) { |
|
|
var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer; |
|
|
return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Compares values to sort them in ascending order. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {number} Returns the sort order indicator for `value`. |
|
|
*/ |
|
|
function compareAscending(value, other) { |
|
|
if (value !== other) { |
|
|
var valIsDefined = value !== undefined, |
|
|
valIsNull = value === null, |
|
|
valIsReflexive = value === value, |
|
|
valIsSymbol = isSymbol(value); |
|
|
|
|
|
var othIsDefined = other !== undefined, |
|
|
othIsNull = other === null, |
|
|
othIsReflexive = other === other, |
|
|
othIsSymbol = isSymbol(other); |
|
|
|
|
|
if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) || |
|
|
(valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) || |
|
|
(valIsNull && othIsDefined && othIsReflexive) || |
|
|
(!valIsDefined && othIsReflexive) || |
|
|
!valIsReflexive) { |
|
|
return 1; |
|
|
} |
|
|
if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) || |
|
|
(othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) || |
|
|
(othIsNull && valIsDefined && valIsReflexive) || |
|
|
(!othIsDefined && valIsReflexive) || |
|
|
!othIsReflexive) { |
|
|
return -1; |
|
|
} |
|
|
} |
|
|
return 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.orderBy` to compare multiple properties of a value to another |
|
|
* and stable sort them. |
|
|
* |
|
|
* If `orders` is unspecified, all values are sorted in ascending order. Otherwise, |
|
|
* specify an order of "desc" for descending or "asc" for ascending sort order |
|
|
* of corresponding values. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {boolean[]|string[]} orders The order to sort by for each property. |
|
|
* @returns {number} Returns the sort order indicator for `object`. |
|
|
*/ |
|
|
function compareMultiple(object, other, orders) { |
|
|
var index = -1, |
|
|
objCriteria = object.criteria, |
|
|
othCriteria = other.criteria, |
|
|
length = objCriteria.length, |
|
|
ordersLength = orders.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var result = compareAscending(objCriteria[index], othCriteria[index]); |
|
|
if (result) { |
|
|
if (index >= ordersLength) { |
|
|
return result; |
|
|
} |
|
|
var order = orders[index]; |
|
|
return result * (order == 'desc' ? -1 : 1); |
|
|
} |
|
|
} |
|
|
// Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications |
|
|
// that causes it, under certain circumstances, to provide the same value for |
|
|
// `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247 |
|
|
// for more details. |
|
|
// |
|
|
// This also ensures a stable sort in V8 and other engines. |
|
|
// See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details. |
|
|
return object.index - other.index; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array that is the composition of partially applied arguments, |
|
|
* placeholders, and provided arguments into a single array of arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} args The provided arguments. |
|
|
* @param {Array} partials The arguments to prepend to those provided. |
|
|
* @param {Array} holders The `partials` placeholder indexes. |
|
|
* @params {boolean} [isCurried] Specify composing for a curried function. |
|
|
* @returns {Array} Returns the new array of composed arguments. |
|
|
*/ |
|
|
function composeArgs(args, partials, holders, isCurried) { |
|
|
var argsIndex = -1, |
|
|
argsLength = args.length, |
|
|
holdersLength = holders.length, |
|
|
leftIndex = -1, |
|
|
leftLength = partials.length, |
|
|
rangeLength = nativeMax(argsLength - holdersLength, 0), |
|
|
result = Array(leftLength + rangeLength), |
|
|
isUncurried = !isCurried; |
|
|
|
|
|
while (++leftIndex < leftLength) { |
|
|
result[leftIndex] = partials[leftIndex]; |
|
|
} |
|
|
while (++argsIndex < holdersLength) { |
|
|
if (isUncurried || argsIndex < argsLength) { |
|
|
result[holders[argsIndex]] = args[argsIndex]; |
|
|
} |
|
|
} |
|
|
while (rangeLength--) { |
|
|
result[leftIndex++] = args[argsIndex++]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like `composeArgs` except that the arguments composition |
|
|
* is tailored for `_.partialRight`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} args The provided arguments. |
|
|
* @param {Array} partials The arguments to append to those provided. |
|
|
* @param {Array} holders The `partials` placeholder indexes. |
|
|
* @params {boolean} [isCurried] Specify composing for a curried function. |
|
|
* @returns {Array} Returns the new array of composed arguments. |
|
|
*/ |
|
|
function composeArgsRight(args, partials, holders, isCurried) { |
|
|
var argsIndex = -1, |
|
|
argsLength = args.length, |
|
|
holdersIndex = -1, |
|
|
holdersLength = holders.length, |
|
|
rightIndex = -1, |
|
|
rightLength = partials.length, |
|
|
rangeLength = nativeMax(argsLength - holdersLength, 0), |
|
|
result = Array(rangeLength + rightLength), |
|
|
isUncurried = !isCurried; |
|
|
|
|
|
while (++argsIndex < rangeLength) { |
|
|
result[argsIndex] = args[argsIndex]; |
|
|
} |
|
|
var offset = argsIndex; |
|
|
while (++rightIndex < rightLength) { |
|
|
result[offset + rightIndex] = partials[rightIndex]; |
|
|
} |
|
|
while (++holdersIndex < holdersLength) { |
|
|
if (isUncurried || argsIndex < argsLength) { |
|
|
result[offset + holders[holdersIndex]] = args[argsIndex++]; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies the values of `source` to `array`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} source The array to copy values from. |
|
|
* @param {Array} [array=[]] The array to copy values to. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function copyArray(source, array) { |
|
|
var index = -1, |
|
|
length = source.length; |
|
|
|
|
|
array || (array = Array(length)); |
|
|
while (++index < length) { |
|
|
array[index] = source[index]; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies properties of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy properties from. |
|
|
* @param {Array} props The property identifiers to copy. |
|
|
* @param {Object} [object={}] The object to copy properties to. |
|
|
* @param {Function} [customizer] The function to customize copied values. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copyObject(source, props, object, customizer) { |
|
|
var isNew = !object; |
|
|
object || (object = {}); |
|
|
|
|
|
var index = -1, |
|
|
length = props.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var key = props[index]; |
|
|
|
|
|
var newValue = customizer |
|
|
? customizer(object[key], source[key], key, object, source) |
|
|
: undefined; |
|
|
|
|
|
if (newValue === undefined) { |
|
|
newValue = source[key]; |
|
|
} |
|
|
if (isNew) { |
|
|
baseAssignValue(object, key, newValue); |
|
|
} else { |
|
|
assignValue(object, key, newValue); |
|
|
} |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies own symbols of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy symbols from. |
|
|
* @param {Object} [object={}] The object to copy symbols to. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copySymbols(source, object) { |
|
|
return copyObject(source, getSymbols(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Copies own and inherited symbols of `source` to `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} source The object to copy symbols from. |
|
|
* @param {Object} [object={}] The object to copy symbols to. |
|
|
* @returns {Object} Returns `object`. |
|
|
*/ |
|
|
function copySymbolsIn(source, object) { |
|
|
return copyObject(source, getSymbolsIn(source), object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.groupBy`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} setter The function to set accumulator values. |
|
|
* @param {Function} [initializer] The accumulator object initializer. |
|
|
* @returns {Function} Returns the new aggregator function. |
|
|
*/ |
|
|
function createAggregator(setter, initializer) { |
|
|
return function(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayAggregator : baseAggregator, |
|
|
accumulator = initializer ? initializer() : {}; |
|
|
|
|
|
return func(collection, setter, baseIteratee(iteratee, 2), accumulator); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.assign`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} assigner The function to assign values. |
|
|
* @returns {Function} Returns the new assigner function. |
|
|
*/ |
|
|
function createAssigner(assigner) { |
|
|
return baseRest(function(object, sources) { |
|
|
var index = -1, |
|
|
length = sources.length, |
|
|
customizer = length > 1 ? sources[length - 1] : undefined, |
|
|
guard = length > 2 ? sources[2] : undefined; |
|
|
|
|
|
customizer = (assigner.length > 3 && typeof customizer == 'function') |
|
|
? (length--, customizer) |
|
|
: undefined; |
|
|
|
|
|
if (guard && isIterateeCall(sources[0], sources[1], guard)) { |
|
|
customizer = length < 3 ? undefined : customizer; |
|
|
length = 1; |
|
|
} |
|
|
object = Object(object); |
|
|
while (++index < length) { |
|
|
var source = sources[index]; |
|
|
if (source) { |
|
|
assigner(object, source, index, customizer); |
|
|
} |
|
|
} |
|
|
return object; |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `baseEach` or `baseEachRight` function. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} eachFunc The function to iterate over a collection. |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new base function. |
|
|
*/ |
|
|
function createBaseEach(eachFunc, fromRight) { |
|
|
return function(collection, iteratee) { |
|
|
if (collection == null) { |
|
|
return collection; |
|
|
} |
|
|
if (!isArrayLike(collection)) { |
|
|
return eachFunc(collection, iteratee); |
|
|
} |
|
|
var length = collection.length, |
|
|
index = fromRight ? length : -1, |
|
|
iterable = Object(collection); |
|
|
|
|
|
while ((fromRight ? index-- : ++index < length)) { |
|
|
if (iteratee(iterable[index], index, iterable) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return collection; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a base function for methods like `_.forIn` and `_.forOwn`. |
|
|
* |
|
|
* @private |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new base function. |
|
|
*/ |
|
|
function createBaseFor(fromRight) { |
|
|
return function(object, iteratee, keysFunc) { |
|
|
var index = -1, |
|
|
iterable = Object(object), |
|
|
props = keysFunc(object), |
|
|
length = props.length; |
|
|
|
|
|
while (length--) { |
|
|
var key = props[fromRight ? length : ++index]; |
|
|
if (iteratee(iterable[key], key, iterable) === false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
return object; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with the optional `this` |
|
|
* binding of `thisArg`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createBind(func, bitmask, thisArg) { |
|
|
var isBind = bitmask & WRAP_BIND_FLAG, |
|
|
Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
return fn.apply(isBind ? thisArg : this, arguments); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that produces an instance of `Ctor` regardless of |
|
|
* whether it was invoked as part of a `new` expression or by `call` or `apply`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} Ctor The constructor to wrap. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createCtor(Ctor) { |
|
|
return function() { |
|
|
// Use a `switch` statement to work with class constructors. See |
|
|
// http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist |
|
|
// for more details. |
|
|
var args = arguments; |
|
|
switch (args.length) { |
|
|
case 0: return new Ctor; |
|
|
case 1: return new Ctor(args[0]); |
|
|
case 2: return new Ctor(args[0], args[1]); |
|
|
case 3: return new Ctor(args[0], args[1], args[2]); |
|
|
case 4: return new Ctor(args[0], args[1], args[2], args[3]); |
|
|
case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]); |
|
|
case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
} |
|
|
var thisBinding = baseCreate(Ctor.prototype), |
|
|
result = Ctor.apply(thisBinding, args); |
|
|
|
|
|
// Mimic the constructor's `return` behavior. |
|
|
// See https://es5.github.io/#x13.2.2 for more details. |
|
|
return isObject(result) ? result : thisBinding; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to enable currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {number} arity The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createCurry(func, bitmask, arity) { |
|
|
var Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var length = arguments.length, |
|
|
args = Array(length), |
|
|
index = length, |
|
|
placeholder = getHolder(wrapper); |
|
|
|
|
|
while (index--) { |
|
|
args[index] = arguments[index]; |
|
|
} |
|
|
var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder) |
|
|
? [] |
|
|
: replaceHolders(args, placeholder); |
|
|
|
|
|
length -= holders.length; |
|
|
if (length < arity) { |
|
|
return createRecurry( |
|
|
func, bitmask, createHybrid, wrapper.placeholder, undefined, |
|
|
args, holders, undefined, undefined, arity - length); |
|
|
} |
|
|
var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
return apply(fn, this, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `_.find` or `_.findLast` function. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} findIndexFunc The function to find the collection index. |
|
|
* @returns {Function} Returns the new find function. |
|
|
*/ |
|
|
function createFind(findIndexFunc) { |
|
|
return function(collection, predicate, fromIndex) { |
|
|
var iterable = Object(collection); |
|
|
if (!isArrayLike(collection)) { |
|
|
var iteratee = baseIteratee(predicate, 3); |
|
|
collection = keys(collection); |
|
|
predicate = function(key) { return iteratee(iterable[key], key, iterable); }; |
|
|
} |
|
|
var index = findIndexFunc(collection, predicate, fromIndex); |
|
|
return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with optional `this` |
|
|
* binding of `thisArg`, partial application, and currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function|string} func The function or method name to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [partialsRight] The arguments to append to those provided |
|
|
* to the new function. |
|
|
* @param {Array} [holdersRight] The `partialsRight` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) { |
|
|
var isAry = bitmask & WRAP_ARY_FLAG, |
|
|
isBind = bitmask & WRAP_BIND_FLAG, |
|
|
isBindKey = bitmask & WRAP_BIND_KEY_FLAG, |
|
|
isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG), |
|
|
isFlip = bitmask & WRAP_FLIP_FLAG, |
|
|
Ctor = isBindKey ? undefined : createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var length = arguments.length, |
|
|
args = Array(length), |
|
|
index = length; |
|
|
|
|
|
while (index--) { |
|
|
args[index] = arguments[index]; |
|
|
} |
|
|
if (isCurried) { |
|
|
var placeholder = getHolder(wrapper), |
|
|
holdersCount = countHolders(args, placeholder); |
|
|
} |
|
|
if (partials) { |
|
|
args = composeArgs(args, partials, holders, isCurried); |
|
|
} |
|
|
if (partialsRight) { |
|
|
args = composeArgsRight(args, partialsRight, holdersRight, isCurried); |
|
|
} |
|
|
length -= holdersCount; |
|
|
if (isCurried && length < arity) { |
|
|
var newHolders = replaceHolders(args, placeholder); |
|
|
return createRecurry( |
|
|
func, bitmask, createHybrid, wrapper.placeholder, thisArg, |
|
|
args, newHolders, argPos, ary, arity - length |
|
|
); |
|
|
} |
|
|
var thisBinding = isBind ? thisArg : this, |
|
|
fn = isBindKey ? thisBinding[func] : func; |
|
|
|
|
|
length = args.length; |
|
|
if (argPos) { |
|
|
args = reorder(args, argPos); |
|
|
} else if (isFlip && length > 1) { |
|
|
args.reverse(); |
|
|
} |
|
|
if (isAry && ary < length) { |
|
|
args.length = ary; |
|
|
} |
|
|
if (this && this !== root && this instanceof wrapper) { |
|
|
fn = Ctor || createCtor(fn); |
|
|
} |
|
|
return fn.apply(thisBinding, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function like `_.invertBy`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} setter The function to set accumulator values. |
|
|
* @param {Function} toIteratee The function to resolve iteratees. |
|
|
* @returns {Function} Returns the new inverter function. |
|
|
*/ |
|
|
function createInverter(setter, toIteratee) { |
|
|
return function(object, iteratee) { |
|
|
return baseInverter(object, setter, toIteratee(iteratee), {}); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to invoke it with the `this` binding |
|
|
* of `thisArg` and `partials` prepended to the arguments it receives. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {Array} partials The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createPartial(func, bitmask, thisArg, partials) { |
|
|
var isBind = bitmask & WRAP_BIND_FLAG, |
|
|
Ctor = createCtor(func); |
|
|
|
|
|
function wrapper() { |
|
|
var argsIndex = -1, |
|
|
argsLength = arguments.length, |
|
|
leftIndex = -1, |
|
|
leftLength = partials.length, |
|
|
args = Array(leftLength + argsLength), |
|
|
fn = (this && this !== root && this instanceof wrapper) ? Ctor : func; |
|
|
|
|
|
while (++leftIndex < leftLength) { |
|
|
args[leftIndex] = partials[leftIndex]; |
|
|
} |
|
|
while (argsLength--) { |
|
|
args[leftIndex++] = arguments[++argsIndex]; |
|
|
} |
|
|
return apply(fn, isBind ? thisArg : this, args); |
|
|
} |
|
|
return wrapper; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a `_.range` or `_.rangeRight` function. |
|
|
* |
|
|
* @private |
|
|
* @param {boolean} [fromRight] Specify iterating from right to left. |
|
|
* @returns {Function} Returns the new range function. |
|
|
*/ |
|
|
function createRange(fromRight) { |
|
|
return function(start, end, step) { |
|
|
if (step && typeof step != 'number' && isIterateeCall(start, end, step)) { |
|
|
end = step = undefined; |
|
|
} |
|
|
// Ensure the sign of `-0` is preserved. |
|
|
start = toFinite(start); |
|
|
if (end === undefined) { |
|
|
end = start; |
|
|
start = 0; |
|
|
} else { |
|
|
end = toFinite(end); |
|
|
} |
|
|
step = step === undefined ? (start < end ? 1 : -1) : toFinite(step); |
|
|
return baseRange(start, end, step, fromRight); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that wraps `func` to continue currying. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to wrap. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @param {Function} wrapFunc The function to create the `func` wrapper. |
|
|
* @param {*} placeholder The placeholder value. |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to prepend to those provided to |
|
|
* the new function. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) { |
|
|
var isCurry = bitmask & WRAP_CURRY_FLAG, |
|
|
newHolders = isCurry ? holders : undefined, |
|
|
newHoldersRight = isCurry ? undefined : holders, |
|
|
newPartials = isCurry ? partials : undefined, |
|
|
newPartialsRight = isCurry ? undefined : partials; |
|
|
|
|
|
bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG); |
|
|
bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG); |
|
|
|
|
|
if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) { |
|
|
bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG); |
|
|
} |
|
|
var newData = [ |
|
|
func, bitmask, thisArg, newPartials, newHolders, newPartialsRight, |
|
|
newHoldersRight, argPos, ary, arity |
|
|
]; |
|
|
|
|
|
var result = wrapFunc.apply(undefined, newData); |
|
|
if (isLaziable(func)) { |
|
|
setData(result, newData); |
|
|
} |
|
|
result.placeholder = placeholder; |
|
|
return setWrapToString(result, func, bitmask); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a set object of `values`. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} values The values to add to the set. |
|
|
* @returns {Object} Returns the new set. |
|
|
*/ |
|
|
var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) { |
|
|
return new Set(values); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Creates a function that either curries or invokes `func` with optional |
|
|
* `this` binding and partially applied arguments. |
|
|
* |
|
|
* @private |
|
|
* @param {Function|string} func The function or method name to wrap. |
|
|
* @param {number} bitmask The bitmask flags. |
|
|
* 1 - `_.bind` |
|
|
* 2 - `_.bindKey` |
|
|
* 4 - `_.curry` or `_.curryRight` of a bound function |
|
|
* 8 - `_.curry` |
|
|
* 16 - `_.curryRight` |
|
|
* 32 - `_.partial` |
|
|
* 64 - `_.partialRight` |
|
|
* 128 - `_.rearg` |
|
|
* 256 - `_.ary` |
|
|
* 512 - `_.flip` |
|
|
* @param {*} [thisArg] The `this` binding of `func`. |
|
|
* @param {Array} [partials] The arguments to be partially applied. |
|
|
* @param {Array} [holders] The `partials` placeholder indexes. |
|
|
* @param {Array} [argPos] The argument positions of the new function. |
|
|
* @param {number} [ary] The arity cap of `func`. |
|
|
* @param {number} [arity] The arity of `func`. |
|
|
* @returns {Function} Returns the new wrapped function. |
|
|
*/ |
|
|
function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) { |
|
|
var isBindKey = bitmask & WRAP_BIND_KEY_FLAG; |
|
|
if (!isBindKey && typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
var length = partials ? partials.length : 0; |
|
|
if (!length) { |
|
|
bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG); |
|
|
partials = holders = undefined; |
|
|
} |
|
|
ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0); |
|
|
arity = arity === undefined ? arity : toInteger(arity); |
|
|
length -= holders ? holders.length : 0; |
|
|
|
|
|
if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) { |
|
|
var partialsRight = partials, |
|
|
holdersRight = holders; |
|
|
|
|
|
partials = holders = undefined; |
|
|
} |
|
|
var data = isBindKey ? undefined : getData(func); |
|
|
|
|
|
var newData = [ |
|
|
func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, |
|
|
argPos, ary, arity |
|
|
]; |
|
|
|
|
|
if (data) { |
|
|
mergeData(newData, data); |
|
|
} |
|
|
func = newData[0]; |
|
|
bitmask = newData[1]; |
|
|
thisArg = newData[2]; |
|
|
partials = newData[3]; |
|
|
holders = newData[4]; |
|
|
arity = newData[9] = newData[9] === undefined |
|
|
? (isBindKey ? 0 : func.length) |
|
|
: nativeMax(newData[9] - length, 0); |
|
|
|
|
|
if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) { |
|
|
bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG); |
|
|
} |
|
|
if (!bitmask || bitmask == WRAP_BIND_FLAG) { |
|
|
var result = createBind(func, bitmask, thisArg); |
|
|
} else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) { |
|
|
result = createCurry(func, bitmask, arity); |
|
|
} else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) { |
|
|
result = createPartial(func, bitmask, thisArg, partials); |
|
|
} else { |
|
|
result = createHybrid.apply(undefined, newData); |
|
|
} |
|
|
var setter = data ? baseSetData : setData; |
|
|
return setWrapToString(setter(result, newData), func, bitmask); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.defaultsDeep` to customize its `_.merge` use to merge source |
|
|
* objects into destination objects that are passed thru. |
|
|
* |
|
|
* @private |
|
|
* @param {*} objValue The destination value. |
|
|
* @param {*} srcValue The source value. |
|
|
* @param {string} key The key of the property to merge. |
|
|
* @param {Object} object The parent object of `objValue`. |
|
|
* @param {Object} source The parent object of `srcValue`. |
|
|
* @param {Object} [stack] Tracks traversed source values and their merged |
|
|
* counterparts. |
|
|
* @returns {*} Returns the value to assign. |
|
|
*/ |
|
|
function customDefaultsMerge(objValue, srcValue, key, object, source, stack) { |
|
|
if (isObject(objValue) && isObject(srcValue)) { |
|
|
// Recursively merge objects and arrays (susceptible to call stack limits). |
|
|
stack.set(srcValue, objValue); |
|
|
baseMerge(objValue, srcValue, undefined, customDefaultsMerge, stack); |
|
|
stack['delete'](srcValue); |
|
|
} |
|
|
return objValue; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain |
|
|
* objects. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @param {string} key The key of the property to inspect. |
|
|
* @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`. |
|
|
*/ |
|
|
function customOmitClone(value) { |
|
|
return isPlainObject(value) ? undefined : value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for arrays with support for |
|
|
* partial deep comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to compare. |
|
|
* @param {Array} other The other array to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `array` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the arrays are equivalent, else `false`. |
|
|
*/ |
|
|
function equalArrays(array, other, bitmask, customizer, equalFunc, stack) { |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG, |
|
|
arrLength = array.length, |
|
|
othLength = other.length; |
|
|
|
|
|
if (arrLength != othLength && !(isPartial && othLength > arrLength)) { |
|
|
return false; |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(array); |
|
|
if (stacked && stack.get(other)) { |
|
|
return stacked == other; |
|
|
} |
|
|
var index = -1, |
|
|
result = true, |
|
|
seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined; |
|
|
|
|
|
stack.set(array, other); |
|
|
stack.set(other, array); |
|
|
|
|
|
// Ignore non-index properties. |
|
|
while (++index < arrLength) { |
|
|
var arrValue = array[index], |
|
|
othValue = other[index]; |
|
|
|
|
|
if (customizer) { |
|
|
var compared = isPartial |
|
|
? customizer(othValue, arrValue, index, other, array, stack) |
|
|
: customizer(arrValue, othValue, index, array, other, stack); |
|
|
} |
|
|
if (compared !== undefined) { |
|
|
if (compared) { |
|
|
continue; |
|
|
} |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
// Recursively compare arrays (susceptible to call stack limits). |
|
|
if (seen) { |
|
|
if (!arraySome(other, function(othValue, othIndex) { |
|
|
if (!cacheHas(seen, othIndex) && |
|
|
(arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) { |
|
|
return seen.push(othIndex); |
|
|
} |
|
|
})) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
} else if (!( |
|
|
arrValue === othValue || |
|
|
equalFunc(arrValue, othValue, bitmask, customizer, stack) |
|
|
)) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
} |
|
|
stack['delete'](array); |
|
|
stack['delete'](other); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for comparing objects of |
|
|
* the same `toStringTag`. |
|
|
* |
|
|
* **Note:** This function only supports comparing values with tags of |
|
|
* `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {string} tag The `toStringTag` of the objects to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) { |
|
|
switch (tag) { |
|
|
case dataViewTag: |
|
|
if ((object.byteLength != other.byteLength) || |
|
|
(object.byteOffset != other.byteOffset)) { |
|
|
return false; |
|
|
} |
|
|
object = object.buffer; |
|
|
other = other.buffer; |
|
|
|
|
|
case arrayBufferTag: |
|
|
if ((object.byteLength != other.byteLength) || |
|
|
!equalFunc(new Uint8Array(object), new Uint8Array(other))) { |
|
|
return false; |
|
|
} |
|
|
return true; |
|
|
|
|
|
case boolTag: |
|
|
case dateTag: |
|
|
case numberTag: |
|
|
// Coerce booleans to `1` or `0` and dates to milliseconds. |
|
|
// Invalid dates are coerced to `NaN`. |
|
|
return eq(+object, +other); |
|
|
|
|
|
case errorTag: |
|
|
return object.name == other.name && object.message == other.message; |
|
|
|
|
|
case regexpTag: |
|
|
case stringTag: |
|
|
// Coerce regexes to strings and treat strings, primitives and objects, |
|
|
// as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring |
|
|
// for more details. |
|
|
return object == (other + ''); |
|
|
|
|
|
case mapTag: |
|
|
var convert = mapToArray; |
|
|
|
|
|
case setTag: |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG; |
|
|
convert || (convert = setToArray); |
|
|
|
|
|
if (object.size != other.size && !isPartial) { |
|
|
return false; |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(object); |
|
|
if (stacked) { |
|
|
return stacked == other; |
|
|
} |
|
|
bitmask |= COMPARE_UNORDERED_FLAG; |
|
|
|
|
|
// Recursively compare objects (susceptible to call stack limits). |
|
|
stack.set(object, other); |
|
|
var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack); |
|
|
stack['delete'](object); |
|
|
return result; |
|
|
|
|
|
case symbolTag: |
|
|
if (symbolValueOf) { |
|
|
return symbolValueOf.call(object) == symbolValueOf.call(other); |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseIsEqualDeep` for objects with support for |
|
|
* partial deep comparisons. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to compare. |
|
|
* @param {Object} other The other object to compare. |
|
|
* @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details. |
|
|
* @param {Function} customizer The function to customize comparisons. |
|
|
* @param {Function} equalFunc The function to determine equivalents of values. |
|
|
* @param {Object} stack Tracks traversed `object` and `other` objects. |
|
|
* @returns {boolean} Returns `true` if the objects are equivalent, else `false`. |
|
|
*/ |
|
|
function equalObjects(object, other, bitmask, customizer, equalFunc, stack) { |
|
|
var isPartial = bitmask & COMPARE_PARTIAL_FLAG, |
|
|
objProps = getAllKeys(object), |
|
|
objLength = objProps.length, |
|
|
othProps = getAllKeys(other), |
|
|
othLength = othProps.length; |
|
|
|
|
|
if (objLength != othLength && !isPartial) { |
|
|
return false; |
|
|
} |
|
|
var index = objLength; |
|
|
while (index--) { |
|
|
var key = objProps[index]; |
|
|
if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
// Assume cyclic values are equal. |
|
|
var stacked = stack.get(object); |
|
|
if (stacked && stack.get(other)) { |
|
|
return stacked == other; |
|
|
} |
|
|
var result = true; |
|
|
stack.set(object, other); |
|
|
stack.set(other, object); |
|
|
|
|
|
var skipCtor = isPartial; |
|
|
while (++index < objLength) { |
|
|
key = objProps[index]; |
|
|
var objValue = object[key], |
|
|
othValue = other[key]; |
|
|
|
|
|
if (customizer) { |
|
|
var compared = isPartial |
|
|
? customizer(othValue, objValue, key, other, object, stack) |
|
|
: customizer(objValue, othValue, key, object, other, stack); |
|
|
} |
|
|
// Recursively compare objects (susceptible to call stack limits). |
|
|
if (!(compared === undefined |
|
|
? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack)) |
|
|
: compared |
|
|
)) { |
|
|
result = false; |
|
|
break; |
|
|
} |
|
|
skipCtor || (skipCtor = key == 'constructor'); |
|
|
} |
|
|
if (result && !skipCtor) { |
|
|
var objCtor = object.constructor, |
|
|
othCtor = other.constructor; |
|
|
|
|
|
// Non `Object` object instances with different constructors are not equal. |
|
|
if (objCtor != othCtor && |
|
|
('constructor' in object && 'constructor' in other) && |
|
|
!(typeof objCtor == 'function' && objCtor instanceof objCtor && |
|
|
typeof othCtor == 'function' && othCtor instanceof othCtor)) { |
|
|
result = false; |
|
|
} |
|
|
} |
|
|
stack['delete'](object); |
|
|
stack['delete'](other); |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseRest` which flattens the rest array. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function flatRest(func) { |
|
|
return setToString(overRest(func, undefined, flatten), func + ''); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of own enumerable property names and symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function getAllKeys(object) { |
|
|
return baseGetAllKeys(object, keys, getSymbols); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of own and inherited enumerable property names and |
|
|
* symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names and symbols. |
|
|
*/ |
|
|
function getAllKeysIn(object) { |
|
|
return baseGetAllKeys(object, keysIn, getSymbolsIn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets metadata for `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to query. |
|
|
* @returns {*} Returns the metadata for `func`. |
|
|
*/ |
|
|
var getData = !metaMap ? noop : function(func) { |
|
|
return metaMap.get(func); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Gets the name of `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to query. |
|
|
* @returns {string} Returns the function name. |
|
|
*/ |
|
|
function getFuncName(func) { |
|
|
var result = (func.name + ''), |
|
|
array = realNames[result], |
|
|
length = hasOwnProperty.call(realNames, result) ? array.length : 0; |
|
|
|
|
|
while (length--) { |
|
|
var data = array[length], |
|
|
otherFunc = data.func; |
|
|
if (otherFunc == null || otherFunc == func) { |
|
|
return data.name; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the argument placeholder value for `func`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to inspect. |
|
|
* @returns {*} Returns the placeholder value. |
|
|
*/ |
|
|
function getHolder(func) { |
|
|
var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func; |
|
|
return object.placeholder; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the data for `map`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} map The map to query. |
|
|
* @param {string} key The reference key. |
|
|
* @returns {*} Returns the map data. |
|
|
*/ |
|
|
function getMapData(map, key) { |
|
|
var data = map.__data__; |
|
|
return isKeyable(key) |
|
|
? data[typeof key == 'string' ? 'string' : 'hash'] |
|
|
: data.map; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the property names, values, and compare flags of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the match data of `object`. |
|
|
*/ |
|
|
function getMatchData(object) { |
|
|
var result = keys(object), |
|
|
length = result.length; |
|
|
|
|
|
while (length--) { |
|
|
var key = result[length], |
|
|
value = object[key]; |
|
|
|
|
|
result[length] = [key, value, isStrictComparable(value)]; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the native function at `key` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {string} key The key of the method to get. |
|
|
* @returns {*} Returns the function if it's native, else `undefined`. |
|
|
*/ |
|
|
function getNative(object, key) { |
|
|
var value = getValue(object, key); |
|
|
return baseIsNative(value) ? value : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the raw `toStringTag`. |
|
|
*/ |
|
|
function getRawTag(value) { |
|
|
var isOwn = hasOwnProperty.call(value, symToStringTag), |
|
|
tag = value[symToStringTag]; |
|
|
|
|
|
try { |
|
|
value[symToStringTag] = undefined; |
|
|
var unmasked = true; |
|
|
} catch (e) {} |
|
|
|
|
|
var result = nativeObjectToString.call(value); |
|
|
if (unmasked) { |
|
|
if (isOwn) { |
|
|
value[symToStringTag] = tag; |
|
|
} else { |
|
|
delete value[symToStringTag]; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of symbols. |
|
|
*/ |
|
|
var getSymbols = !nativeGetSymbols ? stubArray : function(object) { |
|
|
if (object == null) { |
|
|
return []; |
|
|
} |
|
|
object = Object(object); |
|
|
return arrayFilter(nativeGetSymbols(object), function(symbol) { |
|
|
return propertyIsEnumerable.call(object, symbol); |
|
|
}); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Creates an array of the own and inherited enumerable symbols of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of symbols. |
|
|
*/ |
|
|
var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) { |
|
|
var result = []; |
|
|
while (object) { |
|
|
arrayPush(result, getSymbols(object)); |
|
|
object = getPrototype(object); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Gets the `toStringTag` of `value`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to query. |
|
|
* @returns {string} Returns the `toStringTag`. |
|
|
*/ |
|
|
var getTag = baseGetTag; |
|
|
|
|
|
// Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6. |
|
|
if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) || |
|
|
(Map && getTag(new Map) != mapTag) || |
|
|
(Promise && getTag(Promise.resolve()) != promiseTag) || |
|
|
(Set && getTag(new Set) != setTag) || |
|
|
(WeakMap && getTag(new WeakMap) != weakMapTag)) { |
|
|
getTag = function(value) { |
|
|
var result = baseGetTag(value), |
|
|
Ctor = result == objectTag ? value.constructor : undefined, |
|
|
ctorString = Ctor ? toSource(Ctor) : ''; |
|
|
|
|
|
if (ctorString) { |
|
|
switch (ctorString) { |
|
|
case dataViewCtorString: return dataViewTag; |
|
|
case mapCtorString: return mapTag; |
|
|
case promiseCtorString: return promiseTag; |
|
|
case setCtorString: return setTag; |
|
|
case weakMapCtorString: return weakMapTag; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the view, applying any `transforms` to the `start` and `end` positions. |
|
|
* |
|
|
* @private |
|
|
* @param {number} start The start of the view. |
|
|
* @param {number} end The end of the view. |
|
|
* @param {Array} transforms The transformations to apply to the view. |
|
|
* @returns {Object} Returns an object containing the `start` and `end` |
|
|
* positions of the view. |
|
|
*/ |
|
|
function getView(start, end, transforms) { |
|
|
var index = -1, |
|
|
length = transforms.length; |
|
|
|
|
|
while (++index < length) { |
|
|
var data = transforms[index], |
|
|
size = data.size; |
|
|
|
|
|
switch (data.type) { |
|
|
case 'drop': start += size; break; |
|
|
case 'dropRight': end -= size; break; |
|
|
case 'take': end = nativeMin(end, start + size); break; |
|
|
case 'takeRight': start = nativeMax(start, end - size); break; |
|
|
} |
|
|
} |
|
|
return { 'start': start, 'end': end }; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Extracts wrapper details from the `source` body comment. |
|
|
* |
|
|
* @private |
|
|
* @param {string} source The source to inspect. |
|
|
* @returns {Array} Returns the wrapper details. |
|
|
*/ |
|
|
function getWrapDetails(source) { |
|
|
var match = source.match(reWrapDetails); |
|
|
return match ? match[1].split(reSplitDetails) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` exists on `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @param {Function} hasFunc The function to check properties. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
*/ |
|
|
function hasPath(object, path, hasFunc) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length, |
|
|
result = false; |
|
|
|
|
|
while (++index < length) { |
|
|
var key = toKey(path[index]); |
|
|
if (!(result = object != null && hasFunc(object, key))) { |
|
|
break; |
|
|
} |
|
|
object = object[key]; |
|
|
} |
|
|
if (result || ++index != length) { |
|
|
return result; |
|
|
} |
|
|
length = object == null ? 0 : object.length; |
|
|
return !!length && isLength(length) && isIndex(key, length) && |
|
|
(isArray(object) || isArguments(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an array clone. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to clone. |
|
|
* @returns {Array} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneArray(array) { |
|
|
var length = array.length, |
|
|
result = new array.constructor(length); |
|
|
|
|
|
// Add properties assigned by `RegExp#exec`. |
|
|
if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) { |
|
|
result.index = array.index; |
|
|
result.input = array.input; |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an object clone. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to clone. |
|
|
* @returns {Object} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneObject(object) { |
|
|
return (typeof object.constructor == 'function' && !isPrototype(object)) |
|
|
? baseCreate(getPrototype(object)) |
|
|
: {}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Initializes an object clone based on its `toStringTag`. |
|
|
* |
|
|
* **Note:** This function only supports cloning values with tags of |
|
|
* `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to clone. |
|
|
* @param {string} tag The `toStringTag` of the object to clone. |
|
|
* @param {boolean} [isDeep] Specify a deep clone. |
|
|
* @returns {Object} Returns the initialized clone. |
|
|
*/ |
|
|
function initCloneByTag(object, tag, isDeep) { |
|
|
var Ctor = object.constructor; |
|
|
switch (tag) { |
|
|
case arrayBufferTag: |
|
|
return cloneArrayBuffer(object); |
|
|
|
|
|
case boolTag: |
|
|
case dateTag: |
|
|
return new Ctor(+object); |
|
|
|
|
|
case dataViewTag: |
|
|
return cloneDataView(object, isDeep); |
|
|
|
|
|
case float32Tag: case float64Tag: |
|
|
case int8Tag: case int16Tag: case int32Tag: |
|
|
case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag: |
|
|
return cloneTypedArray(object, isDeep); |
|
|
|
|
|
case mapTag: |
|
|
return new Ctor; |
|
|
|
|
|
case numberTag: |
|
|
case stringTag: |
|
|
return new Ctor(object); |
|
|
|
|
|
case regexpTag: |
|
|
return cloneRegExp(object); |
|
|
|
|
|
case setTag: |
|
|
return new Ctor; |
|
|
|
|
|
case symbolTag: |
|
|
return cloneSymbol(object); |
|
|
} |
|
|
} |
|
|
|
|
|
/** |
|
|
* Inserts wrapper `details` in a comment at the top of the `source` body. |
|
|
* |
|
|
* @private |
|
|
* @param {string} source The source to modify. |
|
|
* @returns {Array} details The details to insert. |
|
|
* @returns {string} Returns the modified source. |
|
|
*/ |
|
|
function insertWrapDetails(source, details) { |
|
|
var length = details.length; |
|
|
if (!length) { |
|
|
return source; |
|
|
} |
|
|
var lastIndex = length - 1; |
|
|
details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex]; |
|
|
details = details.join(length > 2 ? ', ' : ' '); |
|
|
return source.replace(reWrapComment, '{\n/* [wrapped with ' + details + '] */\n'); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a flattenable `arguments` object or array. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is flattenable, else `false`. |
|
|
*/ |
|
|
function isFlattenable(value) { |
|
|
return isArray(value) || isArguments(value) || |
|
|
!!(spreadableSymbol && value && value[spreadableSymbol]); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a valid array-like index. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index. |
|
|
* @returns {boolean} Returns `true` if `value` is a valid index, else `false`. |
|
|
*/ |
|
|
function isIndex(value, length) { |
|
|
var type = typeof value; |
|
|
length = length == null ? MAX_SAFE_INTEGER : length; |
|
|
|
|
|
return !!length && |
|
|
(type == 'number' || |
|
|
(type != 'symbol' && reIsUint.test(value))) && |
|
|
(value > -1 && value % 1 == 0 && value < length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if the given arguments are from an iteratee call. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The potential iteratee value argument. |
|
|
* @param {*} index The potential iteratee index or key argument. |
|
|
* @param {*} object The potential iteratee object argument. |
|
|
* @returns {boolean} Returns `true` if the arguments are from an iteratee call, |
|
|
* else `false`. |
|
|
*/ |
|
|
function isIterateeCall(value, index, object) { |
|
|
if (!isObject(object)) { |
|
|
return false; |
|
|
} |
|
|
var type = typeof index; |
|
|
if (type == 'number' |
|
|
? (isArrayLike(object) && isIndex(index, object.length)) |
|
|
: (type == 'string' && index in object) |
|
|
) { |
|
|
return eq(object[index], value); |
|
|
} |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a property name and not a property path. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @param {Object} [object] The object to query keys on. |
|
|
* @returns {boolean} Returns `true` if `value` is a property name, else `false`. |
|
|
*/ |
|
|
function isKey(value, object) { |
|
|
if (isArray(value)) { |
|
|
return false; |
|
|
} |
|
|
var type = typeof value; |
|
|
if (type == 'number' || type == 'symbol' || type == 'boolean' || |
|
|
value == null || isSymbol(value)) { |
|
|
return true; |
|
|
} |
|
|
return reIsPlainProp.test(value) || !reIsDeepProp.test(value) || |
|
|
(object != null && value in Object(object)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is suitable for use as unique object key. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is suitable, else `false`. |
|
|
*/ |
|
|
function isKeyable(value) { |
|
|
var type = typeof value; |
|
|
return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean') |
|
|
? (value !== '__proto__') |
|
|
: (value === null); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `func` has a lazy counterpart. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to check. |
|
|
* @returns {boolean} Returns `true` if `func` has a lazy counterpart, |
|
|
* else `false`. |
|
|
*/ |
|
|
function isLaziable(func) { |
|
|
var funcName = getFuncName(func), |
|
|
other = lodash[funcName]; |
|
|
|
|
|
if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) { |
|
|
return false; |
|
|
} |
|
|
if (func === other) { |
|
|
return true; |
|
|
} |
|
|
var data = getData(other); |
|
|
return !!data && func === data[0]; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `func` has its source masked. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to check. |
|
|
* @returns {boolean} Returns `true` if `func` is masked, else `false`. |
|
|
*/ |
|
|
function isMasked(func) { |
|
|
return !!maskSrcKey && (maskSrcKey in func); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is likely a prototype object. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a prototype, else `false`. |
|
|
*/ |
|
|
function isPrototype(value) { |
|
|
var Ctor = value && value.constructor, |
|
|
proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto; |
|
|
|
|
|
return value === proto; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is suitable for strict equality comparisons, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` if suitable for strict |
|
|
* equality comparisons, else `false`. |
|
|
*/ |
|
|
function isStrictComparable(value) { |
|
|
return value === value && !isObject(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `matchesProperty` for source values suitable |
|
|
* for strict equality comparisons, i.e. `===`. |
|
|
* |
|
|
* @private |
|
|
* @param {string} key The key of the property to get. |
|
|
* @param {*} srcValue The value to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
*/ |
|
|
function matchesStrictComparable(key, srcValue) { |
|
|
return function(object) { |
|
|
if (object == null) { |
|
|
return false; |
|
|
} |
|
|
return object[key] === srcValue && |
|
|
(srcValue !== undefined || (key in Object(object))); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `_.memoize` which clears the memoized function's |
|
|
* cache when it exceeds `MAX_MEMOIZE_SIZE`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to have its output memoized. |
|
|
* @returns {Function} Returns the new memoized function. |
|
|
*/ |
|
|
function memoizeCapped(func) { |
|
|
var result = memoize(func, function(key) { |
|
|
if (cache.size === MAX_MEMOIZE_SIZE) { |
|
|
cache.clear(); |
|
|
} |
|
|
return key; |
|
|
}); |
|
|
|
|
|
var cache = result.cache; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Merges the function metadata of `source` into `data`. |
|
|
* |
|
|
* Merging metadata reduces the number of wrappers used to invoke a function. |
|
|
* This is possible because methods like `_.bind`, `_.curry`, and `_.partial` |
|
|
* may be applied regardless of execution order. Methods like `_.ary` and |
|
|
* `_.rearg` modify function arguments, making the order in which they are |
|
|
* executed important, preventing the merging of metadata. However, we make |
|
|
* an exception for a safe combined case where curried functions have `_.ary` |
|
|
* and or `_.rearg` applied. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} data The destination metadata. |
|
|
* @param {Array} source The source metadata. |
|
|
* @returns {Array} Returns `data`. |
|
|
*/ |
|
|
function mergeData(data, source) { |
|
|
var bitmask = data[1], |
|
|
srcBitmask = source[1], |
|
|
newBitmask = bitmask | srcBitmask, |
|
|
isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG); |
|
|
|
|
|
var isCombo = |
|
|
((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) || |
|
|
((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) || |
|
|
((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG)); |
|
|
|
|
|
// Exit early if metadata can't be merged. |
|
|
if (!(isCommon || isCombo)) { |
|
|
return data; |
|
|
} |
|
|
// Use source `thisArg` if available. |
|
|
if (srcBitmask & WRAP_BIND_FLAG) { |
|
|
data[2] = source[2]; |
|
|
// Set when currying a bound function. |
|
|
newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG; |
|
|
} |
|
|
// Compose partial arguments. |
|
|
var value = source[3]; |
|
|
if (value) { |
|
|
var partials = data[3]; |
|
|
data[3] = partials ? composeArgs(partials, value, source[4]) : value; |
|
|
data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4]; |
|
|
} |
|
|
// Compose partial right arguments. |
|
|
value = source[5]; |
|
|
if (value) { |
|
|
partials = data[5]; |
|
|
data[5] = partials ? composeArgsRight(partials, value, source[6]) : value; |
|
|
data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6]; |
|
|
} |
|
|
// Use source `argPos` if available. |
|
|
value = source[7]; |
|
|
if (value) { |
|
|
data[7] = value; |
|
|
} |
|
|
// Use source `ary` if it's smaller. |
|
|
if (srcBitmask & WRAP_ARY_FLAG) { |
|
|
data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]); |
|
|
} |
|
|
// Use source `arity` if one is not provided. |
|
|
if (data[9] == null) { |
|
|
data[9] = source[9]; |
|
|
} |
|
|
// Use source `func` and merge bitmasks. |
|
|
data[0] = source[0]; |
|
|
data[1] = newBitmask; |
|
|
|
|
|
return data; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This function is like |
|
|
* [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys) |
|
|
* except that it includes inherited enumerable properties. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
*/ |
|
|
function nativeKeysIn(object) { |
|
|
var result = []; |
|
|
if (object != null) { |
|
|
for (var key in Object(object)) { |
|
|
result.push(key); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string using `Object.prototype.toString`. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {string} Returns the converted string. |
|
|
*/ |
|
|
function objectToString(value) { |
|
|
return nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* A specialized version of `baseRest` which transforms the rest array. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @param {Function} transform The rest array transform. |
|
|
* @returns {Function} Returns the new function. |
|
|
*/ |
|
|
function overRest(func, start, transform) { |
|
|
start = nativeMax(start === undefined ? (func.length - 1) : start, 0); |
|
|
return function() { |
|
|
var args = arguments, |
|
|
index = -1, |
|
|
length = nativeMax(args.length - start, 0), |
|
|
array = Array(length); |
|
|
|
|
|
while (++index < length) { |
|
|
array[index] = args[start + index]; |
|
|
} |
|
|
index = -1; |
|
|
var otherArgs = Array(start + 1); |
|
|
while (++index < start) { |
|
|
otherArgs[index] = args[index]; |
|
|
} |
|
|
otherArgs[start] = transform(array); |
|
|
return apply(func, this, otherArgs); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the parent value at `path` of `object`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array} path The path to get the parent value of. |
|
|
* @returns {*} Returns the parent value. |
|
|
*/ |
|
|
function parent(object, path) { |
|
|
return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reorder `array` according to the specified indexes where the element at |
|
|
* the first index is assigned as the first element, the element at |
|
|
* the second index is assigned as the second element, and so on. |
|
|
* |
|
|
* @private |
|
|
* @param {Array} array The array to reorder. |
|
|
* @param {Array} indexes The arranged array indexes. |
|
|
* @returns {Array} Returns `array`. |
|
|
*/ |
|
|
function reorder(array, indexes) { |
|
|
var arrLength = array.length, |
|
|
length = nativeMin(indexes.length, arrLength), |
|
|
oldArray = copyArray(array); |
|
|
|
|
|
while (length--) { |
|
|
var index = indexes[length]; |
|
|
array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined; |
|
|
} |
|
|
return array; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Sets metadata for `func`. |
|
|
* |
|
|
* **Note:** If this function becomes hot, i.e. is invoked a lot in a short |
|
|
* period of time, it will trip its breaker and transition to an identity |
|
|
* function to avoid garbage collection pauses in V8. See |
|
|
* [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070) |
|
|
* for more details. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to associate metadata with. |
|
|
* @param {*} data The metadata. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var setData = shortOut(baseSetData); |
|
|
|
|
|
/** |
|
|
* Sets the `toString` method of `func` to return `string`. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to modify. |
|
|
* @param {Function} string The `toString` result. |
|
|
* @returns {Function} Returns `func`. |
|
|
*/ |
|
|
var setToString = shortOut(baseSetToString); |
|
|
|
|
|
/** |
|
|
* Sets the `toString` method of `wrapper` to mimic the source of `reference` |
|
|
* with wrapper details in a comment at the top of the source body. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} wrapper The function to modify. |
|
|
* @param {Function} reference The reference function. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @returns {Function} Returns `wrapper`. |
|
|
*/ |
|
|
function setWrapToString(wrapper, reference, bitmask) { |
|
|
var source = (reference + ''); |
|
|
return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that'll short out and invoke `identity` instead |
|
|
* of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN` |
|
|
* milliseconds. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new shortable function. |
|
|
*/ |
|
|
function shortOut(func) { |
|
|
var count = 0, |
|
|
lastCalled = 0; |
|
|
|
|
|
return function() { |
|
|
var stamp = nativeNow(), |
|
|
remaining = HOT_SPAN - (stamp - lastCalled); |
|
|
|
|
|
lastCalled = stamp; |
|
|
if (remaining > 0) { |
|
|
if (++count >= HOT_COUNT) { |
|
|
return arguments[0]; |
|
|
} |
|
|
} else { |
|
|
count = 0; |
|
|
} |
|
|
return func.apply(undefined, arguments); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `string` to a property path array. |
|
|
* |
|
|
* @private |
|
|
* @param {string} string The string to convert. |
|
|
* @returns {Array} Returns the property path array. |
|
|
*/ |
|
|
var stringToPath = memoizeCapped(function(string) { |
|
|
var result = []; |
|
|
if (string.charCodeAt(0) === 46 /* . */) { |
|
|
result.push(''); |
|
|
} |
|
|
string.replace(rePropName, function(match, number, quote, subString) { |
|
|
result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match)); |
|
|
}); |
|
|
return result; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string key if it's not a string or symbol. |
|
|
* |
|
|
* @private |
|
|
* @param {*} value The value to inspect. |
|
|
* @returns {string|symbol} Returns the key. |
|
|
*/ |
|
|
function toKey(value) { |
|
|
if (typeof value == 'string' || isSymbol(value)) { |
|
|
return value; |
|
|
} |
|
|
var result = (value + ''); |
|
|
return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `func` to its source code. |
|
|
* |
|
|
* @private |
|
|
* @param {Function} func The function to convert. |
|
|
* @returns {string} Returns the source code. |
|
|
*/ |
|
|
function toSource(func) { |
|
|
if (func != null) { |
|
|
try { |
|
|
return funcToString.call(func); |
|
|
} catch (e) {} |
|
|
try { |
|
|
return (func + ''); |
|
|
} catch (e) {} |
|
|
} |
|
|
return ''; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Updates wrapper `details` based on `bitmask` flags. |
|
|
* |
|
|
* @private |
|
|
* @returns {Array} details The details to modify. |
|
|
* @param {number} bitmask The bitmask flags. See `createWrap` for more details. |
|
|
* @returns {Array} Returns `details`. |
|
|
*/ |
|
|
function updateWrapDetails(details, bitmask) { |
|
|
arrayEach(wrapFlags, function(pair) { |
|
|
var value = '_.' + pair[0]; |
|
|
if ((bitmask & pair[1]) && !arrayIncludes(details, value)) { |
|
|
details.push(value); |
|
|
} |
|
|
}); |
|
|
return details.sort(); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of `wrapper`. |
|
|
* |
|
|
* @private |
|
|
* @param {Object} wrapper The wrapper to clone. |
|
|
* @returns {Object} Returns the cloned wrapper. |
|
|
*/ |
|
|
function wrapperClone(wrapper) { |
|
|
if (wrapper instanceof LazyWrapper) { |
|
|
return wrapper.clone(); |
|
|
} |
|
|
var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__); |
|
|
result.__actions__ = copyArray(wrapper.__actions__); |
|
|
result.__index__ = wrapper.__index__; |
|
|
result.__values__ = wrapper.__values__; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an array with all falsey values removed. The values `false`, `null`, |
|
|
* `0`, `""`, `undefined`, and `NaN` are falsey. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to compact. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @example |
|
|
* |
|
|
* _.compact([0, 1, false, 2, '', 3]); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function compact(array) { |
|
|
var index = -1, |
|
|
length = array == null ? 0 : array.length, |
|
|
resIndex = 0, |
|
|
result = []; |
|
|
|
|
|
while (++index < length) { |
|
|
var value = array[index]; |
|
|
if (value) { |
|
|
result[resIndex++] = value; |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a new array concatenating `array` with any additional arrays |
|
|
* and/or values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to concatenate. |
|
|
* @param {...*} [values] The values to concatenate. |
|
|
* @returns {Array} Returns the new concatenated array. |
|
|
* @example |
|
|
* |
|
|
* var array = [1]; |
|
|
* var other = _.concat(array, 2, [3], [[4]]); |
|
|
* |
|
|
* console.log(other); |
|
|
* // => [1, 2, 3, [4]] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1] |
|
|
*/ |
|
|
function concat() { |
|
|
var length = arguments.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
var args = Array(length - 1), |
|
|
array = arguments[0], |
|
|
index = length; |
|
|
|
|
|
while (index--) { |
|
|
args[index - 1] = arguments[index]; |
|
|
} |
|
|
return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of `array` values not included in the other given arrays |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. The order and references of result values are |
|
|
* determined by the first array. |
|
|
* |
|
|
* **Note:** Unlike `_.pullAll`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {...Array} [values] The values to exclude. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @see _.without, _.xor |
|
|
* @example |
|
|
* |
|
|
* _.difference([2, 1], [2, 3]); |
|
|
* // => [1] |
|
|
*/ |
|
|
var difference = baseRest(function(array, values) { |
|
|
return isArrayLikeObject(array) |
|
|
? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true)) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements dropped from the beginning. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.5.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to drop. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.drop([1, 2, 3]); |
|
|
* // => [2, 3] |
|
|
* |
|
|
* _.drop([1, 2, 3], 2); |
|
|
* // => [3] |
|
|
* |
|
|
* _.drop([1, 2, 3], 5); |
|
|
* // => [] |
|
|
* |
|
|
* _.drop([1, 2, 3], 0); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function drop(array, n, guard) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
return baseSlice(array, n < 0 ? 0 : n, length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.find` except that it returns the index of the first |
|
|
* element `predicate` returns truthy for instead of the element itself. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {number} Returns the index of the found element, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': false }, |
|
|
* { 'user': 'fred', 'active': false }, |
|
|
* { 'user': 'pebbles', 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.findIndex(users, function(o) { return o.user == 'barney'; }); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findIndex(users, { 'user': 'fred', 'active': false }); |
|
|
* // => 1 |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findIndex(users, ['active', false]); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findIndex(users, 'active'); |
|
|
* // => 2 |
|
|
*/ |
|
|
function findIndex(array, predicate, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = fromIndex == null ? 0 : toInteger(fromIndex); |
|
|
if (index < 0) { |
|
|
index = nativeMax(length + index, 0); |
|
|
} |
|
|
return baseFindIndex(array, baseIteratee(predicate, 3), index); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.findIndex` except that it iterates over elements |
|
|
* of `collection` from right to left. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=array.length-1] The index to search from. |
|
|
* @returns {number} Returns the index of the found element, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': true }, |
|
|
* { 'user': 'fred', 'active': false }, |
|
|
* { 'user': 'pebbles', 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* _.findLastIndex(users, function(o) { return o.user == 'pebbles'; }); |
|
|
* // => 2 |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findLastIndex(users, { 'user': 'barney', 'active': true }); |
|
|
* // => 0 |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findLastIndex(users, ['active', false]); |
|
|
* // => 2 |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findLastIndex(users, 'active'); |
|
|
* // => 0 |
|
|
*/ |
|
|
function findLastIndex(array, predicate, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = length - 1; |
|
|
if (fromIndex !== undefined) { |
|
|
index = toInteger(fromIndex); |
|
|
index = fromIndex < 0 |
|
|
? nativeMax(length + index, 0) |
|
|
: nativeMin(index, length - 1); |
|
|
} |
|
|
return baseFindIndex(array, baseIteratee(predicate, 3), index, true); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Flattens `array` a single level deep. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to flatten. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
* @example |
|
|
* |
|
|
* _.flatten([1, [2, [3, [4]], 5]]); |
|
|
* // => [1, 2, [3, [4]], 5] |
|
|
*/ |
|
|
function flatten(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseFlatten(array, 1) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Recursively flattens `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to flatten. |
|
|
* @returns {Array} Returns the new flattened array. |
|
|
* @example |
|
|
* |
|
|
* _.flattenDeep([1, [2, [3, [4]], 5]]); |
|
|
* // => [1, 2, 3, 4, 5] |
|
|
*/ |
|
|
function flattenDeep(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseFlatten(array, INFINITY) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the first element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias first |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {*} Returns the first element of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.head([1, 2, 3]); |
|
|
* // => 1 |
|
|
* |
|
|
* _.head([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function head(array) { |
|
|
return (array && array.length) ? array[0] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the index at which the first occurrence of `value` is found in `array` |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. If `fromIndex` is negative, it's used as the |
|
|
* offset from the end of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {*} value The value to search for. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {number} Returns the index of the matched value, else `-1`. |
|
|
* @example |
|
|
* |
|
|
* _.indexOf([1, 2, 1, 2], 2); |
|
|
* // => 1 |
|
|
* |
|
|
* // Search from the `fromIndex`. |
|
|
* _.indexOf([1, 2, 1, 2], 2, 2); |
|
|
* // => 3 |
|
|
*/ |
|
|
function indexOf(array, value, fromIndex) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return -1; |
|
|
} |
|
|
var index = fromIndex == null ? 0 : toInteger(fromIndex); |
|
|
if (index < 0) { |
|
|
index = nativeMax(length + index, 0); |
|
|
} |
|
|
return baseIndexOf(array, value, index); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets all but the last element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.initial([1, 2, 3]); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function initial(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? baseSlice(array, 0, -1) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of unique values that are included in all given arrays |
|
|
* using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. The order and references of result values are |
|
|
* determined by the first array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to inspect. |
|
|
* @returns {Array} Returns the new array of intersecting values. |
|
|
* @example |
|
|
* |
|
|
* _.intersection([2, 1], [2, 3]); |
|
|
* // => [2] |
|
|
*/ |
|
|
var intersection = baseRest(function(arrays) { |
|
|
var mapped = arrayMap(arrays, castArrayLikeObject); |
|
|
return (mapped.length && mapped[0] === arrays[0]) |
|
|
? baseIntersection(mapped) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Gets the last element of `array`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @returns {*} Returns the last element of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.last([1, 2, 3]); |
|
|
* // => 3 |
|
|
*/ |
|
|
function last(array) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
return length ? array[length - 1] : undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverses `array` so that the first element becomes the last, the second |
|
|
* element becomes the second to last, and so on. |
|
|
* |
|
|
* **Note:** This method mutates `array` and is based on |
|
|
* [`Array#reverse`](https://mdn.io/Array/reverse). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to modify. |
|
|
* @returns {Array} Returns `array`. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2, 3]; |
|
|
* |
|
|
* _.reverse(array); |
|
|
* // => [3, 2, 1] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [3, 2, 1] |
|
|
*/ |
|
|
function reverse(array) { |
|
|
return array == null ? array : nativeReverse.call(array); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` from `start` up to, but not including, `end`. |
|
|
* |
|
|
* **Note:** This method is used instead of |
|
|
* [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are |
|
|
* returned. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to slice. |
|
|
* @param {number} [start=0] The start position. |
|
|
* @param {number} [end=array.length] The end position. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
*/ |
|
|
function slice(array, start, end) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
if (end && typeof end != 'number' && isIterateeCall(array, start, end)) { |
|
|
start = 0; |
|
|
end = length; |
|
|
} |
|
|
else { |
|
|
start = start == null ? 0 : toInteger(start); |
|
|
end = end === undefined ? length : toInteger(end); |
|
|
} |
|
|
return baseSlice(array, start, end); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements taken from the beginning. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to take. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.take([1, 2, 3]); |
|
|
* // => [1] |
|
|
* |
|
|
* _.take([1, 2, 3], 2); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* _.take([1, 2, 3], 5); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* _.take([1, 2, 3], 0); |
|
|
* // => [] |
|
|
*/ |
|
|
function take(array, n, guard) { |
|
|
if (!(array && array.length)) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
return baseSlice(array, 0, n < 0 ? 0 : n); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a slice of `array` with `n` elements taken from the end. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to query. |
|
|
* @param {number} [n=1] The number of elements to take. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {Array} Returns the slice of `array`. |
|
|
* @example |
|
|
* |
|
|
* _.takeRight([1, 2, 3]); |
|
|
* // => [3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 2); |
|
|
* // => [2, 3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 5); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* _.takeRight([1, 2, 3], 0); |
|
|
* // => [] |
|
|
*/ |
|
|
function takeRight(array, n, guard) { |
|
|
var length = array == null ? 0 : array.length; |
|
|
if (!length) { |
|
|
return []; |
|
|
} |
|
|
n = (guard || n === undefined) ? 1 : toInteger(n); |
|
|
n = length - n; |
|
|
return baseSlice(array, n < 0 ? 0 : n, length); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of unique values, in order, from all given arrays using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to inspect. |
|
|
* @returns {Array} Returns the new array of combined values. |
|
|
* @example |
|
|
* |
|
|
* _.union([2], [1, 2]); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
var union = baseRest(function(arrays) { |
|
|
return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true)); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a duplicate-free version of an array, using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons, in which only the first occurrence of each element |
|
|
* is kept. The order of result values is determined by the order they occur |
|
|
* in the array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
* @example |
|
|
* |
|
|
* _.uniq([2, 1, 2]); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
function uniq(array) { |
|
|
return (array && array.length) ? baseUniq(array) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.uniq` except that it accepts `iteratee` which is |
|
|
* invoked for each element in `array` to generate the criterion by which |
|
|
* uniqueness is computed. The order of result values is determined by the |
|
|
* order they occur in the array. The iteratee is invoked with one argument: |
|
|
* (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee invoked per element. |
|
|
* @returns {Array} Returns the new duplicate free array. |
|
|
* @example |
|
|
* |
|
|
* _.uniqBy([2.1, 1.2, 2.3], Math.floor); |
|
|
* // => [2.1, 1.2] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x'); |
|
|
* // => [{ 'x': 1 }, { 'x': 2 }] |
|
|
*/ |
|
|
function uniqBy(array, iteratee) { |
|
|
return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.zip` except that it accepts an array of grouped |
|
|
* elements and creates an array regrouping the elements to their pre-zip |
|
|
* configuration. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.2.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array of grouped elements to process. |
|
|
* @returns {Array} Returns the new array of regrouped elements. |
|
|
* @example |
|
|
* |
|
|
* var zipped = _.zip(['a', 'b'], [1, 2], [true, false]); |
|
|
* // => [['a', 1, true], ['b', 2, false]] |
|
|
* |
|
|
* _.unzip(zipped); |
|
|
* // => [['a', 'b'], [1, 2], [true, false]] |
|
|
*/ |
|
|
function unzip(array) { |
|
|
if (!(array && array.length)) { |
|
|
return []; |
|
|
} |
|
|
var length = 0; |
|
|
array = arrayFilter(array, function(group) { |
|
|
if (isArrayLikeObject(group)) { |
|
|
length = nativeMax(group.length, length); |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
return baseTimes(length, function(index) { |
|
|
return arrayMap(array, baseProperty(index)); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array excluding all given values using |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* for equality comparisons. |
|
|
* |
|
|
* **Note:** Unlike `_.pull`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {Array} array The array to inspect. |
|
|
* @param {...*} [values] The values to exclude. |
|
|
* @returns {Array} Returns the new array of filtered values. |
|
|
* @see _.difference, _.xor |
|
|
* @example |
|
|
* |
|
|
* _.without([2, 1, 2, 3], 1, 2); |
|
|
* // => [3] |
|
|
*/ |
|
|
var without = baseRest(function(array, values) { |
|
|
return isArrayLikeObject(array) |
|
|
? baseDifference(array, values) |
|
|
: []; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an array of grouped elements, the first of which contains the |
|
|
* first elements of the given arrays, the second of which contains the |
|
|
* second elements of the given arrays, and so on. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Array |
|
|
* @param {...Array} [arrays] The arrays to process. |
|
|
* @returns {Array} Returns the new array of grouped elements. |
|
|
* @example |
|
|
* |
|
|
* _.zip(['a', 'b'], [1, 2], [true, false]); |
|
|
* // => [['a', 1, true], ['b', 2, false]] |
|
|
*/ |
|
|
var zip = baseRest(unzip); |
|
|
|
|
|
/** |
|
|
* This method is like `_.fromPairs` except that it accepts two arrays, |
|
|
* one of property identifiers and one of corresponding values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.4.0 |
|
|
* @category Array |
|
|
* @param {Array} [props=[]] The property identifiers. |
|
|
* @param {Array} [values=[]] The property values. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* _.zipObject(['a', 'b'], [1, 2]); |
|
|
* // => { 'a': 1, 'b': 2 } |
|
|
*/ |
|
|
function zipObject(props, values) { |
|
|
return baseZipObject(props || [], values || [], assignValue); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` wrapper instance that wraps `value` with explicit method |
|
|
* chain sequences enabled. The result of such sequences must be unwrapped |
|
|
* with `_#value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.3.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to wrap. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 }, |
|
|
* { 'user': 'pebbles', 'age': 1 } |
|
|
* ]; |
|
|
* |
|
|
* var youngest = _ |
|
|
* .chain(users) |
|
|
* .sortBy('age') |
|
|
* .map(function(o) { |
|
|
* return o.user + ' is ' + o.age; |
|
|
* }) |
|
|
* .head() |
|
|
* .value(); |
|
|
* // => 'pebbles is 1' |
|
|
*/ |
|
|
function chain(value) { |
|
|
var result = lodash(value); |
|
|
result.__chain__ = true; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method invokes `interceptor` and returns `value`. The interceptor |
|
|
* is invoked with one argument; (value). The purpose of this method is to |
|
|
* "tap into" a method chain sequence in order to modify intermediate results. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to provide to `interceptor`. |
|
|
* @param {Function} interceptor The function to invoke. |
|
|
* @returns {*} Returns `value`. |
|
|
* @example |
|
|
* |
|
|
* _([1, 2, 3]) |
|
|
* .tap(function(array) { |
|
|
* // Mutate input array. |
|
|
* array.pop(); |
|
|
* }) |
|
|
* .reverse() |
|
|
* .value(); |
|
|
* // => [2, 1] |
|
|
*/ |
|
|
function tap(value, interceptor) { |
|
|
interceptor(value); |
|
|
return value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.tap` except that it returns the result of `interceptor`. |
|
|
* The purpose of this method is to "pass thru" values replacing intermediate |
|
|
* results in a method chain sequence. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to provide to `interceptor`. |
|
|
* @param {Function} interceptor The function to invoke. |
|
|
* @returns {*} Returns the result of `interceptor`. |
|
|
* @example |
|
|
* |
|
|
* _(' abc ') |
|
|
* .chain() |
|
|
* .trim() |
|
|
* .thru(function(value) { |
|
|
* return [value]; |
|
|
* }) |
|
|
* .value(); |
|
|
* // => ['abc'] |
|
|
*/ |
|
|
function thru(value, interceptor) { |
|
|
return interceptor(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is the wrapper version of `_.at`. |
|
|
* |
|
|
* @name at |
|
|
* @memberOf _ |
|
|
* @since 1.0.0 |
|
|
* @category Seq |
|
|
* @param {...(string|string[])} [paths] The property paths to pick. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c': 3 } }, 4] }; |
|
|
* |
|
|
* _(object).at(['a[0].b.c', 'a[1]']).value(); |
|
|
* // => [3, 4] |
|
|
*/ |
|
|
var wrapperAt = flatRest(function(paths) { |
|
|
var length = paths.length, |
|
|
start = length ? paths[0] : 0, |
|
|
value = this.__wrapped__, |
|
|
interceptor = function(object) { return baseAt(object, paths); }; |
|
|
|
|
|
if (length > 1 || this.__actions__.length || |
|
|
!(value instanceof LazyWrapper) || !isIndex(start)) { |
|
|
return this.thru(interceptor); |
|
|
} |
|
|
value = value.slice(start, +start + (length ? 1 : 0)); |
|
|
value.__actions__.push({ |
|
|
'func': thru, |
|
|
'args': [interceptor], |
|
|
'thisArg': undefined |
|
|
}); |
|
|
return new LodashWrapper(value, this.__chain__).thru(function(array) { |
|
|
if (length && !array.length) { |
|
|
array.push(undefined); |
|
|
} |
|
|
return array; |
|
|
}); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a `lodash` wrapper instance with explicit method chain sequences enabled. |
|
|
* |
|
|
* @name chain |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 } |
|
|
* ]; |
|
|
* |
|
|
* // A sequence without explicit chaining. |
|
|
* _(users).head(); |
|
|
* // => { 'user': 'barney', 'age': 36 } |
|
|
* |
|
|
* // A sequence with explicit chaining. |
|
|
* _(users) |
|
|
* .chain() |
|
|
* .head() |
|
|
* .pick('user') |
|
|
* .value(); |
|
|
* // => { 'user': 'barney' } |
|
|
*/ |
|
|
function wrapperChain() { |
|
|
return chain(this); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Executes the chain sequence and returns the wrapped result. |
|
|
* |
|
|
* @name commit |
|
|
* @memberOf _ |
|
|
* @since 3.2.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2]; |
|
|
* var wrapped = _(array).push(3); |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* wrapped = wrapped.commit(); |
|
|
* console.log(array); |
|
|
* // => [1, 2, 3] |
|
|
* |
|
|
* wrapped.last(); |
|
|
* // => 3 |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function wrapperCommit() { |
|
|
return new LodashWrapper(this.value(), this.__chain__); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the next value on a wrapped object following the |
|
|
* [iterator protocol](https://mdn.io/iteration_protocols#iterator). |
|
|
* |
|
|
* @name next |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the next iterator value. |
|
|
* @example |
|
|
* |
|
|
* var wrapped = _([1, 2]); |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': false, 'value': 1 } |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': false, 'value': 2 } |
|
|
* |
|
|
* wrapped.next(); |
|
|
* // => { 'done': true, 'value': undefined } |
|
|
*/ |
|
|
function wrapperNext() { |
|
|
if (this.__values__ === undefined) { |
|
|
this.__values__ = toArray(this.value()); |
|
|
} |
|
|
var done = this.__index__ >= this.__values__.length, |
|
|
value = done ? undefined : this.__values__[this.__index__++]; |
|
|
|
|
|
return { 'done': done, 'value': value }; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Enables the wrapper to be iterable. |
|
|
* |
|
|
* @name Symbol.iterator |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the wrapper object. |
|
|
* @example |
|
|
* |
|
|
* var wrapped = _([1, 2]); |
|
|
* |
|
|
* wrapped[Symbol.iterator]() === wrapped; |
|
|
* // => true |
|
|
* |
|
|
* Array.from(wrapped); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function wrapperToIterator() { |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a clone of the chain sequence planting `value` as the wrapped value. |
|
|
* |
|
|
* @name plant |
|
|
* @memberOf _ |
|
|
* @since 3.2.0 |
|
|
* @category Seq |
|
|
* @param {*} value The value to plant. |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* var wrapped = _([1, 2]).map(square); |
|
|
* var other = wrapped.plant([3, 4]); |
|
|
* |
|
|
* other.value(); |
|
|
* // => [9, 16] |
|
|
* |
|
|
* wrapped.value(); |
|
|
* // => [1, 4] |
|
|
*/ |
|
|
function wrapperPlant(value) { |
|
|
var result, |
|
|
parent = this; |
|
|
|
|
|
while (parent instanceof baseLodash) { |
|
|
var clone = wrapperClone(parent); |
|
|
clone.__index__ = 0; |
|
|
clone.__values__ = undefined; |
|
|
if (result) { |
|
|
previous.__wrapped__ = clone; |
|
|
} else { |
|
|
result = clone; |
|
|
} |
|
|
var previous = clone; |
|
|
parent = parent.__wrapped__; |
|
|
} |
|
|
previous.__wrapped__ = value; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is the wrapper version of `_.reverse`. |
|
|
* |
|
|
* **Note:** This method mutates the wrapped array. |
|
|
* |
|
|
* @name reverse |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Seq |
|
|
* @returns {Object} Returns the new `lodash` wrapper instance. |
|
|
* @example |
|
|
* |
|
|
* var array = [1, 2, 3]; |
|
|
* |
|
|
* _(array).reverse().value() |
|
|
* // => [3, 2, 1] |
|
|
* |
|
|
* console.log(array); |
|
|
* // => [3, 2, 1] |
|
|
*/ |
|
|
function wrapperReverse() { |
|
|
var value = this.__wrapped__; |
|
|
if (value instanceof LazyWrapper) { |
|
|
var wrapped = value; |
|
|
if (this.__actions__.length) { |
|
|
wrapped = new LazyWrapper(this); |
|
|
} |
|
|
wrapped = wrapped.reverse(); |
|
|
wrapped.__actions__.push({ |
|
|
'func': thru, |
|
|
'args': [reverse], |
|
|
'thisArg': undefined |
|
|
}); |
|
|
return new LodashWrapper(wrapped, this.__chain__); |
|
|
} |
|
|
return this.thru(reverse); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Executes the chain sequence to resolve the unwrapped value. |
|
|
* |
|
|
* @name value |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias toJSON, valueOf |
|
|
* @category Seq |
|
|
* @returns {*} Returns the resolved unwrapped value. |
|
|
* @example |
|
|
* |
|
|
* _([1, 2, 3]).value(); |
|
|
* // => [1, 2, 3] |
|
|
*/ |
|
|
function wrapperValue() { |
|
|
return baseWrapperValue(this.__wrapped__, this.__actions__); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates an object composed of keys generated from the results of running |
|
|
* each element of `collection` thru `iteratee`. The corresponding value of |
|
|
* each key is the number of times the key was returned by `iteratee`. The |
|
|
* iteratee is invoked with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.5.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee to transform keys. |
|
|
* @returns {Object} Returns the composed aggregate object. |
|
|
* @example |
|
|
* |
|
|
* _.countBy([6.1, 4.2, 6.3], Math.floor); |
|
|
* // => { '4': 1, '6': 2 } |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.countBy(['one', 'two', 'three'], 'length'); |
|
|
* // => { '3': 2, '5': 1 } |
|
|
*/ |
|
|
var countBy = createAggregator(function(result, value, key) { |
|
|
if (hasOwnProperty.call(result, key)) { |
|
|
++result[key]; |
|
|
} else { |
|
|
baseAssignValue(result, key, 1); |
|
|
} |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Checks if `predicate` returns truthy for **all** elements of `collection`. |
|
|
* Iteration is stopped once `predicate` returns falsey. The predicate is |
|
|
* invoked with three arguments: (value, index|key, collection). |
|
|
* |
|
|
* **Note:** This method returns `true` for |
|
|
* [empty collections](https://en.wikipedia.org/wiki/Empty_set) because |
|
|
* [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of |
|
|
* elements of empty collections. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {boolean} Returns `true` if all elements pass the predicate check, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.every([true, 1, null, 'yes'], Boolean); |
|
|
* // => false |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': false }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.every(users, { 'user': 'barney', 'active': false }); |
|
|
* // => false |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.every(users, ['active', false]); |
|
|
* // => true |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.every(users, 'active'); |
|
|
* // => false |
|
|
*/ |
|
|
function every(collection, predicate, guard) { |
|
|
var func = isArray(collection) ? arrayEvery : baseEvery; |
|
|
if (guard && isIterateeCall(collection, predicate, guard)) { |
|
|
predicate = undefined; |
|
|
} |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection`, returning an array of all elements |
|
|
* `predicate` returns truthy for. The predicate is invoked with three |
|
|
* arguments: (value, index|key, collection). |
|
|
* |
|
|
* **Note:** Unlike `_.remove`, this method returns a new array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
* @see _.reject |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* _.filter(users, function(o) { return !o.active; }); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.filter(users, { 'age': 36, 'active': true }); |
|
|
* // => objects for ['barney'] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.filter(users, ['active', false]); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.filter(users, 'active'); |
|
|
* // => objects for ['barney'] |
|
|
*/ |
|
|
function filter(collection, predicate) { |
|
|
var func = isArray(collection) ? arrayFilter : baseFilter; |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection`, returning the first element |
|
|
* `predicate` returns truthy for. The predicate is invoked with three |
|
|
* arguments: (value, index|key, collection). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param {number} [fromIndex=0] The index to search from. |
|
|
* @returns {*} Returns the matched element, else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false }, |
|
|
* { 'user': 'pebbles', 'age': 1, 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.find(users, function(o) { return o.age < 40; }); |
|
|
* // => object for 'barney' |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.find(users, { 'age': 1, 'active': true }); |
|
|
* // => object for 'pebbles' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.find(users, ['active', false]); |
|
|
* // => object for 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.find(users, 'active'); |
|
|
* // => object for 'barney' |
|
|
*/ |
|
|
var find = createFind(findIndex); |
|
|
|
|
|
/** |
|
|
* Iterates over elements of `collection` and invokes `iteratee` for each element. |
|
|
* The iteratee is invoked with three arguments: (value, index|key, collection). |
|
|
* Iteratee functions may exit iteration early by explicitly returning `false`. |
|
|
* |
|
|
* **Note:** As with other "Collections" methods, objects with a "length" |
|
|
* property are iterated like arrays. To avoid this behavior use `_.forIn` |
|
|
* or `_.forOwn` for object iteration. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @alias each |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @returns {Array|Object} Returns `collection`. |
|
|
* @see _.forEachRight |
|
|
* @example |
|
|
* |
|
|
* _.forEach([1, 2], function(value) { |
|
|
* console.log(value); |
|
|
* }); |
|
|
* // => Logs `1` then `2`. |
|
|
* |
|
|
* _.forEach({ 'a': 1, 'b': 2 }, function(value, key) { |
|
|
* console.log(key); |
|
|
* }); |
|
|
* // => Logs 'a' then 'b' (iteration order is not guaranteed). |
|
|
*/ |
|
|
function forEach(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayEach : baseEach; |
|
|
return func(collection, baseIteratee(iteratee, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of values by running each element in `collection` thru |
|
|
* `iteratee`. The iteratee is invoked with three arguments: |
|
|
* (value, index|key, collection). |
|
|
* |
|
|
* Many lodash methods are guarded to work as iteratees for methods like |
|
|
* `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`. |
|
|
* |
|
|
* The guarded methods are: |
|
|
* `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`, |
|
|
* `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`, |
|
|
* `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`, |
|
|
* `template`, `trim`, `trimEnd`, `trimStart`, and `words` |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new mapped array. |
|
|
* @example |
|
|
* |
|
|
* function square(n) { |
|
|
* return n * n; |
|
|
* } |
|
|
* |
|
|
* _.map([4, 8], square); |
|
|
* // => [16, 64] |
|
|
* |
|
|
* _.map({ 'a': 4, 'b': 8 }, square); |
|
|
* // => [16, 64] (iteration order is not guaranteed) |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney' }, |
|
|
* { 'user': 'fred' } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.map(users, 'user'); |
|
|
* // => ['barney', 'fred'] |
|
|
*/ |
|
|
function map(collection, iteratee) { |
|
|
var func = isArray(collection) ? arrayMap : baseMap; |
|
|
return func(collection, baseIteratee(iteratee, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reduces `collection` to a value which is the accumulated result of running |
|
|
* each element in `collection` thru `iteratee`, where each successive |
|
|
* invocation is supplied the return value of the previous. If `accumulator` |
|
|
* is not given, the first element of `collection` is used as the initial |
|
|
* value. The iteratee is invoked with four arguments: |
|
|
* (accumulator, value, index|key, collection). |
|
|
* |
|
|
* Many lodash methods are guarded to work as iteratees for methods like |
|
|
* `_.reduce`, `_.reduceRight`, and `_.transform`. |
|
|
* |
|
|
* The guarded methods are: |
|
|
* `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`, |
|
|
* and `sortBy` |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [iteratee=_.identity] The function invoked per iteration. |
|
|
* @param {*} [accumulator] The initial value. |
|
|
* @returns {*} Returns the accumulated value. |
|
|
* @see _.reduceRight |
|
|
* @example |
|
|
* |
|
|
* _.reduce([1, 2], function(sum, n) { |
|
|
* return sum + n; |
|
|
* }, 0); |
|
|
* // => 3 |
|
|
* |
|
|
* _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) { |
|
|
* (result[value] || (result[value] = [])).push(key); |
|
|
* return result; |
|
|
* }, {}); |
|
|
* // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed) |
|
|
*/ |
|
|
function reduce(collection, iteratee, accumulator) { |
|
|
var func = isArray(collection) ? arrayReduce : baseReduce, |
|
|
initAccum = arguments.length < 3; |
|
|
|
|
|
return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach); |
|
|
} |
|
|
|
|
|
/** |
|
|
* The opposite of `_.filter`; this method returns the elements of `collection` |
|
|
* that `predicate` does **not** return truthy for. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {Array} Returns the new filtered array. |
|
|
* @see _.filter |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': false }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': true } |
|
|
* ]; |
|
|
* |
|
|
* _.reject(users, function(o) { return !o.active; }); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.reject(users, { 'age': 40, 'active': true }); |
|
|
* // => objects for ['barney'] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.reject(users, ['active', false]); |
|
|
* // => objects for ['fred'] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.reject(users, 'active'); |
|
|
* // => objects for ['barney'] |
|
|
*/ |
|
|
function reject(collection, predicate) { |
|
|
var func = isArray(collection) ? arrayFilter : baseFilter; |
|
|
return func(collection, negate(baseIteratee(predicate, 3))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the size of `collection` by returning its length for array-like |
|
|
* values or the number of own enumerable string keyed properties for objects. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object|string} collection The collection to inspect. |
|
|
* @returns {number} Returns the collection size. |
|
|
* @example |
|
|
* |
|
|
* _.size([1, 2, 3]); |
|
|
* // => 3 |
|
|
* |
|
|
* _.size({ 'a': 1, 'b': 2 }); |
|
|
* // => 2 |
|
|
* |
|
|
* _.size('pebbles'); |
|
|
* // => 7 |
|
|
*/ |
|
|
function size(collection) { |
|
|
if (collection == null) { |
|
|
return 0; |
|
|
} |
|
|
if (isArrayLike(collection)) { |
|
|
return isString(collection) ? stringSize(collection) : collection.length; |
|
|
} |
|
|
var tag = getTag(collection); |
|
|
if (tag == mapTag || tag == setTag) { |
|
|
return collection.size; |
|
|
} |
|
|
return baseKeys(collection).length; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `predicate` returns truthy for **any** element of `collection`. |
|
|
* Iteration is stopped once `predicate` returns truthy. The predicate is |
|
|
* invoked with three arguments: (value, index|key, collection). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`. |
|
|
* @returns {boolean} Returns `true` if any element passes the predicate check, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.some([null, 0, 'yes', false], Boolean); |
|
|
* // => true |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'active': true }, |
|
|
* { 'user': 'fred', 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.some(users, { 'user': 'barney', 'active': false }); |
|
|
* // => false |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.some(users, ['active', false]); |
|
|
* // => true |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.some(users, 'active'); |
|
|
* // => true |
|
|
*/ |
|
|
function some(collection, predicate, guard) { |
|
|
var func = isArray(collection) ? arraySome : baseSome; |
|
|
if (guard && isIterateeCall(collection, predicate, guard)) { |
|
|
predicate = undefined; |
|
|
} |
|
|
return func(collection, baseIteratee(predicate, 3)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of elements, sorted in ascending order by the results of |
|
|
* running each element in a collection thru each iteratee. This method |
|
|
* performs a stable sort, that is, it preserves the original sort order of |
|
|
* equal elements. The iteratees are invoked with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Collection |
|
|
* @param {Array|Object} collection The collection to iterate over. |
|
|
* @param {...(Function|Function[])} [iteratees=[_.identity]] |
|
|
* The iteratees to sort by. |
|
|
* @returns {Array} Returns the new sorted array. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'fred', 'age': 48 }, |
|
|
* { 'user': 'barney', 'age': 36 }, |
|
|
* { 'user': 'fred', 'age': 40 }, |
|
|
* { 'user': 'barney', 'age': 34 } |
|
|
* ]; |
|
|
* |
|
|
* _.sortBy(users, [function(o) { return o.user; }]); |
|
|
* // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]] |
|
|
* |
|
|
* _.sortBy(users, ['user', 'age']); |
|
|
* // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]] |
|
|
*/ |
|
|
var sortBy = baseRest(function(collection, iteratees) { |
|
|
if (collection == null) { |
|
|
return []; |
|
|
} |
|
|
var length = iteratees.length; |
|
|
if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) { |
|
|
iteratees = []; |
|
|
} else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) { |
|
|
iteratees = [iteratees[0]]; |
|
|
} |
|
|
return baseOrderBy(collection, baseFlatten(iteratees, 1), []); |
|
|
}); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Gets the timestamp of the number of milliseconds that have elapsed since |
|
|
* the Unix epoch (1 January 1970 00:00:00 UTC). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Date |
|
|
* @returns {number} Returns the timestamp. |
|
|
* @example |
|
|
* |
|
|
* _.defer(function(stamp) { |
|
|
* console.log(_.now() - stamp); |
|
|
* }, _.now()); |
|
|
* // => Logs the number of milliseconds it took for the deferred invocation. |
|
|
*/ |
|
|
var now = function() { |
|
|
return root.Date.now(); |
|
|
}; |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func`, with the `this` binding and arguments |
|
|
* of the created function, while it's called less than `n` times. Subsequent |
|
|
* calls to the created function return the result of the last `func` invocation. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Function |
|
|
* @param {number} n The number of calls at which `func` is no longer invoked. |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new restricted function. |
|
|
* @example |
|
|
* |
|
|
* jQuery(element).on('click', _.before(5, addContactToList)); |
|
|
* // => Allows adding up to 4 contacts to the list. |
|
|
*/ |
|
|
function before(n, func) { |
|
|
var result; |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
n = toInteger(n); |
|
|
return function() { |
|
|
if (--n > 0) { |
|
|
result = func.apply(this, arguments); |
|
|
} |
|
|
if (n <= 1) { |
|
|
func = undefined; |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the `this` binding of `thisArg` |
|
|
* and `partials` prepended to the arguments it receives. |
|
|
* |
|
|
* The `_.bind.placeholder` value, which defaults to `_` in monolithic builds, |
|
|
* may be used as a placeholder for partially applied arguments. |
|
|
* |
|
|
* **Note:** Unlike native `Function#bind`, this method doesn't set the "length" |
|
|
* property of bound functions. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to bind. |
|
|
* @param {*} thisArg The `this` binding of `func`. |
|
|
* @param {...*} [partials] The arguments to be partially applied. |
|
|
* @returns {Function} Returns the new bound function. |
|
|
* @example |
|
|
* |
|
|
* function greet(greeting, punctuation) { |
|
|
* return greeting + ' ' + this.user + punctuation; |
|
|
* } |
|
|
* |
|
|
* var object = { 'user': 'fred' }; |
|
|
* |
|
|
* var bound = _.bind(greet, object, 'hi'); |
|
|
* bound('!'); |
|
|
* // => 'hi fred!' |
|
|
* |
|
|
* // Bound with placeholders. |
|
|
* var bound = _.bind(greet, object, _, '!'); |
|
|
* bound('hi'); |
|
|
* // => 'hi fred!' |
|
|
*/ |
|
|
var bind = baseRest(function(func, thisArg, partials) { |
|
|
var bitmask = WRAP_BIND_FLAG; |
|
|
if (partials.length) { |
|
|
var holders = replaceHolders(partials, getHolder(bind)); |
|
|
bitmask |= WRAP_PARTIAL_FLAG; |
|
|
} |
|
|
return createWrap(func, bitmask, thisArg, partials, holders); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a debounced function that delays invoking `func` until after `wait` |
|
|
* milliseconds have elapsed since the last time the debounced function was |
|
|
* invoked. The debounced function comes with a `cancel` method to cancel |
|
|
* delayed `func` invocations and a `flush` method to immediately invoke them. |
|
|
* Provide `options` to indicate whether `func` should be invoked on the |
|
|
* leading and/or trailing edge of the `wait` timeout. The `func` is invoked |
|
|
* with the last arguments provided to the debounced function. Subsequent |
|
|
* calls to the debounced function return the result of the last `func` |
|
|
* invocation. |
|
|
* |
|
|
* **Note:** If `leading` and `trailing` options are `true`, `func` is |
|
|
* invoked on the trailing edge of the timeout only if the debounced function |
|
|
* is invoked more than once during the `wait` timeout. |
|
|
* |
|
|
* If `wait` is `0` and `leading` is `false`, `func` invocation is deferred |
|
|
* until to the next tick, similar to `setTimeout` with a timeout of `0`. |
|
|
* |
|
|
* See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/) |
|
|
* for details over the differences between `_.debounce` and `_.throttle`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to debounce. |
|
|
* @param {number} [wait=0] The number of milliseconds to delay. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.leading=false] |
|
|
* Specify invoking on the leading edge of the timeout. |
|
|
* @param {number} [options.maxWait] |
|
|
* The maximum time `func` is allowed to be delayed before it's invoked. |
|
|
* @param {boolean} [options.trailing=true] |
|
|
* Specify invoking on the trailing edge of the timeout. |
|
|
* @returns {Function} Returns the new debounced function. |
|
|
* @example |
|
|
* |
|
|
* // Avoid costly calculations while the window size is in flux. |
|
|
* jQuery(window).on('resize', _.debounce(calculateLayout, 150)); |
|
|
* |
|
|
* // Invoke `sendMail` when clicked, debouncing subsequent calls. |
|
|
* jQuery(element).on('click', _.debounce(sendMail, 300, { |
|
|
* 'leading': true, |
|
|
* 'trailing': false |
|
|
* })); |
|
|
* |
|
|
* // Ensure `batchLog` is invoked once after 1 second of debounced calls. |
|
|
* var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 }); |
|
|
* var source = new EventSource('/stream'); |
|
|
* jQuery(source).on('message', debounced); |
|
|
* |
|
|
* // Cancel the trailing debounced invocation. |
|
|
* jQuery(window).on('popstate', debounced.cancel); |
|
|
*/ |
|
|
function debounce(func, wait, options) { |
|
|
var lastArgs, |
|
|
lastThis, |
|
|
maxWait, |
|
|
result, |
|
|
timerId, |
|
|
lastCallTime, |
|
|
lastInvokeTime = 0, |
|
|
leading = false, |
|
|
maxing = false, |
|
|
trailing = true; |
|
|
|
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
wait = toNumber(wait) || 0; |
|
|
if (isObject(options)) { |
|
|
leading = !!options.leading; |
|
|
maxing = 'maxWait' in options; |
|
|
maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait; |
|
|
trailing = 'trailing' in options ? !!options.trailing : trailing; |
|
|
} |
|
|
|
|
|
function invokeFunc(time) { |
|
|
var args = lastArgs, |
|
|
thisArg = lastThis; |
|
|
|
|
|
lastArgs = lastThis = undefined; |
|
|
lastInvokeTime = time; |
|
|
result = func.apply(thisArg, args); |
|
|
return result; |
|
|
} |
|
|
|
|
|
function leadingEdge(time) { |
|
|
// Reset any `maxWait` timer. |
|
|
lastInvokeTime = time; |
|
|
// Start the timer for the trailing edge. |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
// Invoke the leading edge. |
|
|
return leading ? invokeFunc(time) : result; |
|
|
} |
|
|
|
|
|
function remainingWait(time) { |
|
|
var timeSinceLastCall = time - lastCallTime, |
|
|
timeSinceLastInvoke = time - lastInvokeTime, |
|
|
timeWaiting = wait - timeSinceLastCall; |
|
|
|
|
|
return maxing |
|
|
? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke) |
|
|
: timeWaiting; |
|
|
} |
|
|
|
|
|
function shouldInvoke(time) { |
|
|
var timeSinceLastCall = time - lastCallTime, |
|
|
timeSinceLastInvoke = time - lastInvokeTime; |
|
|
|
|
|
// Either this is the first call, activity has stopped and we're at the |
|
|
// trailing edge, the system time has gone backwards and we're treating |
|
|
// it as the trailing edge, or we've hit the `maxWait` limit. |
|
|
return (lastCallTime === undefined || (timeSinceLastCall >= wait) || |
|
|
(timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait)); |
|
|
} |
|
|
|
|
|
function timerExpired() { |
|
|
var time = now(); |
|
|
if (shouldInvoke(time)) { |
|
|
return trailingEdge(time); |
|
|
} |
|
|
// Restart the timer. |
|
|
timerId = setTimeout(timerExpired, remainingWait(time)); |
|
|
} |
|
|
|
|
|
function trailingEdge(time) { |
|
|
timerId = undefined; |
|
|
|
|
|
// Only invoke if we have `lastArgs` which means `func` has been |
|
|
// debounced at least once. |
|
|
if (trailing && lastArgs) { |
|
|
return invokeFunc(time); |
|
|
} |
|
|
lastArgs = lastThis = undefined; |
|
|
return result; |
|
|
} |
|
|
|
|
|
function cancel() { |
|
|
if (timerId !== undefined) { |
|
|
clearTimeout(timerId); |
|
|
} |
|
|
lastInvokeTime = 0; |
|
|
lastArgs = lastCallTime = lastThis = timerId = undefined; |
|
|
} |
|
|
|
|
|
function flush() { |
|
|
return timerId === undefined ? result : trailingEdge(now()); |
|
|
} |
|
|
|
|
|
function debounced() { |
|
|
var time = now(), |
|
|
isInvoking = shouldInvoke(time); |
|
|
|
|
|
lastArgs = arguments; |
|
|
lastThis = this; |
|
|
lastCallTime = time; |
|
|
|
|
|
if (isInvoking) { |
|
|
if (timerId === undefined) { |
|
|
return leadingEdge(lastCallTime); |
|
|
} |
|
|
if (maxing) { |
|
|
// Handle invocations in a tight loop. |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
return invokeFunc(lastCallTime); |
|
|
} |
|
|
} |
|
|
if (timerId === undefined) { |
|
|
timerId = setTimeout(timerExpired, wait); |
|
|
} |
|
|
return result; |
|
|
} |
|
|
debounced.cancel = cancel; |
|
|
debounced.flush = flush; |
|
|
return debounced; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Defers invoking the `func` until the current call stack has cleared. Any |
|
|
* additional arguments are provided to `func` when it's invoked. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to defer. |
|
|
* @param {...*} [args] The arguments to invoke `func` with. |
|
|
* @returns {number} Returns the timer id. |
|
|
* @example |
|
|
* |
|
|
* _.defer(function(text) { |
|
|
* console.log(text); |
|
|
* }, 'deferred'); |
|
|
* // => Logs 'deferred' after one millisecond. |
|
|
*/ |
|
|
var defer = baseRest(function(func, args) { |
|
|
return baseDelay(func, 1, args); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Invokes `func` after `wait` milliseconds. Any additional arguments are |
|
|
* provided to `func` when it's invoked. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to delay. |
|
|
* @param {number} wait The number of milliseconds to delay invocation. |
|
|
* @param {...*} [args] The arguments to invoke `func` with. |
|
|
* @returns {number} Returns the timer id. |
|
|
* @example |
|
|
* |
|
|
* _.delay(function(text) { |
|
|
* console.log(text); |
|
|
* }, 1000, 'later'); |
|
|
* // => Logs 'later' after one second. |
|
|
*/ |
|
|
var delay = baseRest(function(func, wait, args) { |
|
|
return baseDelay(func, toNumber(wait) || 0, args); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates a function that memoizes the result of `func`. If `resolver` is |
|
|
* provided, it determines the cache key for storing the result based on the |
|
|
* arguments provided to the memoized function. By default, the first argument |
|
|
* provided to the memoized function is used as the map cache key. The `func` |
|
|
* is invoked with the `this` binding of the memoized function. |
|
|
* |
|
|
* **Note:** The cache is exposed as the `cache` property on the memoized |
|
|
* function. Its creation may be customized by replacing the `_.memoize.Cache` |
|
|
* constructor with one whose instances implement the |
|
|
* [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object) |
|
|
* method interface of `clear`, `delete`, `get`, `has`, and `set`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to have its output memoized. |
|
|
* @param {Function} [resolver] The function to resolve the cache key. |
|
|
* @returns {Function} Returns the new memoized function. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2 }; |
|
|
* var other = { 'c': 3, 'd': 4 }; |
|
|
* |
|
|
* var values = _.memoize(_.values); |
|
|
* values(object); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* values(other); |
|
|
* // => [3, 4] |
|
|
* |
|
|
* object.a = 2; |
|
|
* values(object); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* // Modify the result cache. |
|
|
* values.cache.set(object, ['a', 'b']); |
|
|
* values(object); |
|
|
* // => ['a', 'b'] |
|
|
* |
|
|
* // Replace `_.memoize.Cache`. |
|
|
* _.memoize.Cache = WeakMap; |
|
|
*/ |
|
|
function memoize(func, resolver) { |
|
|
if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
var memoized = function() { |
|
|
var args = arguments, |
|
|
key = resolver ? resolver.apply(this, args) : args[0], |
|
|
cache = memoized.cache; |
|
|
|
|
|
if (cache.has(key)) { |
|
|
return cache.get(key); |
|
|
} |
|
|
var result = func.apply(this, args); |
|
|
memoized.cache = cache.set(key, result) || cache; |
|
|
return result; |
|
|
}; |
|
|
memoized.cache = new (memoize.Cache || MapCache); |
|
|
return memoized; |
|
|
} |
|
|
|
|
|
// Expose `MapCache`. |
|
|
memoize.Cache = MapCache; |
|
|
|
|
|
/** |
|
|
* Creates a function that negates the result of the predicate `func`. The |
|
|
* `func` predicate is invoked with the `this` binding and arguments of the |
|
|
* created function. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Function |
|
|
* @param {Function} predicate The predicate to negate. |
|
|
* @returns {Function} Returns the new negated function. |
|
|
* @example |
|
|
* |
|
|
* function isEven(n) { |
|
|
* return n % 2 == 0; |
|
|
* } |
|
|
* |
|
|
* _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven)); |
|
|
* // => [1, 3, 5] |
|
|
*/ |
|
|
function negate(predicate) { |
|
|
if (typeof predicate != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
return function() { |
|
|
var args = arguments; |
|
|
switch (args.length) { |
|
|
case 0: return !predicate.call(this); |
|
|
case 1: return !predicate.call(this, args[0]); |
|
|
case 2: return !predicate.call(this, args[0], args[1]); |
|
|
case 3: return !predicate.call(this, args[0], args[1], args[2]); |
|
|
} |
|
|
return !predicate.apply(this, args); |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that is restricted to invoking `func` once. Repeat calls |
|
|
* to the function return the value of the first invocation. The `func` is |
|
|
* invoked with the `this` binding and arguments of the created function. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to restrict. |
|
|
* @returns {Function} Returns the new restricted function. |
|
|
* @example |
|
|
* |
|
|
* var initialize = _.once(createApplication); |
|
|
* initialize(); |
|
|
* initialize(); |
|
|
* // => `createApplication` is invoked once |
|
|
*/ |
|
|
function once(func) { |
|
|
return before(2, func); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the `this` binding of the |
|
|
* created function and arguments from `start` and beyond provided as |
|
|
* an array. |
|
|
* |
|
|
* **Note:** This method is based on the |
|
|
* [rest parameter](https://mdn.io/rest_parameters). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to apply a rest parameter to. |
|
|
* @param {number} [start=func.length-1] The start position of the rest parameter. |
|
|
* @returns {Function} Returns the new function. |
|
|
* @example |
|
|
* |
|
|
* var say = _.rest(function(what, names) { |
|
|
* return what + ' ' + _.initial(names).join(', ') + |
|
|
* (_.size(names) > 1 ? ', & ' : '') + _.last(names); |
|
|
* }); |
|
|
* |
|
|
* say('hello', 'fred', 'barney', 'pebbles'); |
|
|
* // => 'hello fred, barney, & pebbles' |
|
|
*/ |
|
|
function rest(func, start) { |
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
start = start === undefined ? start : toInteger(start); |
|
|
return baseRest(func, start); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a throttled function that only invokes `func` at most once per |
|
|
* every `wait` milliseconds. The throttled function comes with a `cancel` |
|
|
* method to cancel delayed `func` invocations and a `flush` method to |
|
|
* immediately invoke them. Provide `options` to indicate whether `func` |
|
|
* should be invoked on the leading and/or trailing edge of the `wait` |
|
|
* timeout. The `func` is invoked with the last arguments provided to the |
|
|
* throttled function. Subsequent calls to the throttled function return the |
|
|
* result of the last `func` invocation. |
|
|
* |
|
|
* **Note:** If `leading` and `trailing` options are `true`, `func` is |
|
|
* invoked on the trailing edge of the timeout only if the throttled function |
|
|
* is invoked more than once during the `wait` timeout. |
|
|
* |
|
|
* If `wait` is `0` and `leading` is `false`, `func` invocation is deferred |
|
|
* until to the next tick, similar to `setTimeout` with a timeout of `0`. |
|
|
* |
|
|
* See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/) |
|
|
* for details over the differences between `_.throttle` and `_.debounce`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Function |
|
|
* @param {Function} func The function to throttle. |
|
|
* @param {number} [wait=0] The number of milliseconds to throttle invocations to. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.leading=true] |
|
|
* Specify invoking on the leading edge of the timeout. |
|
|
* @param {boolean} [options.trailing=true] |
|
|
* Specify invoking on the trailing edge of the timeout. |
|
|
* @returns {Function} Returns the new throttled function. |
|
|
* @example |
|
|
* |
|
|
* // Avoid excessively updating the position while scrolling. |
|
|
* jQuery(window).on('scroll', _.throttle(updatePosition, 100)); |
|
|
* |
|
|
* // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes. |
|
|
* var throttled = _.throttle(renewToken, 300000, { 'trailing': false }); |
|
|
* jQuery(element).on('click', throttled); |
|
|
* |
|
|
* // Cancel the trailing throttled invocation. |
|
|
* jQuery(window).on('popstate', throttled.cancel); |
|
|
*/ |
|
|
function throttle(func, wait, options) { |
|
|
var leading = true, |
|
|
trailing = true; |
|
|
|
|
|
if (typeof func != 'function') { |
|
|
throw new TypeError(FUNC_ERROR_TEXT); |
|
|
} |
|
|
if (isObject(options)) { |
|
|
leading = 'leading' in options ? !!options.leading : leading; |
|
|
trailing = 'trailing' in options ? !!options.trailing : trailing; |
|
|
} |
|
|
return debounce(func, wait, { |
|
|
'leading': leading, |
|
|
'maxWait': wait, |
|
|
'trailing': trailing |
|
|
}); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a shallow clone of `value`. |
|
|
* |
|
|
* **Note:** This method is loosely based on the |
|
|
* [structured clone algorithm](https://mdn.io/Structured_clone_algorithm) |
|
|
* and supports cloning arrays, array buffers, booleans, date objects, maps, |
|
|
* numbers, `Object` objects, regexes, sets, strings, symbols, and typed |
|
|
* arrays. The own enumerable properties of `arguments` objects are cloned |
|
|
* as plain objects. An empty object is returned for uncloneable values such |
|
|
* as error objects, functions, DOM nodes, and WeakMaps. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to clone. |
|
|
* @returns {*} Returns the cloned value. |
|
|
* @see _.cloneDeep |
|
|
* @example |
|
|
* |
|
|
* var objects = [{ 'a': 1 }, { 'b': 2 }]; |
|
|
* |
|
|
* var shallow = _.clone(objects); |
|
|
* console.log(shallow[0] === objects[0]); |
|
|
* // => true |
|
|
*/ |
|
|
function clone(value) { |
|
|
return baseClone(value, CLONE_SYMBOLS_FLAG); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.clone` except that it recursively clones `value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to recursively clone. |
|
|
* @returns {*} Returns the deep cloned value. |
|
|
* @see _.clone |
|
|
* @example |
|
|
* |
|
|
* var objects = [{ 'a': 1 }, { 'b': 2 }]; |
|
|
* |
|
|
* var deep = _.cloneDeep(objects); |
|
|
* console.log(deep[0] === objects[0]); |
|
|
* // => false |
|
|
*/ |
|
|
function cloneDeep(value) { |
|
|
return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Performs a |
|
|
* [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero) |
|
|
* comparison between two values to determine if they are equivalent. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* var other = { 'a': 1 }; |
|
|
* |
|
|
* _.eq(object, object); |
|
|
* // => true |
|
|
* |
|
|
* _.eq(object, other); |
|
|
* // => false |
|
|
* |
|
|
* _.eq('a', 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.eq('a', Object('a')); |
|
|
* // => false |
|
|
* |
|
|
* _.eq(NaN, NaN); |
|
|
* // => true |
|
|
*/ |
|
|
function eq(value, other) { |
|
|
return value === other || (value !== value && other !== other); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is likely an `arguments` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an `arguments` object, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArguments(function() { return arguments; }()); |
|
|
* // => true |
|
|
* |
|
|
* _.isArguments([1, 2, 3]); |
|
|
* // => false |
|
|
*/ |
|
|
var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) { |
|
|
return isObjectLike(value) && hasOwnProperty.call(value, 'callee') && |
|
|
!propertyIsEnumerable.call(value, 'callee'); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as an `Array` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an array, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArray([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArray(document.body.children); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray('abc'); |
|
|
* // => false |
|
|
* |
|
|
* _.isArray(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
var isArray = Array.isArray; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is array-like. A value is considered array-like if it's |
|
|
* not a function and has a `value.length` that's an integer greater than or |
|
|
* equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is array-like, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArrayLike([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike(document.body.children); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike('abc'); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLike(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
function isArrayLike(value) { |
|
|
return value != null && isLength(value.length) && !isFunction(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.isArrayLike` except that it also checks if `value` |
|
|
* is an object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an array-like object, |
|
|
* else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isArrayLikeObject([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLikeObject(document.body.children); |
|
|
* // => true |
|
|
* |
|
|
* _.isArrayLikeObject('abc'); |
|
|
* // => false |
|
|
* |
|
|
* _.isArrayLikeObject(_.noop); |
|
|
* // => false |
|
|
*/ |
|
|
function isArrayLikeObject(value) { |
|
|
return isObjectLike(value) && isArrayLike(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a boolean primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a boolean, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isBoolean(false); |
|
|
* // => true |
|
|
* |
|
|
* _.isBoolean(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isBoolean(value) { |
|
|
return value === true || value === false || |
|
|
(isObjectLike(value) && baseGetTag(value) == boolTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a buffer. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a buffer, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isBuffer(new Buffer(2)); |
|
|
* // => true |
|
|
* |
|
|
* _.isBuffer(new Uint8Array(2)); |
|
|
* // => false |
|
|
*/ |
|
|
var isBuffer = nativeIsBuffer || stubFalse; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Date` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a date object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isDate(new Date); |
|
|
* // => true |
|
|
* |
|
|
* _.isDate('Mon April 23 2012'); |
|
|
* // => false |
|
|
*/ |
|
|
var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is an empty object, collection, map, or set. |
|
|
* |
|
|
* Objects are considered empty if they have no own enumerable string keyed |
|
|
* properties. |
|
|
* |
|
|
* Array-like values such as `arguments` objects, arrays, buffers, strings, or |
|
|
* jQuery-like collections are considered empty if they have a `length` of `0`. |
|
|
* Similarly, maps and sets are considered empty if they have a `size` of `0`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is empty, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isEmpty(null); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty(true); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty(1); |
|
|
* // => true |
|
|
* |
|
|
* _.isEmpty([1, 2, 3]); |
|
|
* // => false |
|
|
* |
|
|
* _.isEmpty({ 'a': 1 }); |
|
|
* // => false |
|
|
*/ |
|
|
function isEmpty(value) { |
|
|
if (value == null) { |
|
|
return true; |
|
|
} |
|
|
if (isArrayLike(value) && |
|
|
(isArray(value) || typeof value == 'string' || typeof value.splice == 'function' || |
|
|
isBuffer(value) || isTypedArray(value) || isArguments(value))) { |
|
|
return !value.length; |
|
|
} |
|
|
var tag = getTag(value); |
|
|
if (tag == mapTag || tag == setTag) { |
|
|
return !value.size; |
|
|
} |
|
|
if (isPrototype(value)) { |
|
|
return !baseKeys(value).length; |
|
|
} |
|
|
for (var key in value) { |
|
|
if (hasOwnProperty.call(value, key)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Performs a deep comparison between two values to determine if they are |
|
|
* equivalent. |
|
|
* |
|
|
* **Note:** This method supports comparing arrays, array buffers, booleans, |
|
|
* date objects, error objects, maps, numbers, `Object` objects, regexes, |
|
|
* sets, strings, symbols, and typed arrays. `Object` objects are compared |
|
|
* by their own, not inherited, enumerable properties. Functions and DOM |
|
|
* nodes are compared by strict equality, i.e. `===`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to compare. |
|
|
* @param {*} other The other value to compare. |
|
|
* @returns {boolean} Returns `true` if the values are equivalent, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* var other = { 'a': 1 }; |
|
|
* |
|
|
* _.isEqual(object, other); |
|
|
* // => true |
|
|
* |
|
|
* object === other; |
|
|
* // => false |
|
|
*/ |
|
|
function isEqual(value, other) { |
|
|
return baseIsEqual(value, other); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a finite primitive number. |
|
|
* |
|
|
* **Note:** This method is based on |
|
|
* [`Number.isFinite`](https://mdn.io/Number/isFinite). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a finite number, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isFinite(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isFinite(Number.MIN_VALUE); |
|
|
* // => true |
|
|
* |
|
|
* _.isFinite(Infinity); |
|
|
* // => false |
|
|
* |
|
|
* _.isFinite('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isFinite(value) { |
|
|
return typeof value == 'number' && nativeIsFinite(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Function` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a function, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isFunction(_); |
|
|
* // => true |
|
|
* |
|
|
* _.isFunction(/abc/); |
|
|
* // => false |
|
|
*/ |
|
|
function isFunction(value) { |
|
|
if (!isObject(value)) { |
|
|
return false; |
|
|
} |
|
|
// The use of `Object#toString` avoids issues with the `typeof` operator |
|
|
// in Safari 9 which returns 'object' for typed arrays and other constructors. |
|
|
var tag = baseGetTag(value); |
|
|
return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a valid array-like length. |
|
|
* |
|
|
* **Note:** This method is loosely based on |
|
|
* [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a valid length, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isLength(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isLength(Number.MIN_VALUE); |
|
|
* // => false |
|
|
* |
|
|
* _.isLength(Infinity); |
|
|
* // => false |
|
|
* |
|
|
* _.isLength('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isLength(value) { |
|
|
return typeof value == 'number' && |
|
|
value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is the |
|
|
* [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types) |
|
|
* of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`) |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is an object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isObject({}); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject(_.noop); |
|
|
* // => true |
|
|
* |
|
|
* _.isObject(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isObject(value) { |
|
|
var type = typeof value; |
|
|
return value != null && (type == 'object' || type == 'function'); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is object-like. A value is object-like if it's not `null` |
|
|
* and has a `typeof` result of "object". |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is object-like, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isObjectLike({}); |
|
|
* // => true |
|
|
* |
|
|
* _.isObjectLike([1, 2, 3]); |
|
|
* // => true |
|
|
* |
|
|
* _.isObjectLike(_.noop); |
|
|
* // => false |
|
|
* |
|
|
* _.isObjectLike(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isObjectLike(value) { |
|
|
return value != null && typeof value == 'object'; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Map` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a map, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isMap(new Map); |
|
|
* // => true |
|
|
* |
|
|
* _.isMap(new WeakMap); |
|
|
* // => false |
|
|
*/ |
|
|
var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `NaN`. |
|
|
* |
|
|
* **Note:** This method is based on |
|
|
* [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as |
|
|
* global [`isNaN`](https://mdn.io/isNaN) which returns `true` for |
|
|
* `undefined` and other non-number values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `NaN`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNaN(NaN); |
|
|
* // => true |
|
|
* |
|
|
* _.isNaN(new Number(NaN)); |
|
|
* // => true |
|
|
* |
|
|
* isNaN(undefined); |
|
|
* // => true |
|
|
* |
|
|
* _.isNaN(undefined); |
|
|
* // => false |
|
|
*/ |
|
|
function isNaN(value) { |
|
|
// An `NaN` primitive is the only value that is not equal to itself. |
|
|
// Perform the `toStringTag` check first to avoid errors with some |
|
|
// ActiveX objects in IE. |
|
|
return isNumber(value) && value != +value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `null`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `null`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNull(null); |
|
|
* // => true |
|
|
* |
|
|
* _.isNull(void 0); |
|
|
* // => false |
|
|
*/ |
|
|
function isNull(value) { |
|
|
return value === null; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Number` primitive or object. |
|
|
* |
|
|
* **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are |
|
|
* classified as numbers, use the `_.isFinite` method. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a number, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isNumber(3); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber(Number.MIN_VALUE); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber(Infinity); |
|
|
* // => true |
|
|
* |
|
|
* _.isNumber('3'); |
|
|
* // => false |
|
|
*/ |
|
|
function isNumber(value) { |
|
|
return typeof value == 'number' || |
|
|
(isObjectLike(value) && baseGetTag(value) == numberTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is a plain object, that is, an object created by the |
|
|
* `Object` constructor or one with a `[[Prototype]]` of `null`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.8.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a plain object, else `false`. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* } |
|
|
* |
|
|
* _.isPlainObject(new Foo); |
|
|
* // => false |
|
|
* |
|
|
* _.isPlainObject([1, 2, 3]); |
|
|
* // => false |
|
|
* |
|
|
* _.isPlainObject({ 'x': 0, 'y': 0 }); |
|
|
* // => true |
|
|
* |
|
|
* _.isPlainObject(Object.create(null)); |
|
|
* // => true |
|
|
*/ |
|
|
function isPlainObject(value) { |
|
|
if (!isObjectLike(value) || baseGetTag(value) != objectTag) { |
|
|
return false; |
|
|
} |
|
|
var proto = getPrototype(value); |
|
|
if (proto === null) { |
|
|
return true; |
|
|
} |
|
|
var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor; |
|
|
return typeof Ctor == 'function' && Ctor instanceof Ctor && |
|
|
funcToString.call(Ctor) == objectCtorString; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `RegExp` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.1.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a regexp, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isRegExp(/abc/); |
|
|
* // => true |
|
|
* |
|
|
* _.isRegExp('/abc/'); |
|
|
* // => false |
|
|
*/ |
|
|
var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Set` object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.3.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a set, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isSet(new Set); |
|
|
* // => true |
|
|
* |
|
|
* _.isSet(new WeakSet); |
|
|
* // => false |
|
|
*/ |
|
|
var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `String` primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a string, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isString('abc'); |
|
|
* // => true |
|
|
* |
|
|
* _.isString(1); |
|
|
* // => false |
|
|
*/ |
|
|
function isString(value) { |
|
|
return typeof value == 'string' || |
|
|
(!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a `Symbol` primitive or object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a symbol, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isSymbol(Symbol.iterator); |
|
|
* // => true |
|
|
* |
|
|
* _.isSymbol('abc'); |
|
|
* // => false |
|
|
*/ |
|
|
function isSymbol(value) { |
|
|
return typeof value == 'symbol' || |
|
|
(isObjectLike(value) && baseGetTag(value) == symbolTag); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `value` is classified as a typed array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is a typed array, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isTypedArray(new Uint8Array); |
|
|
* // => true |
|
|
* |
|
|
* _.isTypedArray([]); |
|
|
* // => false |
|
|
*/ |
|
|
var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray; |
|
|
|
|
|
/** |
|
|
* Checks if `value` is `undefined`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to check. |
|
|
* @returns {boolean} Returns `true` if `value` is `undefined`, else `false`. |
|
|
* @example |
|
|
* |
|
|
* _.isUndefined(void 0); |
|
|
* // => true |
|
|
* |
|
|
* _.isUndefined(null); |
|
|
* // => false |
|
|
*/ |
|
|
function isUndefined(value) { |
|
|
return value === undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to an array. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {Array} Returns the converted array. |
|
|
* @example |
|
|
* |
|
|
* _.toArray({ 'a': 1, 'b': 2 }); |
|
|
* // => [1, 2] |
|
|
* |
|
|
* _.toArray('abc'); |
|
|
* // => ['a', 'b', 'c'] |
|
|
* |
|
|
* _.toArray(1); |
|
|
* // => [] |
|
|
* |
|
|
* _.toArray(null); |
|
|
* // => [] |
|
|
*/ |
|
|
function toArray(value) { |
|
|
if (!value) { |
|
|
return []; |
|
|
} |
|
|
if (isArrayLike(value)) { |
|
|
return isString(value) ? stringToArray(value) : copyArray(value); |
|
|
} |
|
|
if (symIterator && value[symIterator]) { |
|
|
return iteratorToArray(value[symIterator]()); |
|
|
} |
|
|
var tag = getTag(value), |
|
|
func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values); |
|
|
|
|
|
return func(value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a finite number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.12.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {number} Returns the converted number. |
|
|
* @example |
|
|
* |
|
|
* _.toFinite(3.2); |
|
|
* // => 3.2 |
|
|
* |
|
|
* _.toFinite(Number.MIN_VALUE); |
|
|
* // => 5e-324 |
|
|
* |
|
|
* _.toFinite(Infinity); |
|
|
* // => 1.7976931348623157e+308 |
|
|
* |
|
|
* _.toFinite('3.2'); |
|
|
* // => 3.2 |
|
|
*/ |
|
|
function toFinite(value) { |
|
|
if (!value) { |
|
|
return value === 0 ? value : 0; |
|
|
} |
|
|
value = toNumber(value); |
|
|
if (value === INFINITY || value === -INFINITY) { |
|
|
var sign = (value < 0 ? -1 : 1); |
|
|
return sign * MAX_INTEGER; |
|
|
} |
|
|
return value === value ? value : 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to an integer. |
|
|
* |
|
|
* **Note:** This method is loosely based on |
|
|
* [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {number} Returns the converted integer. |
|
|
* @example |
|
|
* |
|
|
* _.toInteger(3.2); |
|
|
* // => 3 |
|
|
* |
|
|
* _.toInteger(Number.MIN_VALUE); |
|
|
* // => 0 |
|
|
* |
|
|
* _.toInteger(Infinity); |
|
|
* // => 1.7976931348623157e+308 |
|
|
* |
|
|
* _.toInteger('3.2'); |
|
|
* // => 3 |
|
|
*/ |
|
|
function toInteger(value) { |
|
|
var result = toFinite(value), |
|
|
remainder = result % 1; |
|
|
|
|
|
return result === result ? (remainder ? result - remainder : result) : 0; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to process. |
|
|
* @returns {number} Returns the number. |
|
|
* @example |
|
|
* |
|
|
* _.toNumber(3.2); |
|
|
* // => 3.2 |
|
|
* |
|
|
* _.toNumber(Number.MIN_VALUE); |
|
|
* // => 5e-324 |
|
|
* |
|
|
* _.toNumber(Infinity); |
|
|
* // => Infinity |
|
|
* |
|
|
* _.toNumber('3.2'); |
|
|
* // => 3.2 |
|
|
*/ |
|
|
function toNumber(value) { |
|
|
if (typeof value == 'number') { |
|
|
return value; |
|
|
} |
|
|
if (isSymbol(value)) { |
|
|
return NAN; |
|
|
} |
|
|
if (isObject(value)) { |
|
|
var other = typeof value.valueOf == 'function' ? value.valueOf() : value; |
|
|
value = isObject(other) ? (other + '') : other; |
|
|
} |
|
|
if (typeof value != 'string') { |
|
|
return value === 0 ? value : +value; |
|
|
} |
|
|
value = value.replace(reTrim, ''); |
|
|
var isBinary = reIsBinary.test(value); |
|
|
return (isBinary || reIsOctal.test(value)) |
|
|
? freeParseInt(value.slice(2), isBinary ? 2 : 8) |
|
|
: (reIsBadHex.test(value) ? NAN : +value); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a plain object flattening inherited enumerable string |
|
|
* keyed properties of `value` to own properties of the plain object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {Object} Returns the converted plain object. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.assign({ 'a': 1 }, new Foo); |
|
|
* // => { 'a': 1, 'b': 2 } |
|
|
* |
|
|
* _.assign({ 'a': 1 }, _.toPlainObject(new Foo)); |
|
|
* // => { 'a': 1, 'b': 2, 'c': 3 } |
|
|
*/ |
|
|
function toPlainObject(value) { |
|
|
return copyObject(value, keysIn(value)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Converts `value` to a string. An empty string is returned for `null` |
|
|
* and `undefined` values. The sign of `-0` is preserved. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Lang |
|
|
* @param {*} value The value to convert. |
|
|
* @returns {string} Returns the converted string. |
|
|
* @example |
|
|
* |
|
|
* _.toString(null); |
|
|
* // => '' |
|
|
* |
|
|
* _.toString(-0); |
|
|
* // => '-0' |
|
|
* |
|
|
* _.toString([1, 2, 3]); |
|
|
* // => '1,2,3' |
|
|
*/ |
|
|
function toString(value) { |
|
|
return value == null ? '' : baseToString(value); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* This method is like `_.assign` except that it iterates over own and |
|
|
* inherited source properties. |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @alias extend |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} [sources] The source objects. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @see _.assign |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* } |
|
|
* |
|
|
* function Bar() { |
|
|
* this.c = 3; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.b = 2; |
|
|
* Bar.prototype.d = 4; |
|
|
* |
|
|
* _.assignIn({ 'a': 0 }, new Foo, new Bar); |
|
|
* // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 } |
|
|
*/ |
|
|
var assignIn = createAssigner(function(object, source) { |
|
|
copyObject(source, keysIn(source), object); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an object that inherits from the `prototype` object. If a |
|
|
* `properties` object is given, its own enumerable string keyed properties |
|
|
* are assigned to the created object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.3.0 |
|
|
* @category Object |
|
|
* @param {Object} prototype The object to inherit from. |
|
|
* @param {Object} [properties] The properties to assign to the object. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* function Shape() { |
|
|
* this.x = 0; |
|
|
* this.y = 0; |
|
|
* } |
|
|
* |
|
|
* function Circle() { |
|
|
* Shape.call(this); |
|
|
* } |
|
|
* |
|
|
* Circle.prototype = _.create(Shape.prototype, { |
|
|
* 'constructor': Circle |
|
|
* }); |
|
|
* |
|
|
* var circle = new Circle; |
|
|
* circle instanceof Circle; |
|
|
* // => true |
|
|
* |
|
|
* circle instanceof Shape; |
|
|
* // => true |
|
|
*/ |
|
|
function create(prototype, properties) { |
|
|
var result = baseCreate(prototype); |
|
|
return properties == null ? result : baseAssign(result, properties); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Assigns own and inherited enumerable string keyed properties of source |
|
|
* objects to the destination object for all destination properties that |
|
|
* resolve to `undefined`. Source objects are applied from left to right. |
|
|
* Once a property is set, additional values of the same property are ignored. |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} [sources] The source objects. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @see _.defaultsDeep |
|
|
* @example |
|
|
* |
|
|
* _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 }); |
|
|
* // => { 'a': 1, 'b': 2 } |
|
|
*/ |
|
|
var defaults = baseRest(function(object, sources) { |
|
|
object = Object(object); |
|
|
|
|
|
var index = -1; |
|
|
var length = sources.length; |
|
|
var guard = length > 2 ? sources[2] : undefined; |
|
|
|
|
|
if (guard && isIterateeCall(sources[0], sources[1], guard)) { |
|
|
length = 1; |
|
|
} |
|
|
|
|
|
while (++index < length) { |
|
|
var source = sources[index]; |
|
|
var props = keysIn(source); |
|
|
var propsIndex = -1; |
|
|
var propsLength = props.length; |
|
|
|
|
|
while (++propsIndex < propsLength) { |
|
|
var key = props[propsIndex]; |
|
|
var value = object[key]; |
|
|
|
|
|
if (value === undefined || |
|
|
(eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) { |
|
|
object[key] = source[key]; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
return object; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* This method is like `_.defaults` except that it recursively assigns |
|
|
* default properties. |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.10.0 |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} [sources] The source objects. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @see _.defaults |
|
|
* @example |
|
|
* |
|
|
* _.defaultsDeep({ 'a': { 'b': 2 } }, { 'a': { 'b': 1, 'c': 3 } }); |
|
|
* // => { 'a': { 'b': 2, 'c': 3 } } |
|
|
*/ |
|
|
var defaultsDeep = baseRest(function(args) { |
|
|
args.push(undefined, customDefaultsMerge); |
|
|
return apply(mergeWith, undefined, args); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* This method is like `_.find` except that it returns the key of the first |
|
|
* element `predicate` returns truthy for instead of the element itself. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 1.1.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {string|undefined} Returns the key of the matched element, |
|
|
* else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = { |
|
|
* 'barney': { 'age': 36, 'active': true }, |
|
|
* 'fred': { 'age': 40, 'active': false }, |
|
|
* 'pebbles': { 'age': 1, 'active': true } |
|
|
* }; |
|
|
* |
|
|
* _.findKey(users, function(o) { return o.age < 40; }); |
|
|
* // => 'barney' (iteration order is not guaranteed) |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findKey(users, { 'age': 1, 'active': true }); |
|
|
* // => 'pebbles' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findKey(users, ['active', false]); |
|
|
* // => 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findKey(users, 'active'); |
|
|
* // => 'barney' |
|
|
*/ |
|
|
function findKey(object, predicate) { |
|
|
return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.findKey` except that it iterates over elements of |
|
|
* a collection in the opposite order. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to inspect. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per iteration. |
|
|
* @returns {string|undefined} Returns the key of the matched element, |
|
|
* else `undefined`. |
|
|
* @example |
|
|
* |
|
|
* var users = { |
|
|
* 'barney': { 'age': 36, 'active': true }, |
|
|
* 'fred': { 'age': 40, 'active': false }, |
|
|
* 'pebbles': { 'age': 1, 'active': true } |
|
|
* }; |
|
|
* |
|
|
* _.findLastKey(users, function(o) { return o.age < 40; }); |
|
|
* // => returns 'pebbles' assuming `_.findKey` returns 'barney' |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.findLastKey(users, { 'age': 36, 'active': true }); |
|
|
* // => 'barney' |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.findLastKey(users, ['active', false]); |
|
|
* // => 'fred' |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.findLastKey(users, 'active'); |
|
|
* // => 'pebbles' |
|
|
*/ |
|
|
function findLastKey(object, predicate) { |
|
|
return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Gets the value at `path` of `object`. If the resolved value is |
|
|
* `undefined`, the `defaultValue` is returned in its place. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.7.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @param {*} [defaultValue] The value returned for `undefined` resolved values. |
|
|
* @returns {*} Returns the resolved value. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c': 3 } }] }; |
|
|
* |
|
|
* _.get(object, 'a[0].b.c'); |
|
|
* // => 3 |
|
|
* |
|
|
* _.get(object, ['a', '0', 'b', 'c']); |
|
|
* // => 3 |
|
|
* |
|
|
* _.get(object, 'a.b.c', 'default'); |
|
|
* // => 'default' |
|
|
*/ |
|
|
function get(object, path, defaultValue) { |
|
|
var result = object == null ? undefined : baseGet(object, path); |
|
|
return result === undefined ? defaultValue : result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` is a direct property of `object`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': { 'b': 2 } }; |
|
|
* var other = _.create({ 'a': _.create({ 'b': 2 }) }); |
|
|
* |
|
|
* _.has(object, 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.has(object, 'a.b'); |
|
|
* // => true |
|
|
* |
|
|
* _.has(object, ['a', 'b']); |
|
|
* // => true |
|
|
* |
|
|
* _.has(other, 'a'); |
|
|
* // => false |
|
|
*/ |
|
|
function has(object, path) { |
|
|
return object != null && hasPath(object, path, baseHas); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Checks if `path` is a direct or inherited property of `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path to check. |
|
|
* @returns {boolean} Returns `true` if `path` exists, else `false`. |
|
|
* @example |
|
|
* |
|
|
* var object = _.create({ 'a': _.create({ 'b': 2 }) }); |
|
|
* |
|
|
* _.hasIn(object, 'a'); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, 'a.b'); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, ['a', 'b']); |
|
|
* // => true |
|
|
* |
|
|
* _.hasIn(object, 'b'); |
|
|
* // => false |
|
|
*/ |
|
|
function hasIn(object, path) { |
|
|
return object != null && hasPath(object, path, baseHasIn); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the inverted keys and values of `object`. |
|
|
* If `object` contains duplicate values, subsequent values overwrite |
|
|
* property assignments of previous values. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.7.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to invert. |
|
|
* @returns {Object} Returns the new inverted object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2, 'c': 1 }; |
|
|
* |
|
|
* _.invert(object); |
|
|
* // => { '1': 'c', '2': 'b' } |
|
|
*/ |
|
|
var invert = createInverter(function(result, value, key) { |
|
|
if (value != null && |
|
|
typeof value.toString != 'function') { |
|
|
value = nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
result[value] = key; |
|
|
}, constant(identity)); |
|
|
|
|
|
/** |
|
|
* This method is like `_.invert` except that the inverted object is generated |
|
|
* from the results of running each element of `object` thru `iteratee`. The |
|
|
* corresponding inverted value of each inverted key is an array of keys |
|
|
* responsible for generating the inverted value. The iteratee is invoked |
|
|
* with one argument: (value). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.1.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to invert. |
|
|
* @param {Function} [iteratee=_.identity] The iteratee invoked per element. |
|
|
* @returns {Object} Returns the new inverted object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': 2, 'c': 1 }; |
|
|
* |
|
|
* _.invertBy(object); |
|
|
* // => { '1': ['a', 'c'], '2': ['b'] } |
|
|
* |
|
|
* _.invertBy(object, function(value) { |
|
|
* return 'group' + value; |
|
|
* }); |
|
|
* // => { 'group1': ['a', 'c'], 'group2': ['b'] } |
|
|
*/ |
|
|
var invertBy = createInverter(function(result, value, key) { |
|
|
if (value != null && |
|
|
typeof value.toString != 'function') { |
|
|
value = nativeObjectToString.call(value); |
|
|
} |
|
|
|
|
|
if (hasOwnProperty.call(result, value)) { |
|
|
result[value].push(key); |
|
|
} else { |
|
|
result[value] = [key]; |
|
|
} |
|
|
}, baseIteratee); |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable property names of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. See the |
|
|
* [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys) |
|
|
* for more details. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.keys(new Foo); |
|
|
* // => ['a', 'b'] (iteration order is not guaranteed) |
|
|
* |
|
|
* _.keys('hi'); |
|
|
* // => ['0', '1'] |
|
|
*/ |
|
|
function keys(object) { |
|
|
return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own and inherited enumerable property names of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property names. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.keysIn(new Foo); |
|
|
* // => ['a', 'b', 'c'] (iteration order is not guaranteed) |
|
|
*/ |
|
|
function keysIn(object) { |
|
|
return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.merge` except that it accepts `customizer` which |
|
|
* is invoked to produce the merged values of the destination and source |
|
|
* properties. If `customizer` returns `undefined`, merging is handled by the |
|
|
* method instead. The `customizer` is invoked with six arguments: |
|
|
* (objValue, srcValue, key, object, source, stack). |
|
|
* |
|
|
* **Note:** This method mutates `object`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The destination object. |
|
|
* @param {...Object} sources The source objects. |
|
|
* @param {Function} customizer The function to customize assigned values. |
|
|
* @returns {Object} Returns `object`. |
|
|
* @example |
|
|
* |
|
|
* function customizer(objValue, srcValue) { |
|
|
* if (_.isArray(objValue)) { |
|
|
* return objValue.concat(srcValue); |
|
|
* } |
|
|
* } |
|
|
* |
|
|
* var object = { 'a': [1], 'b': [2] }; |
|
|
* var other = { 'a': [3], 'b': [4] }; |
|
|
* |
|
|
* _.mergeWith(object, other, customizer); |
|
|
* // => { 'a': [1, 3], 'b': [2, 4] } |
|
|
*/ |
|
|
var mergeWith = createAssigner(function(object, source, srcIndex, customizer) { |
|
|
baseMerge(object, source, srcIndex, customizer); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* The opposite of `_.pick`; this method creates an object composed of the |
|
|
* own and inherited enumerable property paths of `object` that are not omitted. |
|
|
* |
|
|
* **Note:** This method is considerably slower than `_.pick`. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {...(string|string[])} [paths] The property paths to omit. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.omit(object, ['a', 'c']); |
|
|
* // => { 'b': '2' } |
|
|
*/ |
|
|
var omit = flatRest(function(object, paths) { |
|
|
var result = {}; |
|
|
if (object == null) { |
|
|
return result; |
|
|
} |
|
|
var isDeep = false; |
|
|
paths = arrayMap(paths, function(path) { |
|
|
path = castPath(path, object); |
|
|
isDeep || (isDeep = path.length > 1); |
|
|
return path; |
|
|
}); |
|
|
copyObject(object, getAllKeysIn(object), result); |
|
|
if (isDeep) { |
|
|
result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone); |
|
|
} |
|
|
var length = paths.length; |
|
|
while (length--) { |
|
|
baseUnset(result, paths[length]); |
|
|
} |
|
|
return result; |
|
|
}); |
|
|
|
|
|
/** |
|
|
* The opposite of `_.pickBy`; this method creates an object composed of |
|
|
* the own and inherited enumerable string keyed properties of `object` that |
|
|
* `predicate` doesn't return truthy for. The predicate is invoked with two |
|
|
* arguments: (value, key). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.omitBy(object, _.isNumber); |
|
|
* // => { 'b': '2' } |
|
|
*/ |
|
|
function omitBy(object, predicate) { |
|
|
return pickBy(object, negate(baseIteratee(predicate))); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the picked `object` properties. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {...(string|string[])} [paths] The property paths to pick. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.pick(object, ['a', 'c']); |
|
|
* // => { 'a': 1, 'c': 3 } |
|
|
*/ |
|
|
var pick = flatRest(function(object, paths) { |
|
|
return object == null ? {} : basePick(object, paths); |
|
|
}); |
|
|
|
|
|
/** |
|
|
* Creates an object composed of the `object` properties `predicate` returns |
|
|
* truthy for. The predicate is invoked with two arguments: (value, key). |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Object |
|
|
* @param {Object} object The source object. |
|
|
* @param {Function} [predicate=_.identity] The function invoked per property. |
|
|
* @returns {Object} Returns the new object. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1, 'b': '2', 'c': 3 }; |
|
|
* |
|
|
* _.pickBy(object, _.isNumber); |
|
|
* // => { 'a': 1, 'c': 3 } |
|
|
*/ |
|
|
function pickBy(object, predicate) { |
|
|
if (object == null) { |
|
|
return {}; |
|
|
} |
|
|
var props = arrayMap(getAllKeysIn(object), function(prop) { |
|
|
return [prop]; |
|
|
}); |
|
|
predicate = baseIteratee(predicate); |
|
|
return basePickBy(object, props, function(value, path) { |
|
|
return predicate(value, path[0]); |
|
|
}); |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method is like `_.get` except that if the resolved value is a |
|
|
* function it's invoked with the `this` binding of its parent object and |
|
|
* its result is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @param {Array|string} path The path of the property to resolve. |
|
|
* @param {*} [defaultValue] The value returned for `undefined` resolved values. |
|
|
* @returns {*} Returns the resolved value. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] }; |
|
|
* |
|
|
* _.result(object, 'a[0].b.c1'); |
|
|
* // => 3 |
|
|
* |
|
|
* _.result(object, 'a[0].b.c2'); |
|
|
* // => 4 |
|
|
* |
|
|
* _.result(object, 'a[0].b.c3', 'default'); |
|
|
* // => 'default' |
|
|
* |
|
|
* _.result(object, 'a[0].b.c3', _.constant('default')); |
|
|
* // => 'default' |
|
|
*/ |
|
|
function result(object, path, defaultValue) { |
|
|
path = castPath(path, object); |
|
|
|
|
|
var index = -1, |
|
|
length = path.length; |
|
|
|
|
|
// Ensure the loop is entered when path is empty. |
|
|
if (!length) { |
|
|
length = 1; |
|
|
object = undefined; |
|
|
} |
|
|
while (++index < length) { |
|
|
var value = object == null ? undefined : object[toKey(path[index])]; |
|
|
if (value === undefined) { |
|
|
index = length; |
|
|
value = defaultValue; |
|
|
} |
|
|
object = isFunction(value) ? value.call(object) : value; |
|
|
} |
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of the own enumerable string keyed property values of `object`. |
|
|
* |
|
|
* **Note:** Non-object values are coerced to objects. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Object |
|
|
* @param {Object} object The object to query. |
|
|
* @returns {Array} Returns the array of property values. |
|
|
* @example |
|
|
* |
|
|
* function Foo() { |
|
|
* this.a = 1; |
|
|
* this.b = 2; |
|
|
* } |
|
|
* |
|
|
* Foo.prototype.c = 3; |
|
|
* |
|
|
* _.values(new Foo); |
|
|
* // => [1, 2] (iteration order is not guaranteed) |
|
|
* |
|
|
* _.values('hi'); |
|
|
* // => ['h', 'i'] |
|
|
*/ |
|
|
function values(object) { |
|
|
return object == null ? [] : baseValues(object, keys(object)); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Clamps `number` within the inclusive `lower` and `upper` bounds. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.0.0 |
|
|
* @category Number |
|
|
* @param {number} number The number to clamp. |
|
|
* @param {number} [lower] The lower bound. |
|
|
* @param {number} upper The upper bound. |
|
|
* @returns {number} Returns the clamped number. |
|
|
* @example |
|
|
* |
|
|
* _.clamp(-10, -5, 5); |
|
|
* // => -5 |
|
|
* |
|
|
* _.clamp(10, -5, 5); |
|
|
* // => 5 |
|
|
*/ |
|
|
function clamp(number, lower, upper) { |
|
|
if (upper === undefined) { |
|
|
upper = lower; |
|
|
lower = undefined; |
|
|
} |
|
|
if (upper !== undefined) { |
|
|
upper = toNumber(upper); |
|
|
upper = upper === upper ? upper : 0; |
|
|
} |
|
|
if (lower !== undefined) { |
|
|
lower = toNumber(lower); |
|
|
lower = lower === lower ? lower : 0; |
|
|
} |
|
|
return baseClamp(toNumber(number), lower, upper); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Produces a random number between the inclusive `lower` and `upper` bounds. |
|
|
* If only one argument is provided a number between `0` and the given number |
|
|
* is returned. If `floating` is `true`, or either `lower` or `upper` are |
|
|
* floats, a floating-point number is returned instead of an integer. |
|
|
* |
|
|
* **Note:** JavaScript follows the IEEE-754 standard for resolving |
|
|
* floating-point values which can produce unexpected results. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 0.7.0 |
|
|
* @category Number |
|
|
* @param {number} [lower=0] The lower bound. |
|
|
* @param {number} [upper=1] The upper bound. |
|
|
* @param {boolean} [floating] Specify returning a floating-point number. |
|
|
* @returns {number} Returns the random number. |
|
|
* @example |
|
|
* |
|
|
* _.random(0, 5); |
|
|
* // => an integer between 0 and 5 |
|
|
* |
|
|
* _.random(5); |
|
|
* // => also an integer between 0 and 5 |
|
|
* |
|
|
* _.random(5, true); |
|
|
* // => a floating-point number between 0 and 5 |
|
|
* |
|
|
* _.random(1.2, 5.2); |
|
|
* // => a floating-point number between 1.2 and 5.2 |
|
|
*/ |
|
|
function random(lower, upper, floating) { |
|
|
if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) { |
|
|
upper = floating = undefined; |
|
|
} |
|
|
if (floating === undefined) { |
|
|
if (typeof upper == 'boolean') { |
|
|
floating = upper; |
|
|
upper = undefined; |
|
|
} |
|
|
else if (typeof lower == 'boolean') { |
|
|
floating = lower; |
|
|
lower = undefined; |
|
|
} |
|
|
} |
|
|
if (lower === undefined && upper === undefined) { |
|
|
lower = 0; |
|
|
upper = 1; |
|
|
} |
|
|
else { |
|
|
lower = toFinite(lower); |
|
|
if (upper === undefined) { |
|
|
upper = lower; |
|
|
lower = 0; |
|
|
} else { |
|
|
upper = toFinite(upper); |
|
|
} |
|
|
} |
|
|
if (lower > upper) { |
|
|
var temp = lower; |
|
|
lower = upper; |
|
|
upper = temp; |
|
|
} |
|
|
if (floating || lower % 1 || upper % 1) { |
|
|
var rand = nativeRandom(); |
|
|
return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper); |
|
|
} |
|
|
return baseRandom(lower, upper); |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Converts the characters "&", "<", ">", '"', and "'" in `string` to their |
|
|
* corresponding HTML entities. |
|
|
* |
|
|
* **Note:** No other characters are escaped. To escape additional |
|
|
* characters use a third-party library like [_he_](https://mths.be/he). |
|
|
* |
|
|
* Though the ">" character is escaped for symmetry, characters like |
|
|
* ">" and "/" don't need escaping in HTML and have no special meaning |
|
|
* unless they're part of a tag or unquoted attribute value. See |
|
|
* [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands) |
|
|
* (under "semi-related fun fact") for more details. |
|
|
* |
|
|
* When working with HTML you should always |
|
|
* [quote attribute values](http://wonko.com/post/html-escaping) to reduce |
|
|
* XSS vectors. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category String |
|
|
* @param {string} [string=''] The string to escape. |
|
|
* @returns {string} Returns the escaped string. |
|
|
* @example |
|
|
* |
|
|
* _.escape('fred, barney, & pebbles'); |
|
|
* // => 'fred, barney, & pebbles' |
|
|
*/ |
|
|
function escape(string) { |
|
|
string = toString(string); |
|
|
return (string && reHasUnescapedHtml.test(string)) |
|
|
? string.replace(reUnescapedHtml, escapeHtmlChar) |
|
|
: string; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Creates a function that returns `value`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Util |
|
|
* @param {*} value The value to return from the new function. |
|
|
* @returns {Function} Returns the new constant function. |
|
|
* @example |
|
|
* |
|
|
* var objects = _.times(2, _.constant({ 'a': 1 })); |
|
|
* |
|
|
* console.log(objects); |
|
|
* // => [{ 'a': 1 }, { 'a': 1 }] |
|
|
* |
|
|
* console.log(objects[0] === objects[1]); |
|
|
* // => true |
|
|
*/ |
|
|
function constant(value) { |
|
|
return function() { |
|
|
return value; |
|
|
}; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns the first argument it receives. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {*} value Any value. |
|
|
* @returns {*} Returns `value`. |
|
|
* @example |
|
|
* |
|
|
* var object = { 'a': 1 }; |
|
|
* |
|
|
* console.log(_.identity(object) === object); |
|
|
* // => true |
|
|
*/ |
|
|
function identity(value) { |
|
|
return value; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that invokes `func` with the arguments of the created |
|
|
* function. If `func` is a property name, the created function returns the |
|
|
* property value for a given element. If `func` is an array or object, the |
|
|
* created function returns `true` for elements that contain the equivalent |
|
|
* source properties, otherwise it returns `false`. |
|
|
* |
|
|
* @static |
|
|
* @since 4.0.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {*} [func=_.identity] The value to convert to a callback. |
|
|
* @returns {Function} Returns the callback. |
|
|
* @example |
|
|
* |
|
|
* var users = [ |
|
|
* { 'user': 'barney', 'age': 36, 'active': true }, |
|
|
* { 'user': 'fred', 'age': 40, 'active': false } |
|
|
* ]; |
|
|
* |
|
|
* // The `_.matches` iteratee shorthand. |
|
|
* _.filter(users, _.iteratee({ 'user': 'barney', 'active': true })); |
|
|
* // => [{ 'user': 'barney', 'age': 36, 'active': true }] |
|
|
* |
|
|
* // The `_.matchesProperty` iteratee shorthand. |
|
|
* _.filter(users, _.iteratee(['user', 'fred'])); |
|
|
* // => [{ 'user': 'fred', 'age': 40 }] |
|
|
* |
|
|
* // The `_.property` iteratee shorthand. |
|
|
* _.map(users, _.iteratee('user')); |
|
|
* // => ['barney', 'fred'] |
|
|
* |
|
|
* // Create custom iteratee shorthands. |
|
|
* _.iteratee = _.wrap(_.iteratee, function(iteratee, func) { |
|
|
* return !_.isRegExp(func) ? iteratee(func) : function(string) { |
|
|
* return func.test(string); |
|
|
* }; |
|
|
* }); |
|
|
* |
|
|
* _.filter(['abc', 'def'], /ef/); |
|
|
* // => ['def'] |
|
|
*/ |
|
|
function iteratee(func) { |
|
|
return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that performs a partial deep comparison between a given |
|
|
* object and `source`, returning `true` if the given object has equivalent |
|
|
* property values, else `false`. |
|
|
* |
|
|
* **Note:** The created function is equivalent to `_.isMatch` with `source` |
|
|
* partially applied. |
|
|
* |
|
|
* Partial comparisons will match empty array and empty object `source` |
|
|
* values against any array or object value, respectively. See `_.isEqual` |
|
|
* for a list of supported value comparisons. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 3.0.0 |
|
|
* @category Util |
|
|
* @param {Object} source The object of property values to match. |
|
|
* @returns {Function} Returns the new spec function. |
|
|
* @example |
|
|
* |
|
|
* var objects = [ |
|
|
* { 'a': 1, 'b': 2, 'c': 3 }, |
|
|
* { 'a': 4, 'b': 5, 'c': 6 } |
|
|
* ]; |
|
|
* |
|
|
* _.filter(objects, _.matches({ 'a': 4, 'c': 6 })); |
|
|
* // => [{ 'a': 4, 'b': 5, 'c': 6 }] |
|
|
*/ |
|
|
function matches(source) { |
|
|
return baseMatches(baseClone(source, CLONE_DEEP_FLAG)); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Adds all own enumerable string keyed function properties of a source |
|
|
* object to the destination object. If `object` is a function, then methods |
|
|
* are added to its prototype as well. |
|
|
* |
|
|
* **Note:** Use `_.runInContext` to create a pristine `lodash` function to |
|
|
* avoid conflicts caused by modifying the original. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {Function|Object} [object=lodash] The destination object. |
|
|
* @param {Object} source The object of functions to add. |
|
|
* @param {Object} [options={}] The options object. |
|
|
* @param {boolean} [options.chain=true] Specify whether mixins are chainable. |
|
|
* @returns {Function|Object} Returns `object`. |
|
|
* @example |
|
|
* |
|
|
* function vowels(string) { |
|
|
* return _.filter(string, function(v) { |
|
|
* return /[aeiou]/i.test(v); |
|
|
* }); |
|
|
* } |
|
|
* |
|
|
* _.mixin({ 'vowels': vowels }); |
|
|
* _.vowels('fred'); |
|
|
* // => ['e'] |
|
|
* |
|
|
* _('fred').vowels().value(); |
|
|
* // => ['e'] |
|
|
* |
|
|
* _.mixin({ 'vowels': vowels }, { 'chain': false }); |
|
|
* _('fred').vowels(); |
|
|
* // => ['e'] |
|
|
*/ |
|
|
function mixin(object, source, options) { |
|
|
var props = keys(source), |
|
|
methodNames = baseFunctions(source, props); |
|
|
|
|
|
if (options == null && |
|
|
!(isObject(source) && (methodNames.length || !props.length))) { |
|
|
options = source; |
|
|
source = object; |
|
|
object = this; |
|
|
methodNames = baseFunctions(source, keys(source)); |
|
|
} |
|
|
var chain = !(isObject(options) && 'chain' in options) || !!options.chain, |
|
|
isFunc = isFunction(object); |
|
|
|
|
|
arrayEach(methodNames, function(methodName) { |
|
|
var func = source[methodName]; |
|
|
object[methodName] = func; |
|
|
if (isFunc) { |
|
|
object.prototype[methodName] = function() { |
|
|
var chainAll = this.__chain__; |
|
|
if (chain || chainAll) { |
|
|
var result = object(this.__wrapped__), |
|
|
actions = result.__actions__ = copyArray(this.__actions__); |
|
|
|
|
|
actions.push({ 'func': func, 'args': arguments, 'thisArg': object }); |
|
|
result.__chain__ = chainAll; |
|
|
return result; |
|
|
} |
|
|
return func.apply(object, arrayPush([this.value()], arguments)); |
|
|
}; |
|
|
} |
|
|
}); |
|
|
|
|
|
return object; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Reverts the `_` variable to its previous value and returns a reference to |
|
|
* the `lodash` function. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @returns {Function} Returns the `lodash` function. |
|
|
* @example |
|
|
* |
|
|
* var lodash = _.noConflict(); |
|
|
*/ |
|
|
function noConflict() { |
|
|
if (root._ === this) { |
|
|
root._ = oldDash; |
|
|
} |
|
|
return this; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns `undefined`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.3.0 |
|
|
* @category Util |
|
|
* @example |
|
|
* |
|
|
* _.times(2, _.noop); |
|
|
* // => [undefined, undefined] |
|
|
*/ |
|
|
function noop() { |
|
|
// No operation performed. |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates a function that returns the value at `path` of a given object. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 2.4.0 |
|
|
* @category Util |
|
|
* @param {Array|string} path The path of the property to get. |
|
|
* @returns {Function} Returns the new accessor function. |
|
|
* @example |
|
|
* |
|
|
* var objects = [ |
|
|
* { 'a': { 'b': 2 } }, |
|
|
* { 'a': { 'b': 1 } } |
|
|
* ]; |
|
|
* |
|
|
* _.map(objects, _.property('a.b')); |
|
|
* // => [2, 1] |
|
|
* |
|
|
* _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b'); |
|
|
* // => [1, 2] |
|
|
*/ |
|
|
function property(path) { |
|
|
return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path); |
|
|
} |
|
|
|
|
|
/** |
|
|
* Creates an array of numbers (positive and/or negative) progressing from |
|
|
* `start` up to, but not including, `end`. A step of `-1` is used if a negative |
|
|
* `start` is specified without an `end` or `step`. If `end` is not specified, |
|
|
* it's set to `start` with `start` then set to `0`. |
|
|
* |
|
|
* **Note:** JavaScript follows the IEEE-754 standard for resolving |
|
|
* floating-point values which can produce unexpected results. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {number} [start=0] The start of the range. |
|
|
* @param {number} end The end of the range. |
|
|
* @param {number} [step=1] The value to increment or decrement by. |
|
|
* @returns {Array} Returns the range of numbers. |
|
|
* @see _.inRange, _.rangeRight |
|
|
* @example |
|
|
* |
|
|
* _.range(4); |
|
|
* // => [0, 1, 2, 3] |
|
|
* |
|
|
* _.range(-4); |
|
|
* // => [0, -1, -2, -3] |
|
|
* |
|
|
* _.range(1, 5); |
|
|
* // => [1, 2, 3, 4] |
|
|
* |
|
|
* _.range(0, 20, 5); |
|
|
* // => [0, 5, 10, 15] |
|
|
* |
|
|
* _.range(0, -4, -1); |
|
|
* // => [0, -1, -2, -3] |
|
|
* |
|
|
* _.range(1, 4, 0); |
|
|
* // => [1, 1, 1] |
|
|
* |
|
|
* _.range(0); |
|
|
* // => [] |
|
|
*/ |
|
|
var range = createRange(); |
|
|
|
|
|
/** |
|
|
* This method returns a new empty array. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.13.0 |
|
|
* @category Util |
|
|
* @returns {Array} Returns the new empty array. |
|
|
* @example |
|
|
* |
|
|
* var arrays = _.times(2, _.stubArray); |
|
|
* |
|
|
* console.log(arrays); |
|
|
* // => [[], []] |
|
|
* |
|
|
* console.log(arrays[0] === arrays[1]); |
|
|
* // => false |
|
|
*/ |
|
|
function stubArray() { |
|
|
return []; |
|
|
} |
|
|
|
|
|
/** |
|
|
* This method returns `false`. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @since 4.13.0 |
|
|
* @category Util |
|
|
* @returns {boolean} Returns `false`. |
|
|
* @example |
|
|
* |
|
|
* _.times(2, _.stubFalse); |
|
|
* // => [false, false] |
|
|
*/ |
|
|
function stubFalse() { |
|
|
return false; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Generates a unique ID. If `prefix` is given, the ID is appended to it. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Util |
|
|
* @param {string} [prefix=''] The value to prefix the ID with. |
|
|
* @returns {string} Returns the unique ID. |
|
|
* @example |
|
|
* |
|
|
* _.uniqueId('contact_'); |
|
|
* // => 'contact_104' |
|
|
* |
|
|
* _.uniqueId(); |
|
|
* // => '105' |
|
|
*/ |
|
|
function uniqueId(prefix) { |
|
|
var id = ++idCounter; |
|
|
return toString(prefix) + id; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* Computes the maximum value of `array`. If `array` is empty or falsey, |
|
|
* `undefined` is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Math |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @returns {*} Returns the maximum value. |
|
|
* @example |
|
|
* |
|
|
* _.max([4, 2, 8, 6]); |
|
|
* // => 8 |
|
|
* |
|
|
* _.max([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function max(array) { |
|
|
return (array && array.length) |
|
|
? baseExtremum(array, identity, baseGt) |
|
|
: undefined; |
|
|
} |
|
|
|
|
|
/** |
|
|
* Computes the minimum value of `array`. If `array` is empty or falsey, |
|
|
* `undefined` is returned. |
|
|
* |
|
|
* @static |
|
|
* @since 0.1.0 |
|
|
* @memberOf _ |
|
|
* @category Math |
|
|
* @param {Array} array The array to iterate over. |
|
|
* @returns {*} Returns the minimum value. |
|
|
* @example |
|
|
* |
|
|
* _.min([4, 2, 8, 6]); |
|
|
* // => 2 |
|
|
* |
|
|
* _.min([]); |
|
|
* // => undefined |
|
|
*/ |
|
|
function min(array) { |
|
|
return (array && array.length) |
|
|
? baseExtremum(array, identity, baseLt) |
|
|
: undefined; |
|
|
} |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
// Add methods that return wrapped values in chain sequences. |
|
|
lodash.assignIn = assignIn; |
|
|
lodash.before = before; |
|
|
lodash.bind = bind; |
|
|
lodash.chain = chain; |
|
|
lodash.compact = compact; |
|
|
lodash.concat = concat; |
|
|
lodash.countBy = countBy; |
|
|
lodash.create = create; |
|
|
lodash.debounce = debounce; |
|
|
lodash.defaults = defaults; |
|
|
lodash.defaultsDeep = defaultsDeep; |
|
|
lodash.defer = defer; |
|
|
lodash.delay = delay; |
|
|
lodash.difference = difference; |
|
|
lodash.drop = drop; |
|
|
lodash.filter = filter; |
|
|
lodash.flatten = flatten; |
|
|
lodash.flattenDeep = flattenDeep; |
|
|
lodash.initial = initial; |
|
|
lodash.intersection = intersection; |
|
|
lodash.invert = invert; |
|
|
lodash.invertBy = invertBy; |
|
|
lodash.iteratee = iteratee; |
|
|
lodash.keys = keys; |
|
|
lodash.map = map; |
|
|
lodash.matches = matches; |
|
|
lodash.mixin = mixin; |
|
|
lodash.negate = negate; |
|
|
lodash.omit = omit; |
|
|
lodash.omitBy = omitBy; |
|
|
lodash.once = once; |
|
|
lodash.pick = pick; |
|
|
lodash.range = range; |
|
|
lodash.reject = reject; |
|
|
lodash.rest = rest; |
|
|
lodash.slice = slice; |
|
|
lodash.sortBy = sortBy; |
|
|
lodash.take = take; |
|
|
lodash.takeRight = takeRight; |
|
|
lodash.tap = tap; |
|
|
lodash.throttle = throttle; |
|
|
lodash.thru = thru; |
|
|
lodash.toArray = toArray; |
|
|
lodash.union = union; |
|
|
lodash.uniq = uniq; |
|
|
lodash.uniqBy = uniqBy; |
|
|
lodash.unzip = unzip; |
|
|
lodash.values = values; |
|
|
lodash.without = without; |
|
|
lodash.zip = zip; |
|
|
lodash.zipObject = zipObject; |
|
|
|
|
|
// Add aliases. |
|
|
lodash.extend = assignIn; |
|
|
|
|
|
// Add methods to `lodash.prototype`. |
|
|
mixin(lodash, lodash); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
// Add methods that return unwrapped values in chain sequences. |
|
|
lodash.clamp = clamp; |
|
|
lodash.clone = clone; |
|
|
lodash.cloneDeep = cloneDeep; |
|
|
lodash.escape = escape; |
|
|
lodash.every = every; |
|
|
lodash.find = find; |
|
|
lodash.findIndex = findIndex; |
|
|
lodash.findKey = findKey; |
|
|
lodash.findLastIndex = findLastIndex; |
|
|
lodash.findLastKey = findLastKey; |
|
|
lodash.forEach = forEach; |
|
|
lodash.get = get; |
|
|
lodash.has = has; |
|
|
lodash.head = head; |
|
|
lodash.identity = identity; |
|
|
lodash.indexOf = indexOf; |
|
|
lodash.isArguments = isArguments; |
|
|
lodash.isArray = isArray; |
|
|
lodash.isArrayLike = isArrayLike; |
|
|
lodash.isBoolean = isBoolean; |
|
|
lodash.isDate = isDate; |
|
|
lodash.isEmpty = isEmpty; |
|
|
lodash.isEqual = isEqual; |
|
|
lodash.isFinite = isFinite; |
|
|
lodash.isFunction = isFunction; |
|
|
lodash.isNaN = isNaN; |
|
|
lodash.isNull = isNull; |
|
|
lodash.isNumber = isNumber; |
|
|
lodash.isObject = isObject; |
|
|
lodash.isPlainObject = isPlainObject; |
|
|
lodash.isRegExp = isRegExp; |
|
|
lodash.isString = isString; |
|
|
lodash.isUndefined = isUndefined; |
|
|
lodash.last = last; |
|
|
lodash.max = max; |
|
|
lodash.min = min; |
|
|
lodash.noConflict = noConflict; |
|
|
lodash.noop = noop; |
|
|
lodash.random = random; |
|
|
lodash.reduce = reduce; |
|
|
lodash.result = result; |
|
|
lodash.size = size; |
|
|
lodash.some = some; |
|
|
lodash.uniqueId = uniqueId; |
|
|
|
|
|
// Add aliases. |
|
|
lodash.each = forEach; |
|
|
lodash.first = head; |
|
|
|
|
|
mixin(lodash, (function() { |
|
|
var source = {}; |
|
|
baseForOwn(lodash, function(func, methodName) { |
|
|
if (!hasOwnProperty.call(lodash.prototype, methodName)) { |
|
|
source[methodName] = func; |
|
|
} |
|
|
}); |
|
|
return source; |
|
|
}()), { 'chain': false }); |
|
|
|
|
|
/*------------------------------------------------------------------------*/ |
|
|
|
|
|
/** |
|
|
* The semantic version number. |
|
|
* |
|
|
* @static |
|
|
* @memberOf _ |
|
|
* @type {string} |
|
|
*/ |
|
|
lodash.VERSION = VERSION; |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.drop` and `_.take` variants. |
|
|
arrayEach(['drop', 'take'], function(methodName, index) { |
|
|
LazyWrapper.prototype[methodName] = function(n) { |
|
|
n = n === undefined ? 1 : nativeMax(toInteger(n), 0); |
|
|
|
|
|
var result = (this.__filtered__ && !index) |
|
|
? new LazyWrapper(this) |
|
|
: this.clone(); |
|
|
|
|
|
if (result.__filtered__) { |
|
|
result.__takeCount__ = nativeMin(n, result.__takeCount__); |
|
|
} else { |
|
|
result.__views__.push({ |
|
|
'size': nativeMin(n, MAX_ARRAY_LENGTH), |
|
|
'type': methodName + (result.__dir__ < 0 ? 'Right' : '') |
|
|
}); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype[methodName + 'Right'] = function(n) { |
|
|
return this.reverse()[methodName](n).reverse(); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods that accept an `iteratee` value. |
|
|
arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) { |
|
|
var type = index + 1, |
|
|
isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG; |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function(iteratee) { |
|
|
var result = this.clone(); |
|
|
result.__iteratees__.push({ |
|
|
'iteratee': getIteratee(iteratee, 3), |
|
|
'type': type |
|
|
}); |
|
|
result.__filtered__ = result.__filtered__ || isFilter; |
|
|
return result; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.head` and `_.last`. |
|
|
arrayEach(['head', 'last'], function(methodName, index) { |
|
|
var takeName = 'take' + (index ? 'Right' : ''); |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function() { |
|
|
return this[takeName](1).value()[0]; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `LazyWrapper` methods for `_.initial` and `_.tail`. |
|
|
arrayEach(['initial', 'tail'], function(methodName, index) { |
|
|
var dropName = 'drop' + (index ? '' : 'Right'); |
|
|
|
|
|
LazyWrapper.prototype[methodName] = function() { |
|
|
return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1); |
|
|
}; |
|
|
}); |
|
|
|
|
|
LazyWrapper.prototype.compact = function() { |
|
|
return this.filter(identity); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.find = function(predicate) { |
|
|
return this.filter(predicate).head(); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.findLast = function(predicate) { |
|
|
return this.reverse().find(predicate); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.invokeMap = baseRest(function(path, args) { |
|
|
if (typeof path == 'function') { |
|
|
return new LazyWrapper(this); |
|
|
} |
|
|
return this.map(function(value) { |
|
|
return baseInvoke(value, path, args); |
|
|
}); |
|
|
}); |
|
|
|
|
|
LazyWrapper.prototype.reject = function(predicate) { |
|
|
return this.filter(negate(getIteratee(predicate))); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.slice = function(start, end) { |
|
|
start = toInteger(start); |
|
|
|
|
|
var result = this; |
|
|
if (result.__filtered__ && (start > 0 || end < 0)) { |
|
|
return new LazyWrapper(result); |
|
|
} |
|
|
if (start < 0) { |
|
|
result = result.takeRight(-start); |
|
|
} else if (start) { |
|
|
result = result.drop(start); |
|
|
} |
|
|
if (end !== undefined) { |
|
|
end = toInteger(end); |
|
|
result = end < 0 ? result.dropRight(-end) : result.take(end - start); |
|
|
} |
|
|
return result; |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.takeRightWhile = function(predicate) { |
|
|
return this.reverse().takeWhile(predicate).reverse(); |
|
|
}; |
|
|
|
|
|
LazyWrapper.prototype.toArray = function() { |
|
|
return this.take(MAX_ARRAY_LENGTH); |
|
|
}; |
|
|
|
|
|
// Add `LazyWrapper` methods to `lodash.prototype`. |
|
|
baseForOwn(LazyWrapper.prototype, function(func, methodName) { |
|
|
var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName), |
|
|
isTaker = /^(?:head|last)$/.test(methodName), |
|
|
lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName], |
|
|
retUnwrapped = isTaker || /^find/.test(methodName); |
|
|
|
|
|
if (!lodashFunc) { |
|
|
return; |
|
|
} |
|
|
lodash.prototype[methodName] = function() { |
|
|
var value = this.__wrapped__, |
|
|
args = isTaker ? [1] : arguments, |
|
|
isLazy = value instanceof LazyWrapper, |
|
|
iteratee = args[0], |
|
|
useLazy = isLazy || isArray(value); |
|
|
|
|
|
var interceptor = function(value) { |
|
|
var result = lodashFunc.apply(lodash, arrayPush([value], args)); |
|
|
return (isTaker && chainAll) ? result[0] : result; |
|
|
}; |
|
|
|
|
|
if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) { |
|
|
// Avoid lazy use if the iteratee has a "length" value other than `1`. |
|
|
isLazy = useLazy = false; |
|
|
} |
|
|
var chainAll = this.__chain__, |
|
|
isHybrid = !!this.__actions__.length, |
|
|
isUnwrapped = retUnwrapped && !chainAll, |
|
|
onlyLazy = isLazy && !isHybrid; |
|
|
|
|
|
if (!retUnwrapped && useLazy) { |
|
|
value = onlyLazy ? value : new LazyWrapper(this); |
|
|
var result = func.apply(value, args); |
|
|
result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined }); |
|
|
return new LodashWrapper(result, chainAll); |
|
|
} |
|
|
if (isUnwrapped && onlyLazy) { |
|
|
return func.apply(this, args); |
|
|
} |
|
|
result = this.thru(interceptor); |
|
|
return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result; |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Add `Array` methods to `lodash.prototype`. |
|
|
arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) { |
|
|
var func = arrayProto[methodName], |
|
|
chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru', |
|
|
retUnwrapped = /^(?:pop|shift)$/.test(methodName); |
|
|
|
|
|
lodash.prototype[methodName] = function() { |
|
|
var args = arguments; |
|
|
if (retUnwrapped && !this.__chain__) { |
|
|
var value = this.value(); |
|
|
return func.apply(isArray(value) ? value : [], args); |
|
|
} |
|
|
return this[chainName](function(value) { |
|
|
return func.apply(isArray(value) ? value : [], args); |
|
|
}); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// Map minified method names to their real names. |
|
|
baseForOwn(LazyWrapper.prototype, function(func, methodName) { |
|
|
var lodashFunc = lodash[methodName]; |
|
|
if (lodashFunc) { |
|
|
var key = (lodashFunc.name + ''), |
|
|
names = realNames[key] || (realNames[key] = []); |
|
|
|
|
|
names.push({ 'name': methodName, 'func': lodashFunc }); |
|
|
} |
|
|
}); |
|
|
|
|
|
realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{ |
|
|
'name': 'wrapper', |
|
|
'func': undefined |
|
|
}]; |
|
|
|
|
|
// Add methods to `LazyWrapper`. |
|
|
LazyWrapper.prototype.clone = lazyClone; |
|
|
LazyWrapper.prototype.reverse = lazyReverse; |
|
|
LazyWrapper.prototype.value = lazyValue; |
|
|
|
|
|
// Add lazy aliases. |
|
|
lodash.prototype.first = lodash.prototype.head; |
|
|
|
|
|
if (symIterator) { |
|
|
lodash.prototype[symIterator] = wrapperToIterator; |
|
|
} |
|
|
|
|
|
/*--------------------------------------------------------------------------*/ |
|
|
|
|
|
// Some AMD build optimizers, like r.js, check for condition patterns like: |
|
|
if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) { |
|
|
// Expose Lodash on the global object to prevent errors when Lodash is |
|
|
// loaded by a script tag in the presence of an AMD loader. |
|
|
// See http://requirejs.org/docs/errors.html#mismatch for more details. |
|
|
// Use `_.noConflict` to remove Lodash from the global object. |
|
|
root._ = lodash; |
|
|
|
|
|
// Define as an anonymous module so, through path mapping, it can be |
|
|
// referenced as the "underscore" module. |
|
|
define(function() { |
|
|
return lodash; |
|
|
}); |
|
|
} |
|
|
// Check for `exports` after `define` in case a build optimizer adds it. |
|
|
else if (freeModule) { |
|
|
// Export for Node.js. |
|
|
(freeModule.exports = lodash)._ = lodash; |
|
|
// Export for CommonJS support. |
|
|
freeExports._ = lodash; |
|
|
} |
|
|
else { |
|
|
// Export to the global object. |
|
|
root._ = lodash; |
|
|
} |
|
|
}.call(this)); |
|
|
/** |
|
|
* Created by richie on 15/7/8. |
|
|
*/ |
|
|
/** |
|
|
* 初始化BI对象 |
|
|
*/ |
|
|
if (window.BI == null) { |
|
|
window.BI = {}; |
|
|
}/** |
|
|
* 基本函数 |
|
|
* Create By GUY 2014\11\17 |
|
|
* |
|
|
*/ |
|
|
|
|
|
if (!window.BI) { |
|
|
window.BI = {}; |
|
|
} |
|
|
|
|
|
!(function (undefined) { |
|
|
var traverse = function (func, context) { |
|
|
return function (value, key, obj) { |
|
|
return func.call(context, key, value, obj); |
|
|
}; |
|
|
}; |
|
|
var _apply = function (name) { |
|
|
return function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}; |
|
|
var _applyFunc = function (name) { |
|
|
return function () { |
|
|
var args = Array.prototype.slice.call(arguments, 0); |
|
|
args[1] = _.isFunction(args[1]) ? traverse(args[1], args[2]) : args[1]; |
|
|
return _[name].apply(_, args); |
|
|
}; |
|
|
}; |
|
|
|
|
|
// Utility |
|
|
_.extend(BI, { |
|
|
i18nText: function (key) { |
|
|
var localeText = (BI.i18n && BI.i18n[key]) || ""; |
|
|
if (!localeText) { |
|
|
localeText = key; |
|
|
} |
|
|
var len = arguments.length; |
|
|
if (len > 1) { |
|
|
for (var i = 1; i < len; i++) { |
|
|
var key = "{R" + i + "}"; |
|
|
localeText = localeText.replaceAll(key, arguments[i] + ""); |
|
|
} |
|
|
} |
|
|
return localeText; |
|
|
}, |
|
|
|
|
|
assert: function (v, is) { |
|
|
if (this.isFunction(is)) { |
|
|
if (!is(v)) { |
|
|
throw new Error(v + " error"); |
|
|
} else { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
if (!this.isArray(is)) { |
|
|
is = [is]; |
|
|
} |
|
|
if (!this.deepContains(is, v)) { |
|
|
throw new Error(v + " error"); |
|
|
} |
|
|
}, |
|
|
|
|
|
warn: function (message) { |
|
|
console.warn(message); |
|
|
}, |
|
|
|
|
|
UUID: function () { |
|
|
var f = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"]; |
|
|
var str = ""; |
|
|
for (var i = 0; i < 16; i++) { |
|
|
var r = parseInt(f.length * Math.random(), 10); |
|
|
str += f[r]; |
|
|
} |
|
|
return str; |
|
|
}, |
|
|
|
|
|
isWidget: function (widget) { |
|
|
return widget instanceof BI.Widget || (BI.View && widget instanceof BI.View); |
|
|
}, |
|
|
|
|
|
createWidgets: function (items, options, context) { |
|
|
if (!BI.isArray(items)) { |
|
|
throw new Error("cannot create Widgets"); |
|
|
} |
|
|
if (BI.isWidget(options)) { |
|
|
context = options; |
|
|
options = {}; |
|
|
} else { |
|
|
options || (options = {}); |
|
|
} |
|
|
return BI.map(BI.flatten(items), function (i, item) { |
|
|
return BI.createWidget(item, BI.deepClone(options)); |
|
|
}); |
|
|
}, |
|
|
|
|
|
createItems: function (data, innerAttr, outerAttr) { |
|
|
innerAttr = BI.isArray(innerAttr) ? innerAttr : BI.makeArray(BI.flatten(data).length, innerAttr); |
|
|
outerAttr = BI.isArray(outerAttr) ? outerAttr : BI.makeArray(BI.flatten(data).length, outerAttr); |
|
|
return BI.map(data, function (i, item) { |
|
|
if (BI.isArray(item)) { |
|
|
return BI.createItems(item, innerAttr, outerAttr); |
|
|
} |
|
|
if (item instanceof BI.Widget) { |
|
|
return BI.extend({}, innerAttr.shift(), outerAttr.shift(), { |
|
|
type: null, |
|
|
el: item |
|
|
}); |
|
|
} |
|
|
if (innerAttr[0] instanceof BI.Widget) { |
|
|
outerAttr.shift(); |
|
|
return BI.extend({}, item, { |
|
|
el: innerAttr.shift() |
|
|
}); |
|
|
} |
|
|
if (item.el instanceof BI.Widget || (BI.View && item.el instanceof BI.View)) { |
|
|
innerAttr.shift(); |
|
|
return BI.extend({}, outerAttr.shift(), {type: null}, item); |
|
|
} |
|
|
if (item.el) { |
|
|
return BI.extend({}, outerAttr.shift(), item, { |
|
|
el: BI.extend({}, innerAttr.shift(), item.el) |
|
|
}); |
|
|
} |
|
|
return BI.extend({}, outerAttr.shift(), { |
|
|
el: BI.extend({}, innerAttr.shift(), item) |
|
|
}); |
|
|
}); |
|
|
}, |
|
|
|
|
|
// 用容器包装items |
|
|
packageItems: function (items, layouts) { |
|
|
for (var i = layouts.length - 1; i >= 0; i--) { |
|
|
items = BI.map(items, function (k, it) { |
|
|
return BI.extend({}, layouts[i], { |
|
|
items: [ |
|
|
BI.extend({}, layouts[i].el, { |
|
|
el: it |
|
|
}) |
|
|
] |
|
|
}); |
|
|
}); |
|
|
} |
|
|
return items; |
|
|
}, |
|
|
|
|
|
formatEL: function (obj) { |
|
|
if (obj && !obj.type && obj.el) { |
|
|
return obj; |
|
|
} |
|
|
return { |
|
|
el: obj |
|
|
}; |
|
|
}, |
|
|
|
|
|
// 剥开EL |
|
|
stripEL: function (obj) { |
|
|
return obj.type && obj || obj.el || obj; |
|
|
}, |
|
|
|
|
|
trans2Element: function (widgets) { |
|
|
return BI.map(widgets, function (i, wi) { |
|
|
return wi.element; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 集合相关方法 |
|
|
_.each(["where", "findWhere", "invoke", "pluck", "shuffle", "sample", "toArray", "size"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["get", "each", "map", "reduce", "reduceRight", "find", "filter", "reject", "every", "all", "some", "any", "max", "min", |
|
|
"sortBy", "groupBy", "indexBy", "countBy", "partition", "clamp"], function (name) { |
|
|
if (name === "any") { |
|
|
BI[name] = _applyFunc("some"); |
|
|
} else { |
|
|
BI[name] = _applyFunc(name); |
|
|
} |
|
|
}); |
|
|
_.extend(BI, { |
|
|
// 数数 |
|
|
count: function (from, to, predicate) { |
|
|
var t; |
|
|
if (predicate) { |
|
|
for (t = from; t < to; t++) { |
|
|
predicate(t); |
|
|
} |
|
|
} |
|
|
return to - from; |
|
|
}, |
|
|
|
|
|
// 倒数 |
|
|
inverse: function (from, to, predicate) { |
|
|
return BI.count(to, from, predicate); |
|
|
}, |
|
|
|
|
|
firstKey: function (obj) { |
|
|
var res = undefined; |
|
|
BI.any(obj, function (key, value) { |
|
|
res = key; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
lastKey: function (obj) { |
|
|
var res = undefined; |
|
|
BI.each(obj, function (key, value) { |
|
|
res = key; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
firstObject: function (obj) { |
|
|
var res = undefined; |
|
|
BI.any(obj, function (key, value) { |
|
|
res = value; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
lastObject: function (obj) { |
|
|
var res = undefined; |
|
|
BI.each(obj, function (key, value) { |
|
|
res = value; |
|
|
return true; |
|
|
}); |
|
|
return res; |
|
|
}, |
|
|
|
|
|
concat: function (obj1, obj2) { |
|
|
if (BI.isKey(obj1)) { |
|
|
return obj1 + "" + obj2; |
|
|
} |
|
|
if (BI.isArray(obj1)) { |
|
|
return obj1.concat(obj2); |
|
|
} |
|
|
if (BI.isObject(obj1)) { |
|
|
return _.extend({}, obj1, obj2); |
|
|
} |
|
|
}, |
|
|
|
|
|
backEach: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
predicate(index, obj[index], obj); |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
backAny: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
if (predicate(index, obj[index], obj)) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
backEvery: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
for (var index = obj.length - 1; index >= 0; index--) { |
|
|
if (!predicate(index, obj[index], obj)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
backFindKey: function (obj, predicate, context) { |
|
|
predicate = BI.iteratee(predicate, context); |
|
|
var keys = _.keys(obj), key; |
|
|
for (var i = keys.length - 1; i >= 0; i--) { |
|
|
key = keys[i]; |
|
|
if (predicate(obj[key], key, obj)) { |
|
|
return key; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
backFind: function (obj, predicate, context) { |
|
|
var key; |
|
|
if (BI.isArray(obj)) { |
|
|
key = BI.findLastIndex(obj, predicate, context); |
|
|
} else { |
|
|
key = BI.backFindKey(obj, predicate, context); |
|
|
} |
|
|
if (key !== void 0 && key !== -1) { |
|
|
return obj[key]; |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (obj, target, context) { |
|
|
var isFunction = BI.isFunction(target); |
|
|
target = isFunction || BI.isArray(target) ? target : [target]; |
|
|
var i; |
|
|
if (BI.isArray(obj)) { |
|
|
for (i = 0; i < obj.length; i++) { |
|
|
if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) { |
|
|
obj.splice(i--, 1); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
BI.each(obj, function (i, v) { |
|
|
if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) { |
|
|
delete obj[i]; |
|
|
} |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
removeAt: function (obj, index) { |
|
|
index = BI.isArray(index) ? index : [index]; |
|
|
var isArray = BI.isArray(obj), i; |
|
|
for (i = 0; i < index.length; i++) { |
|
|
if (isArray) { |
|
|
obj[index[i]] = "$deleteIndex"; |
|
|
} else { |
|
|
delete obj[index[i]]; |
|
|
} |
|
|
} |
|
|
if (isArray) { |
|
|
BI.remove(obj, "$deleteIndex"); |
|
|
} |
|
|
}, |
|
|
|
|
|
string2Array: function (str) { |
|
|
return str.split("&-&"); |
|
|
}, |
|
|
|
|
|
array2String: function (array) { |
|
|
return array.join("&-&"); |
|
|
}, |
|
|
|
|
|
abc2Int: function (str) { |
|
|
var idx = 0, start = "A", str = str.toUpperCase(); |
|
|
for (var i = 0, len = str.length; i < len; ++i) { |
|
|
idx = str.charAt(i).charCodeAt(0) - start.charCodeAt(0) + 26 * idx + 1; |
|
|
if (idx > (2147483646 - str.charAt(i).charCodeAt(0) + start.charCodeAt(0)) / 26) { |
|
|
return 0; |
|
|
} |
|
|
} |
|
|
return idx; |
|
|
}, |
|
|
|
|
|
int2Abc: function (num) { |
|
|
var DIGITS = ["A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z"]; |
|
|
var idx = num, str = ""; |
|
|
if (num === 0) { |
|
|
return ""; |
|
|
} |
|
|
while (idx !== 0) { |
|
|
var t = idx % 26; |
|
|
if (t === 0) { |
|
|
t = 26; |
|
|
} |
|
|
str = DIGITS[t - 1] + str; |
|
|
idx = (idx - t) / 26; |
|
|
} |
|
|
return str; |
|
|
} |
|
|
}); |
|
|
|
|
|
// 数组相关的方法 |
|
|
_.each(["first", "initial", "last", "rest", "compact", "flatten", "without", "union", "intersection", |
|
|
"difference", "zip", "unzip", "object", "indexOf", "lastIndexOf", "sortedIndex", "range", "take", "takeRight"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["findIndex", "findLastIndex"], function (name) { |
|
|
BI[name] = _applyFunc(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
// 构建一个长度为length的数组 |
|
|
makeArray: function (length, value) { |
|
|
var res = []; |
|
|
for (var i = 0; i < length; i++) { |
|
|
if (BI.isNull(value)) { |
|
|
res.push(i); |
|
|
} else { |
|
|
res.push(BI.deepClone(value)); |
|
|
} |
|
|
} |
|
|
return res; |
|
|
}, |
|
|
|
|
|
makeObject: function (array, value) { |
|
|
var map = {}; |
|
|
for (var i = 0; i < array.length; i++) { |
|
|
if (BI.isNull(value)) { |
|
|
map[array[i]] = array[i]; |
|
|
} else { |
|
|
map[array[i]] = BI.deepClone(value); |
|
|
} |
|
|
} |
|
|
return map; |
|
|
}, |
|
|
|
|
|
makeArrayByArray: function (array, value) { |
|
|
var res = []; |
|
|
if (!array) { |
|
|
return res; |
|
|
} |
|
|
for (var i = 0, len = array.length; i < len; i++) { |
|
|
if (BI.isArray(array[i])) { |
|
|
res.push(arguments.callee(array[i], value)); |
|
|
} else { |
|
|
res.push(BI.deepClone(value)); |
|
|
} |
|
|
} |
|
|
return res; |
|
|
}, |
|
|
|
|
|
uniq: function (array, isSorted, iteratee, context) { |
|
|
if (array == null) { |
|
|
return []; |
|
|
} |
|
|
if (!_.isBoolean(isSorted)) { |
|
|
context = iteratee; |
|
|
iteratee = isSorted; |
|
|
isSorted = false; |
|
|
} |
|
|
iteratee && (iteratee = traverse(iteratee, context)); |
|
|
return _.uniq.call(_, array, isSorted, iteratee, context); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 对象相关方法 |
|
|
_.each(["keys", "allKeys", "values", "pairs", "invert", "create", "functions", "extend", "extendOwn", |
|
|
"defaults", "clone", "property", "propertyOf", "matcher", "isEqual", "isMatch", "isEmpty", |
|
|
"isElement", "isNumber", "isString", "isArray", "isObject", "isPlainObject", "isArguments", "isFunction", "isFinite", |
|
|
"isBoolean", "isDate", "isRegExp", "isError", "isNaN", "isUndefined", "zipObject", "cloneDeep"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.each(["mapObject", "findKey", "pick", "omit", "tap"], function (name) { |
|
|
BI[name] = _applyFunc(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
|
|
|
inherit: function (sb, sp, overrides) { |
|
|
if (typeof sp === "object") { |
|
|
overrides = sp; |
|
|
sp = sb; |
|
|
sb = function () { |
|
|
return sp.apply(this, arguments); |
|
|
}; |
|
|
} |
|
|
var F = function () { |
|
|
}, spp = sp.prototype; |
|
|
F.prototype = spp; |
|
|
sb.prototype = new F(); |
|
|
sb.superclass = spp; |
|
|
_.extend(sb.prototype, overrides, { |
|
|
superclass: sp |
|
|
}); |
|
|
return sb; |
|
|
}, |
|
|
|
|
|
has: function (obj, keys) { |
|
|
if (BI.isArray(keys)) { |
|
|
if (keys.length === 0) { |
|
|
return false; |
|
|
} |
|
|
return BI.every(keys, function (i, key) { |
|
|
return _.has(obj, key); |
|
|
}); |
|
|
} |
|
|
return _.has.apply(_, arguments); |
|
|
}, |
|
|
|
|
|
// 数字和字符串可以作为key |
|
|
isKey: function (key) { |
|
|
return BI.isNumber(key) || (BI.isString(key) && key.length > 0); |
|
|
}, |
|
|
|
|
|
// 忽略大小写的等于 |
|
|
isCapitalEqual: function (a, b) { |
|
|
a = BI.isNull(a) ? a : ("" + a).toLowerCase(); |
|
|
b = BI.isNull(b) ? b : ("" + b).toLowerCase(); |
|
|
return BI.isEqual(a, b); |
|
|
}, |
|
|
|
|
|
isWidthOrHeight: function (w) { |
|
|
if (typeof w === "number") { |
|
|
return w >= 0; |
|
|
} else if (typeof w === "string") { |
|
|
return /^\d{1,3}%$/.exec(w) || w == "auto" || /^\d+px$/.exec(w); |
|
|
} |
|
|
}, |
|
|
|
|
|
isNotNull: function (obj) { |
|
|
return !BI.isNull(obj); |
|
|
}, |
|
|
|
|
|
isNull: function (obj) { |
|
|
return typeof obj === "undefined" || obj === null; |
|
|
}, |
|
|
|
|
|
isEmptyArray: function (arr) { |
|
|
return BI.isArray(arr) && BI.isEmpty(arr); |
|
|
}, |
|
|
|
|
|
isNotEmptyArray: function (arr) { |
|
|
return BI.isArray(arr) && !BI.isEmpty(arr); |
|
|
}, |
|
|
|
|
|
isEmptyObject: function (obj) { |
|
|
return BI.isEqual(obj, {}); |
|
|
}, |
|
|
|
|
|
isNotEmptyObject: function (obj) { |
|
|
return BI.isPlainObject(obj) && !BI.isEmptyObject(obj); |
|
|
}, |
|
|
|
|
|
isEmptyString: function (obj) { |
|
|
return BI.isString(obj) && obj.length === 0; |
|
|
}, |
|
|
|
|
|
isNotEmptyString: function (obj) { |
|
|
return BI.isString(obj) && !BI.isEmptyString(obj); |
|
|
}, |
|
|
|
|
|
isWindow: function () { |
|
|
return $.isWindow.apply($, arguments); |
|
|
} |
|
|
}); |
|
|
|
|
|
// deep方法 |
|
|
_.extend(BI, { |
|
|
deepClone: _.cloneDeep, |
|
|
|
|
|
isDeepMatch: function (object, attrs) { |
|
|
var keys = BI.keys(attrs), length = keys.length; |
|
|
if (object == null) { |
|
|
return !length; |
|
|
} |
|
|
var obj = Object(object); |
|
|
for (var i = 0; i < length; i++) { |
|
|
var key = keys[i]; |
|
|
if (!BI.isEqual(attrs[key], obj[key]) || !(key in obj)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
contains: function (obj, target, fromIndex) { |
|
|
if (!_.isArrayLike(obj)) obj = _.values(obj); |
|
|
return _.indexOf(obj, target, typeof fromIndex === "number" && fromIndex) >= 0; |
|
|
}, |
|
|
|
|
|
deepContains: function (obj, copy) { |
|
|
if (BI.isObject(copy)) { |
|
|
return BI.any(obj, function (i, v) { |
|
|
if (BI.isEqual(v, copy)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
} |
|
|
return BI.contains(obj, copy); |
|
|
}, |
|
|
|
|
|
deepIndexOf: function (obj, target) { |
|
|
for (var i = 0; i < obj.length; i++) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
return i; |
|
|
} |
|
|
} |
|
|
return -1; |
|
|
}, |
|
|
|
|
|
deepRemove: function (obj, target) { |
|
|
var done = false; |
|
|
var i; |
|
|
if (BI.isArray(obj)) { |
|
|
for (i = 0; i < obj.length; i++) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
obj.splice(i--, 1); |
|
|
done = true; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
BI.each(obj, function (i, v) { |
|
|
if (BI.isEqual(target, obj[i])) { |
|
|
delete obj[i]; |
|
|
done = true; |
|
|
} |
|
|
}); |
|
|
} |
|
|
return done; |
|
|
}, |
|
|
|
|
|
deepWithout: function (obj, target) { |
|
|
if (BI.isArray(obj)) { |
|
|
var result = []; |
|
|
for (var i = 0; i < obj.length; i++) { |
|
|
if (!BI.isEqual(target, obj[i])) { |
|
|
result.push(obj[i]); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
} |
|
|
var result = {}; |
|
|
BI.each(obj, function (i, v) { |
|
|
if (!BI.isEqual(target, obj[i])) { |
|
|
result[i] = v; |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
|
|
|
}, |
|
|
|
|
|
deepUnique: function (array) { |
|
|
var result = []; |
|
|
BI.each(array, function (i, item) { |
|
|
if (!BI.deepContains(result, item)) { |
|
|
result.push(item); |
|
|
} |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
// 比较两个对象得出不一样的key值 |
|
|
deepDiff: function (object, other) { |
|
|
object || (object = {}); |
|
|
other || (other = {}); |
|
|
var result = []; |
|
|
var used = []; |
|
|
for (var b in object) { |
|
|
if (this.has(object, b)) { |
|
|
if (!this.isEqual(object[b], other[b])) { |
|
|
result.push(b); |
|
|
} |
|
|
used.push(b); |
|
|
} |
|
|
} |
|
|
for (var b in other) { |
|
|
if (this.has(other, b) && !used.contains(b)) { |
|
|
result.push(b); |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}, |
|
|
|
|
|
deepExtend: function () { |
|
|
var args = [].slice.call(arguments); |
|
|
args.unshift(true); |
|
|
return $.extend.apply($, args); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 通用方法 |
|
|
_.each(["uniqueId", "result", "chain", "iteratee", "escape", "unescape"], function (name) { |
|
|
BI[name] = function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}); |
|
|
|
|
|
// 事件相关方法 |
|
|
_.each(["bind", "once", "partial", "debounce", "throttle", "delay", "defer", "wrap"], function (name) { |
|
|
BI[name] = function () { |
|
|
return _[name].apply(_, arguments); |
|
|
}; |
|
|
}); |
|
|
|
|
|
_.extend(BI, { |
|
|
nextTick: (function () { |
|
|
var callbacks = []; |
|
|
var pending = false; |
|
|
var timerFunc; |
|
|
|
|
|
function nextTickHandler () { |
|
|
pending = false; |
|
|
var copies = callbacks.slice(0); |
|
|
callbacks = []; |
|
|
for (var i = 0; i < copies.length; i++) { |
|
|
copies[i](); |
|
|
} |
|
|
} |
|
|
|
|
|
if (typeof Promise !== "undefined") { |
|
|
var p = Promise.resolve(); |
|
|
timerFunc = function () { |
|
|
p.then(nextTickHandler); |
|
|
}; |
|
|
} else |
|
|
|
|
|
/* istanbul ignore if */ |
|
|
if (typeof MutationObserver !== "undefined") { |
|
|
var counter = 1; |
|
|
var observer = new MutationObserver(nextTickHandler); |
|
|
var textNode = document.createTextNode(counter + ""); |
|
|
observer.observe(textNode, { |
|
|
characterData: true |
|
|
}); |
|
|
timerFunc = function () { |
|
|
counter = (counter + 1) % 2; |
|
|
textNode.data = counter + ""; |
|
|
}; |
|
|
} else { |
|
|
timerFunc = function () { |
|
|
setTimeout(nextTickHandler, 0); |
|
|
}; |
|
|
} |
|
|
return function queueNextTick (cb) { |
|
|
var _resolve; |
|
|
var args = [].slice.call(arguments, 1); |
|
|
callbacks.push(function () { |
|
|
if (cb) { |
|
|
cb.apply(null, args); |
|
|
} |
|
|
if (_resolve) { |
|
|
_resolve.apply(null, args); |
|
|
} |
|
|
}); |
|
|
if (!pending) { |
|
|
pending = true; |
|
|
timerFunc(); |
|
|
} |
|
|
if (!cb && typeof Promise !== "undefined") { |
|
|
return new Promise(function (resolve) { |
|
|
_resolve = resolve; |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})() |
|
|
}); |
|
|
|
|
|
// 数字相关方法 |
|
|
_.each(["random"], function (name) { |
|
|
BI[name] = _apply(name); |
|
|
}); |
|
|
_.extend(BI, { |
|
|
getTime: function () { |
|
|
if (window.performance && window.performance.now) { |
|
|
return window.performance.now(); |
|
|
} |
|
|
if (window.performance && window.performance.webkitNow) { |
|
|
return window.performance.webkitNow(); |
|
|
} |
|
|
if (Date.now) { |
|
|
return Date.now(); |
|
|
} |
|
|
return BI.getDate().getTime(); |
|
|
|
|
|
|
|
|
}, |
|
|
|
|
|
parseInt: function (number) { |
|
|
var radix = 10; |
|
|
if (/^0x/g.test(number)) { |
|
|
radix = 16; |
|
|
} |
|
|
try { |
|
|
return parseInt(number, radix); |
|
|
} catch (e) { |
|
|
throw new Error(number + "parse int error"); |
|
|
return NaN; |
|
|
} |
|
|
}, |
|
|
|
|
|
parseSafeInt: function (value) { |
|
|
var MAX_SAFE_INTEGER = 9007199254740991; |
|
|
return value |
|
|
? this.clamp(this.parseInt(value), -MAX_SAFE_INTEGER, MAX_SAFE_INTEGER) |
|
|
: (value === 0 ? value : 0); |
|
|
}, |
|
|
|
|
|
parseFloat: function (number) { |
|
|
try { |
|
|
return parseFloat(number); |
|
|
} catch (e) { |
|
|
throw new Error(number + "parse float error"); |
|
|
return NaN; |
|
|
} |
|
|
}, |
|
|
|
|
|
isNaturalNumber: function (number) { |
|
|
if (/^\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isPositiveInteger: function (number) { |
|
|
if (/^\+?[1-9][0-9]*$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isNegativeInteger: function (number) { |
|
|
if (/^\-[1-9][0-9]*$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isInteger: function (number) { |
|
|
if (/^\-?\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isNumeric: function (number) { |
|
|
return $.isNumeric(number); |
|
|
}, |
|
|
|
|
|
isFloat: function (number) { |
|
|
if (/^([+-]?)\\d*\\.\\d+$/.test(number)) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
isOdd: function (number) { |
|
|
if (!BI.isInteger(number)) { |
|
|
return false; |
|
|
} |
|
|
return number & 1 === 1; |
|
|
}, |
|
|
|
|
|
isEven: function (number) { |
|
|
if (!BI.isInteger(number)) { |
|
|
return false; |
|
|
} |
|
|
return number & 1 === 0; |
|
|
}, |
|
|
|
|
|
sum: function (array, iteratee, context) { |
|
|
var sum = 0; |
|
|
BI.each(array, function (i, item) { |
|
|
if (iteratee) { |
|
|
sum += Number(iteratee.apply(context, [i, item])); |
|
|
} else { |
|
|
sum += Number(item); |
|
|
} |
|
|
}); |
|
|
return sum; |
|
|
}, |
|
|
|
|
|
average: function (array, iteratee, context) { |
|
|
var sum = BI.sum(array, iteratee, context); |
|
|
return sum / array.length; |
|
|
} |
|
|
}); |
|
|
|
|
|
// 字符串相关方法 |
|
|
_.extend(BI, { |
|
|
trim: function () { |
|
|
return $.trim.apply($, arguments); |
|
|
}, |
|
|
|
|
|
toUpperCase: function (string) { |
|
|
return (string + "").toLocaleUpperCase(); |
|
|
}, |
|
|
|
|
|
toLowerCase: function (string) { |
|
|
return (string + "").toLocaleLowerCase(); |
|
|
}, |
|
|
|
|
|
isEndWithBlank: function (string) { |
|
|
return /(\s|\u00A0)$/.test(string); |
|
|
}, |
|
|
|
|
|
isLiteral: function (exp) { |
|
|
var literalValueRE = /^\s?(true|false|-?[\d\.]+|'[^']*'|"[^"]*")\s?$/; |
|
|
return literalValueRE.test(exp); |
|
|
}, |
|
|
|
|
|
stripQuotes: function (str) { |
|
|
var a = str.charCodeAt(0); |
|
|
var b = str.charCodeAt(str.length - 1); |
|
|
return a === b && (a === 0x22 || a === 0x27) |
|
|
? str.slice(1, -1) |
|
|
: str; |
|
|
}, |
|
|
|
|
|
// background-color => backgroundColor |
|
|
camelize: function (str) { |
|
|
return str.replace(/-(.)/g, function (_, character) { |
|
|
return character.toUpperCase(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
// backgroundColor => background-color |
|
|
hyphenate: function (str) { |
|
|
return str.replace(/([A-Z])/g, "-$1").toLowerCase(); |
|
|
}, |
|
|
|
|
|
isNotEmptyString: function (str) { |
|
|
return BI.isString(str) && !BI.isEmpty(str); |
|
|
}, |
|
|
|
|
|
isEmptyString: function (str) { |
|
|
return BI.isString(str) && BI.isEmpty(str); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串进行加密 {@link #decrypt} |
|
|
* @static |
|
|
* @param str 原始字符<EFBFBD>? |
|
|
* @param keyt 密钥 |
|
|
* @returns {String} 加密后的字符<EFBFBD>? |
|
|
*/ |
|
|
encrypt: function (str, keyt) { |
|
|
if (str == "") { |
|
|
return ""; |
|
|
} |
|
|
str = escape(str); |
|
|
if (!keyt || keyt == "") { |
|
|
keyt = "655"; |
|
|
} |
|
|
keyt = escape(keyt); |
|
|
if (keyt == null || keyt.length <= 0) { |
|
|
alert("Please enter a password with which to encrypt the message."); |
|
|
return null; |
|
|
} |
|
|
var prand = ""; |
|
|
for (var i = 0; i < keyt.length; i++) { |
|
|
prand += keyt.charCodeAt(i).toString(); |
|
|
} |
|
|
var sPos = Math.floor(prand.length / 5); |
|
|
var mult = parseInt(prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4) + prand.charAt(sPos * 5)); |
|
|
|
|
|
var incr = Math.ceil(keyt.length / 2); |
|
|
var modu = Math.pow(2, 31) - 1; |
|
|
if (mult < 2) { |
|
|
alert("Algorithm cannot find a suitable hash. Please choose a different password. \nPossible considerations are to choose a more complex or longer password."); |
|
|
return null; |
|
|
} |
|
|
// var salt = Math.round(Math.random() * 1000000000) % 100000000; |
|
|
var salt = 101; |
|
|
prand += salt; |
|
|
while (prand.length > 10) { |
|
|
prand = (parseInt(prand.substring(0, 10)) + parseInt(prand.substring(10, prand.length), 10)).toString(); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
var enc_chr = ""; |
|
|
var enc_str = ""; |
|
|
for (var i = 0; i < str.length; i++) { |
|
|
enc_chr = parseInt(str.charCodeAt(i) ^ Math.floor((prand / modu) * 255)); |
|
|
if (enc_chr < 16) { |
|
|
enc_str += "0" + enc_chr.toString(16); |
|
|
} else { |
|
|
enc_str += enc_chr.toString(16); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
} |
|
|
salt = salt.toString(16); |
|
|
while (salt.length < 8) { |
|
|
salt = "0" + salt; |
|
|
} |
|
|
enc_str += salt; |
|
|
return enc_str; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对加密后的字符串解密 {@link #encrypt} |
|
|
* @static |
|
|
* @param str 加密过的字符<EFBFBD>? |
|
|
* @param keyt 密钥 |
|
|
* @returns {String} 解密后的字符<EFBFBD>? |
|
|
*/ |
|
|
decrypt: function (str, keyt) { |
|
|
if (str == "") { |
|
|
return ""; |
|
|
} |
|
|
if (!keyt || keyt == "") { |
|
|
keyt = "655"; |
|
|
} |
|
|
keyt = escape(keyt); |
|
|
if (str == null || str.length < 8) { |
|
|
return; |
|
|
} |
|
|
if (keyt == null || keyt.length <= 0) { |
|
|
return; |
|
|
} |
|
|
var prand = ""; |
|
|
for (var i = 0; i < keyt.length; i++) { |
|
|
prand += keyt.charCodeAt(i).toString(); |
|
|
} |
|
|
var sPos = Math.floor(prand.length / 5); |
|
|
var tempmult = prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4); |
|
|
if (sPos * 5 < prand.length) { |
|
|
tempmult += prand.charAt(sPos * 5); |
|
|
} |
|
|
var mult = parseInt(tempmult); |
|
|
var incr = Math.round(keyt.length / 2); |
|
|
var modu = Math.pow(2, 31) - 1; |
|
|
var salt = parseInt(str.substring(str.length - 8, str.length), 16); |
|
|
str = str.substring(0, str.length - 8); |
|
|
prand += salt; |
|
|
while (prand.length > 10) { |
|
|
prand = (parseInt(prand.substring(0, 10), 10) + parseInt(prand.substring(10, prand.length), 10)).toString(); |
|
|
} |
|
|
prand = (mult * prand + incr) % modu; |
|
|
var enc_chr = ""; |
|
|
var enc_str = ""; |
|
|
for (var i = 0; i < str.length; i += 2) { |
|
|
enc_chr = parseInt(parseInt(str.substring(i, i + 2), 16) ^ Math.floor((prand / modu) * 255)); |
|
|
enc_str += String.fromCharCode(enc_chr); |
|
|
prand = (mult * prand + incr) % modu; |
|
|
} |
|
|
return unescape(enc_str); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串中的'和\做编码处理 |
|
|
* @static |
|
|
* @param {String} string 要做编码处理的字符串 |
|
|
* @return {String} 编码后的字符串 |
|
|
*/ |
|
|
escape: function (string) { |
|
|
return string.replace(/('|\\)/g, "\\$1"); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 让字符串通过指定字符做补齐的函数 |
|
|
* |
|
|
* var s = BI.leftPad('123', 5, '0');//s的值为:'00123' |
|
|
* |
|
|
* @static |
|
|
* @param {String} val 原始值 |
|
|
* @param {Number} size 总共需要的位数 |
|
|
* @param {String} ch 用于补齐的字符 |
|
|
* @return {String} 补齐后的字符串 |
|
|
*/ |
|
|
leftPad: function (val, size, ch) { |
|
|
var result = String(val); |
|
|
if (!ch) { |
|
|
ch = " "; |
|
|
} |
|
|
while (result.length < size) { |
|
|
result = ch + result; |
|
|
} |
|
|
return result.toString(); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 对字符串做替换的函数 |
|
|
* |
|
|
* var cls = 'my-class', text = 'Some text'; |
|
|
* var res = BI.format('<div class="{0}>{1}</div>"', cls, text); |
|
|
* //res的值为:'<div class="my-class">Some text</div>'; |
|
|
* |
|
|
* @static |
|
|
* @param {String} format 要做替换的字符串,替换字符串1,替换字符串2... |
|
|
* @return {String} 做了替换后的字符串 |
|
|
*/ |
|
|
format: function (format) { |
|
|
var args = Array.prototype.slice.call(arguments, 1); |
|
|
return format.replace(/\{(\d+)\}/g, function (m, i) { |
|
|
return args[i]; |
|
|
}); |
|
|
} |
|
|
}); |
|
|
|
|
|
// 日期相关方法 |
|
|
_.extend(BI, { |
|
|
/** |
|
|
* 是否是闰年 |
|
|
* @param year |
|
|
* @returns {boolean} |
|
|
*/ |
|
|
isLeapYear: function (year) { |
|
|
return (year % 4 === 0 && year % 100 !== 0) || year % 400 === 0; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 检测是否在有效期 |
|
|
* |
|
|
* @param YY 年 |
|
|
* @param MM 月 |
|
|
* @param DD 日 |
|
|
* @param minDate '1900-01-01' |
|
|
* @param maxDate '2099-12-31' |
|
|
* @returns {Array} 若无效返回无效状态 |
|
|
*/ |
|
|
checkDateVoid: function (YY, MM, DD, minDate, maxDate) { |
|
|
var back = []; |
|
|
YY = YY | 0; |
|
|
MM = MM | 0; |
|
|
DD = DD | 0; |
|
|
minDate = BI.isString(minDate) ? minDate.match(/\d+/g) : minDate; |
|
|
maxDate = BI.isString(maxDate) ? maxDate.match(/\d+/g) : maxDate; |
|
|
if (YY < minDate[0]) { |
|
|
back = ["y"]; |
|
|
} else if (YY > maxDate[0]) { |
|
|
back = ["y", 1]; |
|
|
} else if (YY >= minDate[0] && YY <= maxDate[0]) { |
|
|
if (YY == minDate[0]) { |
|
|
if (MM < minDate[1]) { |
|
|
back = ["m"]; |
|
|
} else if (MM == minDate[1]) { |
|
|
if (DD < minDate[2]) { |
|
|
back = ["d"]; |
|
|
} |
|
|
} |
|
|
} |
|
|
if (YY == maxDate[0]) { |
|
|
if (MM > maxDate[1]) { |
|
|
back = ["m", 1]; |
|
|
} else if (MM == maxDate[1]) { |
|
|
if (DD > maxDate[2]) { |
|
|
back = ["d", 1]; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
return back; |
|
|
}, |
|
|
|
|
|
checkDateLegal: function (str) { |
|
|
var ar = str.match(/\d+/g); |
|
|
var YY = ar[0] | 0, MM = ar[1] | 0, DD = ar[2] | 0; |
|
|
if (ar.length <= 1) { |
|
|
return true; |
|
|
} |
|
|
if (ar.length <= 2) { |
|
|
return MM >= 1 && MM <= 12; |
|
|
} |
|
|
var MD = Date._MD.slice(0); |
|
|
MD[1] = BI.isLeapYear(YY) ? 29 : 28; |
|
|
return MM >= 1 && MM <= 12 && DD <= MD[MM - 1]; |
|
|
}, |
|
|
|
|
|
parseDateTime: function (str, fmt) { |
|
|
var today = BI.getDate(); |
|
|
var y = 0; |
|
|
var m = 0; |
|
|
var d = 1; |
|
|
// wei : 对于fmt为‘YYYYMM’或者‘YYYYMMdd’的格式,str的值为类似'201111'的形式,因为年月之间没有分隔符,所以正则表达式分割无效,导致bug7376。 |
|
|
var a = str.split(/\W+/); |
|
|
if (fmt.toLowerCase() == "%y%x" || fmt.toLowerCase() == "%y%x%d") { |
|
|
var yearlength = 4; |
|
|
var otherlength = 2; |
|
|
a[0] = str.substring(0, yearlength); |
|
|
a[1] = str.substring(yearlength, yearlength + otherlength); |
|
|
a[2] = str.substring(yearlength + otherlength, yearlength + otherlength * 2); |
|
|
} |
|
|
var b = fmt.match(/%./g); |
|
|
var i = 0, j = 0; |
|
|
var hr = 0; |
|
|
var min = 0; |
|
|
var sec = 0; |
|
|
for (i = 0; i < a.length; ++i) { |
|
|
switch (b[i]) { |
|
|
case "%d": |
|
|
case "%e": |
|
|
d = parseInt(a[i], 10); |
|
|
break; |
|
|
|
|
|
case "%X": |
|
|
m = parseInt(a[i], 10) - 1; |
|
|
break; |
|
|
case "%x": |
|
|
m = parseInt(a[i], 10) - 1; |
|
|
break; |
|
|
|
|
|
case "%Y": |
|
|
case "%y": |
|
|
y = parseInt(a[i], 10); |
|
|
(y < 100) && (y += (y > 29) ? 1900 : 2000); |
|
|
break; |
|
|
|
|
|
case "%b": |
|
|
case "%B": |
|
|
for (j = 0; j < 12; ++j) { |
|
|
if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) { |
|
|
m = j; |
|
|
break; |
|
|
} |
|
|
} |
|
|
break; |
|
|
|
|
|
case "%H": |
|
|
case "%I": |
|
|
case "%k": |
|
|
case "%l": |
|
|
hr = parseInt(a[i], 10); |
|
|
break; |
|
|
|
|
|
case "%P": |
|
|
case "%p": |
|
|
if (/pm/i.test(a[i]) && hr < 12) { |
|
|
hr += 12; |
|
|
} else if (/am/i.test(a[i]) && hr >= 12) { |
|
|
hr -= 12; |
|
|
} |
|
|
break; |
|
|
|
|
|
case "%M": |
|
|
min = parseInt(a[i], 10); |
|
|
case "%S": |
|
|
sec = parseInt(a[i], 10); |
|
|
break; |
|
|
} |
|
|
} |
|
|
// if (!a[i]) { |
|
|
// continue; |
|
|
// } |
|
|
if (isNaN(y)) { |
|
|
y = today.getFullYear(); |
|
|
} |
|
|
if (isNaN(m)) { |
|
|
m = today.getMonth(); |
|
|
} |
|
|
if (isNaN(d)) { |
|
|
d = today.getDate(); |
|
|
} |
|
|
if (isNaN(hr)) { |
|
|
hr = today.getHours(); |
|
|
} |
|
|
if (isNaN(min)) { |
|
|
min = today.getMinutes(); |
|
|
} |
|
|
if (isNaN(sec)) { |
|
|
sec = today.getSeconds(); |
|
|
} |
|
|
if (y != 0) { |
|
|
return BI.getDate(y, m, d, hr, min, sec); |
|
|
} |
|
|
y = 0; |
|
|
m = -1; |
|
|
d = 0; |
|
|
for (i = 0; i < a.length; ++i) { |
|
|
if (a[i].search(/[a-zA-Z]+/) != -1) { |
|
|
var t = -1; |
|
|
for (j = 0; j < 12; ++j) { |
|
|
if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) { |
|
|
t = j; |
|
|
break; |
|
|
} |
|
|
} |
|
|
if (t != -1) { |
|
|
if (m != -1) { |
|
|
d = m + 1; |
|
|
} |
|
|
m = t; |
|
|
} |
|
|
} else if (parseInt(a[i], 10) <= 12 && m == -1) { |
|
|
m = a[i] - 1; |
|
|
} else if (parseInt(a[i], 10) > 31 && y == 0) { |
|
|
y = parseInt(a[i], 10); |
|
|
(y < 100) && (y += (y > 29) ? 1900 : 2000); |
|
|
} else if (d == 0) { |
|
|
d = a[i]; |
|
|
} |
|
|
} |
|
|
if (y == 0) { |
|
|
y = today.getFullYear(); |
|
|
} |
|
|
if (m != -1 && d != 0) { |
|
|
return BI.getDate(y, m, d, hr, min, sec); |
|
|
} |
|
|
return today; |
|
|
}, |
|
|
|
|
|
getDate: function () { |
|
|
var length = arguments.length; |
|
|
var args = arguments; |
|
|
var dt; |
|
|
switch (length) { |
|
|
// new Date() |
|
|
case 0: |
|
|
dt = new Date(); |
|
|
break; |
|
|
// new Date(long) |
|
|
case 1: |
|
|
dt = new Date(args[0]); |
|
|
break; |
|
|
// new Date(year, month) |
|
|
case 2: |
|
|
dt = new Date(args[0], args[1]); |
|
|
break; |
|
|
// new Date(year, month, day) |
|
|
case 3: |
|
|
dt = new Date(args[0], args[1], args[2]); |
|
|
break; |
|
|
// new Date(year, month, day, hour) |
|
|
case 4: |
|
|
dt = new Date(args[0], args[1], args[2], args[3]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute) |
|
|
case 5: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second) |
|
|
case 6: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second, millisecond) |
|
|
case 7: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
break; |
|
|
default: |
|
|
dt = new Date(); |
|
|
break; |
|
|
} |
|
|
if (BI.isNotNull(Date.timeZone) && (arguments.length === 0 || (arguments.length === 1 && BI.isNumber(arguments[0])))) { |
|
|
var localTime = dt.getTime(); |
|
|
var localOffset = dt.getTimezoneOffset() * 60000; // 获得当地时间偏移的毫秒数 |
|
|
var utc = localTime + localOffset; // utc即GMT时间标准时区 |
|
|
return new Date(utc + Date.timeZone);// + Pool.timeZone.offset); |
|
|
} |
|
|
return dt; |
|
|
|
|
|
}, |
|
|
|
|
|
getTime: function () { |
|
|
var length = arguments.length; |
|
|
var args = arguments; |
|
|
var dt; |
|
|
switch (length) { |
|
|
// new Date() |
|
|
case 0: |
|
|
dt = new Date(); |
|
|
break; |
|
|
// new Date(long) |
|
|
case 1: |
|
|
dt = new Date(args[0]); |
|
|
break; |
|
|
// new Date(year, month) |
|
|
case 2: |
|
|
dt = new Date(args[0], args[1]); |
|
|
break; |
|
|
// new Date(year, month, day) |
|
|
case 3: |
|
|
dt = new Date(args[0], args[1], args[2]); |
|
|
break; |
|
|
// new Date(year, month, day, hour) |
|
|
case 4: |
|
|
dt = new Date(args[0], args[1], args[2], args[3]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute) |
|
|
case 5: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second) |
|
|
case 6: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]); |
|
|
break; |
|
|
// new Date(year, month, day, hour, minute, second, millisecond) |
|
|
case 7: |
|
|
dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]); |
|
|
break; |
|
|
default: |
|
|
dt = new Date(); |
|
|
break; |
|
|
} |
|
|
if (BI.isNotNull(Date.timeZone)) { |
|
|
return dt.getTime() - Date.timeZone - dt.getTimezoneOffset() * 60000; |
|
|
} |
|
|
return dt.getTime(); |
|
|
|
|
|
} |
|
|
}); |
|
|
|
|
|
// 浏览器相关方法 |
|
|
_.extend(BI, { |
|
|
isIE: function () { |
|
|
if (this.__isIE == null) { |
|
|
this.__isIE = /(msie|trident)/i.test(navigator.userAgent.toLowerCase()); |
|
|
} |
|
|
return this.__isIE; |
|
|
}, |
|
|
|
|
|
getIEVersion: function () { |
|
|
if (this.__IEVersion != null) { |
|
|
return this.__IEVersion; |
|
|
} |
|
|
var version = 0; |
|
|
var agent = navigator.userAgent.toLowerCase(); |
|
|
var v1 = agent.match(/(?:msie\s([\w.]+))/); |
|
|
var v2 = agent.match(/(?:trident.*rv:([\w.]+))/); |
|
|
if (v1 && v2 && v1[1] && v2[1]) { |
|
|
version = Math.max(v1[1] * 1, v2[1] * 1); |
|
|
} else if (v1 && v1[1]) { |
|
|
version = v1[1] * 1; |
|
|
} else if (v2 && v2[1]) { |
|
|
version = v2[1] * 1; |
|
|
} else { |
|
|
version = 0; |
|
|
} |
|
|
return this.__IEVersion = version; |
|
|
}, |
|
|
|
|
|
isIE9Below: function () { |
|
|
if (!BI.isIE()) { |
|
|
return false; |
|
|
} |
|
|
return this.getIEVersion() < 9; |
|
|
}, |
|
|
|
|
|
isEdge: function () { |
|
|
return /edge/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isChrome: function () { |
|
|
return /chrome/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isFireFox: function () { |
|
|
return /firefox/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isOpera: function () { |
|
|
return /opera/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isSafari: function () { |
|
|
return /safari/i.test(navigator.userAgent.toLowerCase()); |
|
|
}, |
|
|
|
|
|
isKhtml: function () { |
|
|
return /Konqueror|Safari|KHTML/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isMac: function () { |
|
|
return /macintosh|mac os x/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isWindows: function () { |
|
|
return /windows|win32/i.test(navigator.userAgent); |
|
|
}, |
|
|
|
|
|
isSupportCss3: function (style) { |
|
|
var prefix = ["webkit", "Moz", "ms", "o"], |
|
|
i, len, |
|
|
humpString = [], |
|
|
htmlStyle = document.documentElement.style, |
|
|
_toHumb = function (string) { |
|
|
return string.replace(/-(\w)/g, function ($0, $1) { |
|
|
return $1.toUpperCase(); |
|
|
}); |
|
|
}; |
|
|
|
|
|
for (i in prefix) { |
|
|
humpString.push(_toHumb(prefix[i] + "-" + style)); |
|
|
} |
|
|
humpString.push(_toHumb(style)); |
|
|
|
|
|
for (i = 0, len = humpString.length; i < len; i++) { |
|
|
if (humpString[i] in htmlStyle) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
} |
|
|
}); |
|
|
// BI请求 |
|
|
_.extend(BI, { |
|
|
|
|
|
ajax: function (option) { |
|
|
option || (option = {}); |
|
|
var async = option.async; |
|
|
option.data = BI.cjkEncodeDO(option.data || {}); |
|
|
|
|
|
$.ajax({ |
|
|
url: option.url, |
|
|
type: "POST", |
|
|
data: option.data, |
|
|
async: async, |
|
|
error: option.error, |
|
|
complete: function (res, status) { |
|
|
if (BI.isFunction(option.complete)) { |
|
|
option.complete(BI.jsonDecode(res.responseText), status); |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
}); |
|
|
})();/** |
|
|
* 客户端观察者,主要处理事件的添加、删除、执行等 |
|
|
* @class BI.OB |
|
|
* @abstract |
|
|
*/ |
|
|
BI.OB = function (config) { |
|
|
var props = this.props; |
|
|
if (BI.isFunction(this.props)) { |
|
|
props = this.props(config); |
|
|
} |
|
|
this.options = (window.$ || window._).extend(this._defaultConfig(config), props, config); |
|
|
this._init(); |
|
|
this._initRef(); |
|
|
}; |
|
|
_.extend(BI.OB.prototype, { |
|
|
props: {}, |
|
|
init: null, |
|
|
destroyed: null, |
|
|
|
|
|
_defaultConfig: function (config) { |
|
|
return {}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
this._initListeners(); |
|
|
this.init && this.init(); |
|
|
}, |
|
|
|
|
|
_initListeners: function () { |
|
|
var self = this; |
|
|
if (this.options.listeners != null) { |
|
|
_.each(this.options.listeners, function (lis) { |
|
|
(lis.target ? lis.target : self)[lis.once ? "once" : "on"] |
|
|
(lis.eventName, _.bind(lis.action, self)); |
|
|
}); |
|
|
delete this.options.listeners; |
|
|
} |
|
|
}, |
|
|
|
|
|
// 获得一个当前对象的引用 |
|
|
_initRef: function () { |
|
|
if (this.options.ref) { |
|
|
this.options.ref.call(this, this); |
|
|
} |
|
|
}, |
|
|
|
|
|
//释放当前对象 |
|
|
_purgeRef: function(){ |
|
|
if (this.options.ref) { |
|
|
this.options.ref.call(null); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getEvents: function () { |
|
|
if (!_.isArray(this.events)) { |
|
|
this.events = []; |
|
|
} |
|
|
return this.events; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给观察者绑定一个事件 |
|
|
* @param {String} eventName 事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数 |
|
|
*/ |
|
|
on: function (eventName, fn) { |
|
|
eventName = eventName.toLowerCase(); |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (!_.isArray(fns)) { |
|
|
fns = []; |
|
|
this._getEvents()[eventName] = fns; |
|
|
} |
|
|
fns.push(fn); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给观察者绑定一个只执行一次的事件 |
|
|
* @param {String} eventName 事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数 |
|
|
*/ |
|
|
once: function (eventName, fn) { |
|
|
var proxy = function () { |
|
|
fn.apply(this, arguments); |
|
|
this.un(eventName, proxy); |
|
|
}; |
|
|
this.on(eventName, proxy); |
|
|
}, |
|
|
/** |
|
|
* 解除观察者绑定的指定事件 |
|
|
* @param {String} eventName 要解除绑定事件的名字 |
|
|
* @param {Function} fn 事件对应的执行函数,该参数是可选的,没有该参数时,将解除绑定所有同名字的事件 |
|
|
*/ |
|
|
un: function (eventName, fn) { |
|
|
eventName = eventName.toLowerCase(); |
|
|
|
|
|
/* alex:如果fn是null,就是把eventName上面所有方法都un掉*/ |
|
|
if (fn == null) { |
|
|
delete this._getEvents()[eventName]; |
|
|
} else { |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (_.isArray(fns)) { |
|
|
var newFns = []; |
|
|
_.each(fns, function (ifn) { |
|
|
if (ifn != fn) { |
|
|
newFns.push(ifn); |
|
|
} |
|
|
}); |
|
|
this._getEvents()[eventName] = newFns; |
|
|
} |
|
|
} |
|
|
}, |
|
|
/** |
|
|
* 清除观察者的所有事件绑定 |
|
|
*/ |
|
|
purgeListeners: function () { |
|
|
/* alex:清空events*/ |
|
|
this.events = []; |
|
|
}, |
|
|
/** |
|
|
* 触发绑定过的事件 |
|
|
* |
|
|
* @param {String} eventName 要触发的事件的名字 |
|
|
* @returns {Boolean} 如果事件函数返回false,则返回false并中断其他同名事件的执行,否则执行所有的同名事件并返回true |
|
|
*/ |
|
|
fireEvent: function () { |
|
|
var eventName = arguments[0].toLowerCase(); |
|
|
var fns = this._getEvents()[eventName]; |
|
|
if (BI.isArray(fns)) { |
|
|
if (BI.isArguments(arguments[1])) { |
|
|
for (var i = 0; i < fns.length; i++) { |
|
|
if (fns[i].apply(this, arguments[1]) === false) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var args = Array.prototype.slice.call(arguments, 1); |
|
|
for (var i = 0; i < fns.length; i++) { |
|
|
if (fns[i].apply(this, args) === false) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
return true; |
|
|
}, |
|
|
|
|
|
destroy: function () { |
|
|
this.destroyed && this.destroyed(); |
|
|
this._purgeRef(); |
|
|
this.purgeListeners(); |
|
|
} |
|
|
});/** |
|
|
* Widget超类 |
|
|
* @class BI.Widget |
|
|
* @extends BI.OB |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
*/ |
|
|
BI.Widget = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.Widget.superclass._defaultConfig.apply(this), { |
|
|
root: false, |
|
|
tagName: "div", |
|
|
attributes: null, |
|
|
data: null, |
|
|
|
|
|
tag: null, |
|
|
disabled: false, |
|
|
invisible: false, |
|
|
invalid: false, |
|
|
baseCls: "", |
|
|
extraCls: "", |
|
|
cls: "" |
|
|
}); |
|
|
}, |
|
|
|
|
|
beforeInit: null, |
|
|
|
|
|
// 生命周期函数 |
|
|
beforeCreate: null, |
|
|
|
|
|
created: null, |
|
|
|
|
|
render: null, |
|
|
|
|
|
beforeMount: null, |
|
|
|
|
|
mounted: null, |
|
|
|
|
|
shouldUpdate: null, |
|
|
|
|
|
update: function () { |
|
|
}, |
|
|
|
|
|
beforeDestroy: null, |
|
|
|
|
|
destroyed: null, |
|
|
|
|
|
_init: function () { |
|
|
BI.Widget.superclass._init.apply(this, arguments); |
|
|
this._initRoot(); |
|
|
this._initElementWidth(); |
|
|
this._initElementHeight(); |
|
|
this._initVisual(); |
|
|
this._initState(); |
|
|
if (this.beforeInit) { |
|
|
this.__asking = true; |
|
|
this.beforeInit(BI.bind(this._render, this)); |
|
|
if (this.__asking === true) { |
|
|
this.__async = true; |
|
|
} |
|
|
} else { |
|
|
this._render(); |
|
|
} |
|
|
}, |
|
|
|
|
|
_render: function () { |
|
|
this.__asking = false; |
|
|
this.beforeCreate && this.beforeCreate(); |
|
|
this._initElement(); |
|
|
this._initEffects(); |
|
|
this.created && this.created(); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 初始化根节点 |
|
|
* @private |
|
|
*/ |
|
|
_initRoot: function () { |
|
|
var o = this.options; |
|
|
this.widgetName = o.widgetName || BI.uniqueId("widget"); |
|
|
this._isRoot = o.root; |
|
|
if (BI.isWidget(o.element)) { |
|
|
if (o.element instanceof BI.Widget) { |
|
|
this._parent = o.element; |
|
|
this._parent.addWidget(this.widgetName, this); |
|
|
} else { |
|
|
this._isRoot = true; |
|
|
} |
|
|
this.element = this.options.element.element; |
|
|
} else if (o.element) { |
|
|
// if (o.root !== true) { |
|
|
// throw new Error("root is a required property"); |
|
|
// } |
|
|
this.element = $(o.element); |
|
|
this._isRoot = true; |
|
|
} else { |
|
|
this.element = $(document.createElement(o.tagName)); |
|
|
} |
|
|
this.element._isWidget = true; |
|
|
if (o.baseCls || o.extraCls || o.cls) { |
|
|
this.element.addClass((o.baseCls || "") + " " + (o.extraCls || "") + " " + (o.cls || "")); |
|
|
} |
|
|
if (o.attributes) { |
|
|
this.element.attr(o.attributes); |
|
|
} |
|
|
if (o.data) { |
|
|
this.element.data(o.data); |
|
|
} |
|
|
this._children = {}; |
|
|
}, |
|
|
|
|
|
_initElementWidth: function () { |
|
|
var o = this.options; |
|
|
if (BI.isWidthOrHeight(o.width)) { |
|
|
this.element.css("width", o.width); |
|
|
} |
|
|
}, |
|
|
|
|
|
_initElementHeight: function () { |
|
|
var o = this.options; |
|
|
if (BI.isWidthOrHeight(o.height)) { |
|
|
this.element.css("height", o.height); |
|
|
} |
|
|
}, |
|
|
|
|
|
_initVisual: function () { |
|
|
var o = this.options; |
|
|
if (o.invisible) { |
|
|
// 用display属性做显示和隐藏,否则jquery会在显示时将display设为block会覆盖掉display:flex属性 |
|
|
this.element.css("display", "none"); |
|
|
} |
|
|
}, |
|
|
|
|
|
_initEffects: function () { |
|
|
var o = this.options; |
|
|
if (o.disabled || o.invalid) { |
|
|
if (this.options.disabled) { |
|
|
this.setEnable(false); |
|
|
} |
|
|
if (this.options.invalid) { |
|
|
this.setValid(false); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
_initState: function () { |
|
|
this._isMounted = false; |
|
|
}, |
|
|
|
|
|
_initElement: function () { |
|
|
var self = this; |
|
|
var els = this.render && this.render(); |
|
|
if (BI.isPlainObject(els)) { |
|
|
els = [els]; |
|
|
} |
|
|
if (BI.isArray(els)) { |
|
|
BI.each(els, function (i, el) { |
|
|
BI.createWidget(el, { |
|
|
element: self |
|
|
}); |
|
|
}); |
|
|
} |
|
|
// if (this._isRoot === true || !(this instanceof BI.Layout)) { |
|
|
this._mount(); |
|
|
// } |
|
|
}, |
|
|
|
|
|
_setParent: function (parent) { |
|
|
this._parent = parent; |
|
|
}, |
|
|
|
|
|
_mount: function () { |
|
|
var self = this; |
|
|
var isMounted = this._isMounted; |
|
|
if (isMounted || !this.isVisible() || this.__asking === true) { |
|
|
return; |
|
|
} |
|
|
if (this._isRoot === true) { |
|
|
isMounted = true; |
|
|
} else if (this._parent && this._parent._isMounted === true) { |
|
|
isMounted = true; |
|
|
} |
|
|
if (!isMounted) { |
|
|
return; |
|
|
} |
|
|
this.beforeMount && this.beforeMount(); |
|
|
this._isMounted = true; |
|
|
this._mountChildren && this._mountChildren(); |
|
|
BI.each(this._children, function (i, widget) { |
|
|
!self.isEnabled() && widget._setEnable(false); |
|
|
!self.isValid() && widget._setValid(false); |
|
|
widget._mount && widget._mount(); |
|
|
}); |
|
|
this.mounted && this.mounted(); |
|
|
}, |
|
|
|
|
|
_mountChildren: null, |
|
|
|
|
|
isMounted: function () { |
|
|
return this._isMounted; |
|
|
}, |
|
|
|
|
|
setWidth: function (w) { |
|
|
this.options.width = w; |
|
|
this._initElementWidth(); |
|
|
}, |
|
|
|
|
|
setHeight: function (h) { |
|
|
this.options.height = h; |
|
|
this._initElementHeight(); |
|
|
}, |
|
|
|
|
|
_setEnable: function (enable) { |
|
|
if (enable === true) { |
|
|
this.options.disabled = false; |
|
|
} else if (enable === false) { |
|
|
this.options.disabled = true; |
|
|
} |
|
|
// 递归将所有子组件使能 |
|
|
BI.each(this._children, function (i, child) { |
|
|
!child._manualSetEnable && child._setEnable && child._setEnable(enable); |
|
|
}); |
|
|
}, |
|
|
|
|
|
_setValid: function (valid) { |
|
|
if (valid === true) { |
|
|
this.options.invalid = false; |
|
|
} else if (valid === false) { |
|
|
this.options.invalid = true; |
|
|
} |
|
|
// 递归将所有子组件使有效 |
|
|
BI.each(this._children, function (i, child) { |
|
|
!child._manualSetValid && child._setValid && child._setValid(valid); |
|
|
}); |
|
|
}, |
|
|
|
|
|
_setVisible: function (visible) { |
|
|
if (visible === true) { |
|
|
this.options.invisible = false; |
|
|
} else if (visible === false) { |
|
|
this.options.invisible = true; |
|
|
} |
|
|
}, |
|
|
|
|
|
setEnable: function (enable) { |
|
|
this._manualSetEnable = true; |
|
|
this._setEnable(enable); |
|
|
if (enable === true) { |
|
|
this.element.removeClass("base-disabled disabled"); |
|
|
} else if (enable === false) { |
|
|
this.element.addClass("base-disabled disabled"); |
|
|
} |
|
|
}, |
|
|
|
|
|
setVisible: function (visible) { |
|
|
this._setVisible(visible); |
|
|
if (visible === true) { |
|
|
// 用this.element.show()会把display属性改成block |
|
|
this.element.css("display", ""); |
|
|
this._mount(); |
|
|
} else if (visible === false) { |
|
|
this.element.css("display", "none"); |
|
|
} |
|
|
this.fireEvent(BI.Events.VIEW, visible); |
|
|
}, |
|
|
|
|
|
setValid: function (valid) { |
|
|
this._manualSetValid = true; |
|
|
this._setValid(valid); |
|
|
if (valid === true) { |
|
|
this.element.removeClass("base-invalid invalid"); |
|
|
} else if (valid === false) { |
|
|
this.element.addClass("base-invalid invalid"); |
|
|
} |
|
|
}, |
|
|
|
|
|
doBehavior: function () { |
|
|
var args = arguments; |
|
|
// 递归将所有子组件使有效 |
|
|
BI.each(this._children, function (i, child) { |
|
|
child.doBehavior && child.doBehavior.apply(child, args); |
|
|
}); |
|
|
}, |
|
|
|
|
|
getWidth: function () { |
|
|
return this.options.width; |
|
|
}, |
|
|
|
|
|
getHeight: function () { |
|
|
return this.options.height; |
|
|
}, |
|
|
|
|
|
isValid: function () { |
|
|
return !this.options.invalid; |
|
|
}, |
|
|
|
|
|
addWidget: function (name, widget) { |
|
|
var self = this; |
|
|
if (name instanceof BI.Widget) { |
|
|
widget = name; |
|
|
name = widget.getName(); |
|
|
} |
|
|
if (BI.isKey(name)) { |
|
|
name = name + ""; |
|
|
} |
|
|
name = name || widget.getName() || BI.uniqueId("widget"); |
|
|
if (this._children[name]) { |
|
|
throw new Error("name has already been existed"); |
|
|
} |
|
|
widget._setParent && widget._setParent(this); |
|
|
widget.on(BI.Events.DESTROY, function () { |
|
|
BI.remove(self._children, this); |
|
|
}); |
|
|
return (this._children[name] = widget); |
|
|
}, |
|
|
|
|
|
getWidgetByName: function (name) { |
|
|
if (!BI.isKey(name) || name === this.getName()) { |
|
|
return this; |
|
|
} |
|
|
name = name + ""; |
|
|
var widget = void 0, other = {}; |
|
|
BI.any(this._children, function (i, wi) { |
|
|
if (i === name) { |
|
|
widget = wi; |
|
|
return true; |
|
|
} |
|
|
other[i] = wi; |
|
|
}); |
|
|
if (!widget) { |
|
|
BI.any(other, function (i, wi) { |
|
|
return (widget = wi.getWidgetByName(i)); |
|
|
}); |
|
|
} |
|
|
return widget; |
|
|
}, |
|
|
|
|
|
removeWidget: function (nameOrWidget) { |
|
|
var self = this; |
|
|
if (BI.isWidget(nameOrWidget)) { |
|
|
BI.remove(this._children, nameOrWidget); |
|
|
} else { |
|
|
delete this._children[nameOrWidget]; |
|
|
} |
|
|
}, |
|
|
|
|
|
hasWidget: function (name) { |
|
|
return this._children[name] != null; |
|
|
}, |
|
|
|
|
|
getName: function () { |
|
|
return this.widgetName; |
|
|
}, |
|
|
|
|
|
setTag: function (tag) { |
|
|
this.options.tag = tag; |
|
|
}, |
|
|
|
|
|
getTag: function () { |
|
|
return this.options.tag; |
|
|
}, |
|
|
|
|
|
attr: function (key, value) { |
|
|
var self = this; |
|
|
if (BI.isPlainObject(key)) { |
|
|
BI.each(key, function (k, v) { |
|
|
self.attr(k, v); |
|
|
}); |
|
|
return; |
|
|
} |
|
|
if (BI.isNotNull(value)) { |
|
|
return this.options[key] = value; |
|
|
} |
|
|
return this.options[key]; |
|
|
}, |
|
|
|
|
|
getText: function () { |
|
|
|
|
|
}, |
|
|
|
|
|
setText: function (text) { |
|
|
|
|
|
}, |
|
|
|
|
|
getValue: function () { |
|
|
|
|
|
}, |
|
|
|
|
|
setValue: function (value) { |
|
|
|
|
|
}, |
|
|
|
|
|
isEnabled: function () { |
|
|
return !this.options.disabled; |
|
|
}, |
|
|
|
|
|
isVisible: function () { |
|
|
return !this.options.invisible; |
|
|
}, |
|
|
|
|
|
disable: function () { |
|
|
this.setEnable(false); |
|
|
}, |
|
|
|
|
|
enable: function () { |
|
|
this.setEnable(true); |
|
|
}, |
|
|
|
|
|
valid: function () { |
|
|
this.setValid(true); |
|
|
}, |
|
|
|
|
|
invalid: function () { |
|
|
this.setValid(false); |
|
|
}, |
|
|
|
|
|
invisible: function () { |
|
|
this.setVisible(false); |
|
|
}, |
|
|
|
|
|
visible: function () { |
|
|
this.setVisible(true); |
|
|
}, |
|
|
|
|
|
__d: function () { |
|
|
this.beforeDestroy && this.beforeDestroy(); |
|
|
BI.each(this._children, function (i, widget) { |
|
|
widget && widget._unMount && widget._unMount(); |
|
|
}); |
|
|
this._children = {}; |
|
|
this._parent = null; |
|
|
this._isMounted = false; |
|
|
this.destroyed && this.destroyed(); |
|
|
}, |
|
|
|
|
|
_unMount: function () { |
|
|
this.__d(); |
|
|
this.fireEvent(BI.Events.UNMOUNT); |
|
|
this.purgeListeners(); |
|
|
}, |
|
|
|
|
|
isolate: function () { |
|
|
if (this._parent) { |
|
|
this._parent.removeWidget(this); |
|
|
} |
|
|
BI.DOM.hang([this]); |
|
|
}, |
|
|
|
|
|
empty: function () { |
|
|
BI.each(this._children, function (i, widget) { |
|
|
widget && widget._unMount && widget._unMount(); |
|
|
}); |
|
|
this._children = {}; |
|
|
this.element.empty(); |
|
|
}, |
|
|
|
|
|
_destroy: function () { |
|
|
this.__d(); |
|
|
this.element.destroy(); |
|
|
this.purgeListeners(); |
|
|
}, |
|
|
|
|
|
destroy: function () { |
|
|
this.__d(); |
|
|
this.element.destroy(); |
|
|
this.fireEvent(BI.Events.DESTROY); |
|
|
this._purgeRef(); |
|
|
this.purgeListeners(); |
|
|
} |
|
|
});(function () { |
|
|
var kv = {}; |
|
|
BI.shortcut = function (xtype, cls) { |
|
|
if (kv[xtype] != null) { |
|
|
throw ("shortcut:[" + xtype + "] has been registed"); |
|
|
} |
|
|
kv[xtype] = cls; |
|
|
}; |
|
|
|
|
|
// 根据配置属性生成widget |
|
|
var createWidget = function (config) { |
|
|
if (config["classType"]) { |
|
|
return new (new Function("return " + config["classType"] + ";")())(config); |
|
|
} |
|
|
|
|
|
var cls = kv[config.type]; |
|
|
return new cls(config); |
|
|
}; |
|
|
|
|
|
BI.createWidget = function (item, options, context) { |
|
|
var el, w; |
|
|
item || (item = {}); |
|
|
if (BI.isWidget(options)) { |
|
|
context = options; |
|
|
options = {}; |
|
|
} else { |
|
|
options || (options = {}); |
|
|
} |
|
|
if (BI.isEmpty(item) && BI.isEmpty(options)) { |
|
|
return BI.createWidget({ |
|
|
type: "bi.layout" |
|
|
}); |
|
|
} |
|
|
if (BI.isWidget(item)) { |
|
|
return item; |
|
|
} |
|
|
if (item.type || options.type) { |
|
|
el = BI.extend({}, options, item); |
|
|
w = BI.Plugin.getWidget(el.type, el); |
|
|
return w.type === el.type ? BI.Plugin.getObject(el.type, createWidget(w)) : BI.createWidget(BI.extend({}, item, {type: w.type}, options)); |
|
|
} |
|
|
if (item.el && (item.el.type || options.type)) { |
|
|
el = BI.extend({}, options, item.el); |
|
|
w = BI.Plugin.getWidget(el.type, el); |
|
|
return w.type === el.type ? BI.Plugin.getObject(el.type, createWidget(w)) : BI.createWidget(BI.extend({}, item, {type: w.type}, options)); |
|
|
} |
|
|
if (BI.isWidget(item.el)) { |
|
|
return item.el; |
|
|
} |
|
|
throw new Error("无法根据item创建组件"); |
|
|
}; |
|
|
|
|
|
})();(function (window, undefined) { |
|
|
function aspect (type) { |
|
|
return function (target, methodName, advice) { |
|
|
var exist = target[methodName], |
|
|
dispatcher; |
|
|
|
|
|
if (!exist || exist.target != target) { |
|
|
dispatcher = target[methodName] = function () { |
|
|
// before methods |
|
|
var beforeArr = dispatcher.before; |
|
|
var args = arguments, next; |
|
|
for (var l = beforeArr.length; l--;) { |
|
|
next = beforeArr[l].advice.apply(this, args); |
|
|
if (next === false) { |
|
|
return false; |
|
|
} |
|
|
args = next || args; |
|
|
} |
|
|
// target method |
|
|
var rs = dispatcher.method.apply(this, args); |
|
|
// after methods |
|
|
var afterArr = dispatcher.after; |
|
|
for (var i = 0, ii = afterArr.length; i < ii; i++) { |
|
|
next = afterArr[i].advice.call(this, rs, args); |
|
|
if (rs === false) { |
|
|
return false; |
|
|
} |
|
|
args = next || args; |
|
|
} |
|
|
return rs; |
|
|
}; |
|
|
|
|
|
dispatcher.before = []; |
|
|
dispatcher.after = []; |
|
|
|
|
|
if (exist) { |
|
|
dispatcher.method = exist; |
|
|
} |
|
|
dispatcher.target = target; |
|
|
} |
|
|
|
|
|
var aspectArr = (dispatcher || exist)[type]; |
|
|
var obj = { |
|
|
advice: advice, |
|
|
_index: aspectArr.length, |
|
|
remove: function () { |
|
|
aspectArr.splice(this._index, 1); |
|
|
} |
|
|
}; |
|
|
aspectArr.push(obj); |
|
|
|
|
|
return obj; |
|
|
}; |
|
|
} |
|
|
|
|
|
BI.aspect = { |
|
|
before: aspect("before"), |
|
|
after: aspect("after") |
|
|
}; |
|
|
|
|
|
return BI.aspect; |
|
|
|
|
|
})(window); |
|
|
!(function () { |
|
|
|
|
|
var _keyStr = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/="; |
|
|
|
|
|
|
|
|
// private method for UTF-8 encoding |
|
|
var _utf8_encode = function (string) { |
|
|
string = string.replace(/\r\n/g, "\n"); |
|
|
var utftext = ""; |
|
|
|
|
|
for (var n = 0; n < string.length; n++) { |
|
|
|
|
|
var c = string.charCodeAt(n); |
|
|
|
|
|
if (c < 128) { |
|
|
utftext += String.fromCharCode(c); |
|
|
} else if ((c > 127) && (c < 2048)) { |
|
|
utftext += String.fromCharCode((c >> 6) | 192); |
|
|
utftext += String.fromCharCode((c & 63) | 128); |
|
|
} else { |
|
|
utftext += String.fromCharCode((c >> 12) | 224); |
|
|
utftext += String.fromCharCode(((c >> 6) & 63) | 128); |
|
|
utftext += String.fromCharCode((c & 63) | 128); |
|
|
} |
|
|
|
|
|
} |
|
|
|
|
|
return utftext; |
|
|
}; |
|
|
|
|
|
// private method for UTF-8 decoding |
|
|
var _utf8_decode = function (utftext) { |
|
|
var string = ""; |
|
|
var i = 0; |
|
|
var c = 0, c3 = 0, c2 = 0; |
|
|
|
|
|
while (i < utftext.length) { |
|
|
|
|
|
c = utftext.charCodeAt(i); |
|
|
|
|
|
if (c < 128) { |
|
|
string += String.fromCharCode(c); |
|
|
i++; |
|
|
} else if ((c > 191) && (c < 224)) { |
|
|
c2 = utftext.charCodeAt(i + 1); |
|
|
string += String.fromCharCode(((c & 31) << 6) | (c2 & 63)); |
|
|
i += 2; |
|
|
} else { |
|
|
c2 = utftext.charCodeAt(i + 1); |
|
|
c3 = utftext.charCodeAt(i + 2); |
|
|
string += String.fromCharCode(((c & 15) << 12) | ((c2 & 63) << 6) | (c3 & 63)); |
|
|
i += 3; |
|
|
} |
|
|
|
|
|
} |
|
|
return string; |
|
|
}; |
|
|
|
|
|
_.extend(BI, { |
|
|
|
|
|
encode: function (input) { |
|
|
var output = ""; |
|
|
var chr1, chr2, chr3, enc1, enc2, enc3, enc4; |
|
|
var i = 0; |
|
|
|
|
|
input = _utf8_encode(input); |
|
|
|
|
|
while (i < input.length) { |
|
|
|
|
|
chr1 = input.charCodeAt(i++); |
|
|
chr2 = input.charCodeAt(i++); |
|
|
chr3 = input.charCodeAt(i++); |
|
|
|
|
|
enc1 = chr1 >> 2; |
|
|
enc2 = ((chr1 & 3) << 4) | (chr2 >> 4); |
|
|
enc3 = ((chr2 & 15) << 2) | (chr3 >> 6); |
|
|
enc4 = chr3 & 63; |
|
|
|
|
|
if (isNaN(chr2)) { |
|
|
enc3 = enc4 = 64; |
|
|
} else if (isNaN(chr3)) { |
|
|
enc4 = 64; |
|
|
} |
|
|
|
|
|
output = output + _keyStr.charAt(enc1) + _keyStr.charAt(enc2) + _keyStr.charAt(enc3) + _keyStr.charAt(enc4); |
|
|
|
|
|
} |
|
|
|
|
|
return output; |
|
|
}, |
|
|
|
|
|
// public method for decoding |
|
|
decode: function (input) { |
|
|
var output = ""; |
|
|
var chr1, chr2, chr3; |
|
|
var enc1, enc2, enc3, enc4; |
|
|
var i = 0; |
|
|
|
|
|
input = input.replace(/[^A-Za-z0-9\+\/\=]/g, ""); |
|
|
|
|
|
while (i < input.length) { |
|
|
|
|
|
enc1 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc2 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc3 = _keyStr.indexOf(input.charAt(i++)); |
|
|
enc4 = _keyStr.indexOf(input.charAt(i++)); |
|
|
|
|
|
chr1 = (enc1 << 2) | (enc2 >> 4); |
|
|
chr2 = ((enc2 & 15) << 4) | (enc3 >> 2); |
|
|
chr3 = ((enc3 & 3) << 6) | enc4; |
|
|
|
|
|
output = output + String.fromCharCode(chr1); |
|
|
|
|
|
if (enc3 != 64) { |
|
|
output = output + String.fromCharCode(chr2); |
|
|
} |
|
|
if (enc4 != 64) { |
|
|
output = output + String.fromCharCode(chr3); |
|
|
} |
|
|
|
|
|
} |
|
|
|
|
|
output = _utf8_decode(output); |
|
|
|
|
|
return output; |
|
|
|
|
|
} |
|
|
}); |
|
|
})(); |
|
|
BI.Cache = { |
|
|
_prefix: "bi", |
|
|
setUsername: function (username) { |
|
|
localStorage.setItem(BI.Cache._prefix + ".username", (username + "" || "").toUpperCase()); |
|
|
}, |
|
|
getUsername: function () { |
|
|
return localStorage.getItem(BI.Cache._prefix + ".username") || ""; |
|
|
}, |
|
|
_getKeyPrefix: function () { |
|
|
return BI.Cache.getUsername() + "." + BI.Cache._prefix + "."; |
|
|
}, |
|
|
_generateKey: function (key) { |
|
|
return BI.Cache._getKeyPrefix() + (key || ""); |
|
|
}, |
|
|
getItem: function (key) { |
|
|
return localStorage.getItem(BI.Cache._generateKey(key)); |
|
|
}, |
|
|
setItem: function (key, value) { |
|
|
localStorage.setItem(BI.Cache._generateKey(key), value); |
|
|
}, |
|
|
removeItem: function (key) { |
|
|
localStorage.removeItem(BI.Cache._generateKey(key)); |
|
|
}, |
|
|
clear: function () { |
|
|
for (var i = localStorage.length; i >= 0; i--) { |
|
|
var key = localStorage.key(i); |
|
|
if (key) { |
|
|
if (key.indexOf(BI.Cache._getKeyPrefix()) === 0) { |
|
|
localStorage.removeItem(key); |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
keys: function () { |
|
|
var result = []; |
|
|
for (var i = localStorage.length; i >= 0; i--) { |
|
|
var key = localStorage.key(i); |
|
|
if (key) { |
|
|
var prefix = BI.Cache._getKeyPrefix(); |
|
|
if (key.indexOf(prefix) === 0) { |
|
|
result[result.length] = key.substring(prefix.length); |
|
|
} |
|
|
} |
|
|
} |
|
|
return result; |
|
|
}, |
|
|
|
|
|
addCookie: function (name, value, path, expiresHours) { |
|
|
var cookieString = name + "=" + escape(value); |
|
|
// 判断是否设置过期时间 |
|
|
if (expiresHours && expiresHours > 0) { |
|
|
var date = new Date(); |
|
|
date.setTime(BI.getTime() + expiresHours * 3600 * 1000); |
|
|
cookieString = cookieString + "; expires=" + date.toGMTString(); |
|
|
} |
|
|
if (path) { |
|
|
cookieString = cookieString + "; path=" + path; |
|
|
} |
|
|
document.cookie = cookieString; |
|
|
}, |
|
|
getCookie: function (name) { |
|
|
var arr, reg = new RegExp("(^| )" + name + "=([^;]*)(;|$)"); |
|
|
if (arr = document.cookie.match(reg)) {return unescape(arr[2]);} |
|
|
return null; |
|
|
}, |
|
|
deleteCookie: function (name, path) { |
|
|
var date = new Date(); |
|
|
date.setTime(BI.getTime() - 10000); |
|
|
var cookieString = name + "=v; expires=" + date.toGMTString(); |
|
|
if (path) { |
|
|
cookieString = cookieString + "; path=" + path; |
|
|
} |
|
|
document.cookie = cookieString; |
|
|
} |
|
|
};BI.CellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize) { |
|
|
this._cellSizeGetter = cellSizeGetter; |
|
|
this._cellCount = cellCount; |
|
|
this._estimatedCellSize = estimatedCellSize; |
|
|
this._cellSizeAndPositionData = {}; |
|
|
this._lastMeasuredIndex = -1; |
|
|
}; |
|
|
|
|
|
BI.CellSizeAndPositionManager.prototype = { |
|
|
constructor: BI.CellSizeAndPositionManager, |
|
|
configure: function (cellCount, estimatedCellSize) { |
|
|
this._cellCount = cellCount; |
|
|
this._estimatedCellSize = estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getCellCount: function () { |
|
|
return this._cellCount; |
|
|
}, |
|
|
|
|
|
getEstimatedCellSize: function () { |
|
|
return this._estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getLastMeasuredIndex: function () { |
|
|
return this._lastMeasuredIndex; |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfCell: function (index) { |
|
|
if (index < 0 || index >= this._cellCount) { |
|
|
return; |
|
|
} |
|
|
if (index > this._lastMeasuredIndex) { |
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
var offset = lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size; |
|
|
|
|
|
for (var i = this._lastMeasuredIndex + 1; i <= index; i++) { |
|
|
var size = this._cellSizeGetter(i); |
|
|
|
|
|
if (size == null || isNaN(size)) { |
|
|
continue; |
|
|
} |
|
|
|
|
|
this._cellSizeAndPositionData[i] = { |
|
|
offset: offset, |
|
|
size: size |
|
|
}; |
|
|
|
|
|
offset += size; |
|
|
} |
|
|
|
|
|
this._lastMeasuredIndex = index; |
|
|
} |
|
|
return this._cellSizeAndPositionData[index]; |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfLastMeasuredCell: function () { |
|
|
return this._lastMeasuredIndex >= 0 |
|
|
? this._cellSizeAndPositionData[this._lastMeasuredIndex] |
|
|
: { |
|
|
offset: 0, |
|
|
size: 0 |
|
|
}; |
|
|
}, |
|
|
|
|
|
getTotalSize: function () { |
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
return lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size + (this._cellCount - this._lastMeasuredIndex - 1) * this._estimatedCellSize; |
|
|
}, |
|
|
|
|
|
getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) { |
|
|
var datum = this.getSizeAndPositionOfCell(targetIndex); |
|
|
var maxOffset = datum.offset; |
|
|
var minOffset = maxOffset - containerSize + datum.size; |
|
|
|
|
|
var idealOffset; |
|
|
|
|
|
switch (align) { |
|
|
case "start": |
|
|
idealOffset = maxOffset; |
|
|
break; |
|
|
case "end": |
|
|
idealOffset = minOffset; |
|
|
break; |
|
|
case "center": |
|
|
idealOffset = maxOffset - ((containerSize - datum.size) / 2); |
|
|
break; |
|
|
default: |
|
|
idealOffset = Math.max(minOffset, Math.min(maxOffset, currentOffset)); |
|
|
break; |
|
|
} |
|
|
|
|
|
var totalSize = this.getTotalSize(); |
|
|
|
|
|
return Math.max(0, Math.min(totalSize - containerSize, idealOffset)); |
|
|
}, |
|
|
|
|
|
getVisibleCellRange: function (containerSize, offset) { |
|
|
var totalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === 0) { |
|
|
return {}; |
|
|
} |
|
|
|
|
|
var maxOffset = offset + containerSize; |
|
|
var start = this._findNearestCell(offset); |
|
|
|
|
|
var datum = this.getSizeAndPositionOfCell(start); |
|
|
offset = datum.offset + datum.size; |
|
|
|
|
|
var stop = start; |
|
|
|
|
|
while (offset < maxOffset && stop < this._cellCount - 1) { |
|
|
stop++; |
|
|
offset += this.getSizeAndPositionOfCell(stop).size; |
|
|
} |
|
|
|
|
|
return { |
|
|
start: start, |
|
|
stop: stop |
|
|
}; |
|
|
}, |
|
|
|
|
|
resetCell: function (index) { |
|
|
this._lastMeasuredIndex = Math.min(this._lastMeasuredIndex, index - 1); |
|
|
}, |
|
|
|
|
|
_binarySearch: function (high, low, offset) { |
|
|
var middle; |
|
|
var currentOffset; |
|
|
|
|
|
while (low <= high) { |
|
|
middle = low + Math.floor((high - low) / 2); |
|
|
currentOffset = this.getSizeAndPositionOfCell(middle).offset; |
|
|
|
|
|
if (currentOffset === offset) { |
|
|
return middle; |
|
|
} else if (currentOffset < offset) { |
|
|
low = middle + 1; |
|
|
} else if (currentOffset > offset) { |
|
|
high = middle - 1; |
|
|
} |
|
|
} |
|
|
|
|
|
if (low > 0) { |
|
|
return low - 1; |
|
|
} |
|
|
}, |
|
|
|
|
|
_exponentialSearch: function (index, offset) { |
|
|
var interval = 1; |
|
|
|
|
|
while (index < this._cellCount && this.getSizeAndPositionOfCell(index).offset < offset) { |
|
|
index += interval; |
|
|
interval *= 2; |
|
|
} |
|
|
|
|
|
return this._binarySearch(Math.min(index, this._cellCount - 1), Math.floor(index / 2), offset); |
|
|
}, |
|
|
|
|
|
_findNearestCell: function (offset) { |
|
|
if (isNaN(offset)) { |
|
|
return; |
|
|
} |
|
|
|
|
|
offset = Math.max(0, offset); |
|
|
|
|
|
var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell(); |
|
|
var lastMeasuredIndex = Math.max(0, this._lastMeasuredIndex); |
|
|
|
|
|
if (lastMeasuredCellSizeAndPosition.offset >= offset) { |
|
|
return this._binarySearch(lastMeasuredIndex, 0, offset); |
|
|
} |
|
|
return this._exponentialSearch(lastMeasuredIndex, offset); |
|
|
|
|
|
} |
|
|
}; |
|
|
|
|
|
BI.ScalingCellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize, maxScrollSize) { |
|
|
this._cellSizeAndPositionManager = new BI.CellSizeAndPositionManager(cellCount, cellSizeGetter, estimatedCellSize); |
|
|
this._maxScrollSize = maxScrollSize || 10000000; |
|
|
}; |
|
|
|
|
|
BI.ScalingCellSizeAndPositionManager.prototype = { |
|
|
constructor: BI.ScalingCellSizeAndPositionManager, |
|
|
|
|
|
configure: function () { |
|
|
this._cellSizeAndPositionManager.configure.apply(this._cellSizeAndPositionManager, arguments); |
|
|
}, |
|
|
|
|
|
getCellCount: function () { |
|
|
return this._cellSizeAndPositionManager.getCellCount(); |
|
|
}, |
|
|
|
|
|
getEstimatedCellSize: function () { |
|
|
return this._cellSizeAndPositionManager.getEstimatedCellSize(); |
|
|
}, |
|
|
|
|
|
getLastMeasuredIndex: function () { |
|
|
return this._cellSizeAndPositionManager.getLastMeasuredIndex(); |
|
|
}, |
|
|
|
|
|
getOffsetAdjustment: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (safeTotalSize - totalSize)); |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfCell: function (index) { |
|
|
return this._cellSizeAndPositionManager.getSizeAndPositionOfCell(index); |
|
|
}, |
|
|
|
|
|
getSizeAndPositionOfLastMeasuredCell: function () { |
|
|
return this._cellSizeAndPositionManager.getSizeAndPositionOfLastMeasuredCell(); |
|
|
}, |
|
|
|
|
|
getTotalSize: function () { |
|
|
return Math.min(this._maxScrollSize, this._cellSizeAndPositionManager.getTotalSize()); |
|
|
}, |
|
|
|
|
|
getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) { |
|
|
currentOffset = this._safeOffsetToOffset(containerSize, currentOffset); |
|
|
|
|
|
var offset = this._cellSizeAndPositionManager.getUpdatedOffsetForIndex(align, containerSize, currentOffset, targetIndex); |
|
|
|
|
|
return this._offsetToSafeOffset(containerSize, offset); |
|
|
}, |
|
|
|
|
|
getVisibleCellRange: function (containerSize, offset) { |
|
|
offset = this._safeOffsetToOffset(containerSize, offset); |
|
|
|
|
|
return this._cellSizeAndPositionManager.getVisibleCellRange(containerSize, offset); |
|
|
}, |
|
|
|
|
|
resetCell: function (index) { |
|
|
this._cellSizeAndPositionManager.resetCell(index); |
|
|
}, |
|
|
|
|
|
_getOffsetPercentage: function (containerSize, offset, totalSize) { |
|
|
return totalSize <= containerSize |
|
|
? 0 |
|
|
: offset / (totalSize - containerSize); |
|
|
}, |
|
|
|
|
|
_offsetToSafeOffset: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === safeTotalSize) { |
|
|
return offset; |
|
|
} |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, totalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (safeTotalSize - containerSize)); |
|
|
|
|
|
}, |
|
|
|
|
|
_safeOffsetToOffset: function (containerSize, offset) { |
|
|
var totalSize = this._cellSizeAndPositionManager.getTotalSize(); |
|
|
var safeTotalSize = this.getTotalSize(); |
|
|
|
|
|
if (totalSize === safeTotalSize) { |
|
|
return offset; |
|
|
} |
|
|
var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize); |
|
|
|
|
|
return Math.round(offsetPercentage * (totalSize - containerSize)); |
|
|
|
|
|
} |
|
|
};/** |
|
|
* 汉字拼音索引 |
|
|
*/ |
|
|
|
|
|
!(function () { |
|
|
var _ChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY"; |
|
|
|
|
|
// 此处收录了375个多音字,数据来自于http://www.51window.net/page/pinyin |
|
|
var oMultiDiff = { |
|
|
19969: "DZ", |
|
|
19975: "WM", |
|
|
19988: "QJ", |
|
|
20048: "YL", |
|
|
20056: "SC", |
|
|
20060: "NM", |
|
|
20094: "QG", |
|
|
20127: "QJ", |
|
|
20167: "QC", |
|
|
20193: "YG", |
|
|
20250: "KH", |
|
|
20256: "ZC", |
|
|
20282: "SC", |
|
|
20285: "QJG", |
|
|
20291: "TD", |
|
|
20314: "YD", |
|
|
20315: "BF", |
|
|
20340: "NE", |
|
|
20375: "TD", |
|
|
20389: "YJ", |
|
|
20391: "CZ", |
|
|
20415: "PB", |
|
|
20446: "YS", |
|
|
20447: "SQ", |
|
|
20504: "TC", |
|
|
20608: "KG", |
|
|
20854: "QJ", |
|
|
20857: "ZC", |
|
|
20911: "PF", |
|
|
20985: "AW", |
|
|
21032: "PB", |
|
|
21048: "XQ", |
|
|
21049: "SC", |
|
|
21089: "YS", |
|
|
21119: "JC", |
|
|
21242: "SB", |
|
|
21273: "SC", |
|
|
21305: "YP", |
|
|
21306: "QO", |
|
|
21330: "ZC", |
|
|
21333: "SDC", |
|
|
21345: "QK", |
|
|
21378: "CA", |
|
|
21397: "SC", |
|
|
21414: "XS", |
|
|
21442: "SC", |
|
|
21477: "JG", |
|
|
21480: "TD", |
|
|
21484: "ZS", |
|
|
21494: "YX", |
|
|
21505: "YX", |
|
|
21512: "HG", |
|
|
21523: "XH", |
|
|
21537: "PB", |
|
|
21542: "PF", |
|
|
21549: "KH", |
|
|
21571: "E", |
|
|
21574: "DA", |
|
|
21588: "TD", |
|
|
21589: "O", |
|
|
21618: "ZC", |
|
|
21621: "KHA", |
|
|
21632: "ZJ", |
|
|
21654: "KG", |
|
|
21679: "LKG", |
|
|
21683: "KH", |
|
|
21710: "A", |
|
|
21719: "YH", |
|
|
21734: "WOE", |
|
|
21769: "A", |
|
|
21780: "WN", |
|
|
21804: "XH", |
|
|
21834: "A", |
|
|
21899: "ZD", |
|
|
21903: "RN", |
|
|
21908: "WO", |
|
|
21939: "ZC", |
|
|
21956: "SA", |
|
|
21964: "YA", |
|
|
21970: "TD", |
|
|
22003: "A", |
|
|
22031: "JG", |
|
|
22040: "XS", |
|
|
22060: "ZC", |
|
|
22066: "ZC", |
|
|
22079: "MH", |
|
|
22129: "XJ", |
|
|
22179: "XA", |
|
|
22237: "NJ", |
|
|
22244: "TD", |
|
|
22280: "JQ", |
|
|
22300: "YH", |
|
|
22313: "XW", |
|
|
22331: "YQ", |
|
|
22343: "YJ", |
|
|
22351: "PH", |
|
|
22395: "DC", |
|
|
22412: "TD", |
|
|
22484: "PB", |
|
|
22500: "PB", |
|
|
22534: "ZD", |
|
|
22549: "DH", |
|
|
22561: "PB", |
|
|
22612: "TD", |
|
|
22771: "KQ", |
|
|
22831: "HB", |
|
|
22841: "JG", |
|
|
22855: "QJ", |
|
|
22865: "XQ", |
|
|
23013: "ML", |
|
|
23081: "WM", |
|
|
23487: "SX", |
|
|
23558: "QJ", |
|
|
23561: "YW", |
|
|
23586: "YW", |
|
|
23614: "YW", |
|
|
23615: "SN", |
|
|
23631: "PB", |
|
|
23646: "ZS", |
|
|
23663: "ZT", |
|
|
23673: "YG", |
|
|
23762: "TD", |
|
|
23769: "ZS", |
|
|
23780: "QJ", |
|
|
23884: "QK", |
|
|
24055: "XH", |
|
|
24113: "DC", |
|
|
24162: "ZC", |
|
|
24191: "GA", |
|
|
24273: "QJ", |
|
|
24324: "NL", |
|
|
24377: "TD", |
|
|
24378: "QJ", |
|
|
24439: "PF", |
|
|
24554: "ZS", |
|
|
24683: "TD", |
|
|
24694: "WE", |
|
|
24733: "LK", |
|
|
24925: "TN", |
|
|
25094: "ZG", |
|
|
25100: "XQ", |
|
|
25103: "XH", |
|
|
25153: "PB", |
|
|
25170: "PB", |
|
|
25179: "KG", |
|
|
25203: "PB", |
|
|
25240: "ZS", |
|
|
25282: "FB", |
|
|
25303: "NA", |
|
|
25324: "KG", |
|
|
25341: "ZY", |
|
|
25373: "WZ", |
|
|
25375: "XJ", |
|
|
25384: "A", |
|
|
25457: "A", |
|
|
25528: "SD", |
|
|
25530: "SC", |
|
|
25552: "TD", |
|
|
25774: "ZC", |
|
|
25874: "ZC", |
|
|
26044: "YW", |
|
|
26080: "WM", |
|
|
26292: "PB", |
|
|
26333: "PB", |
|
|
26355: "ZY", |
|
|
26366: "CZ", |
|
|
26397: "ZC", |
|
|
26399: "QJ", |
|
|
26415: "ZS", |
|
|
26451: "SB", |
|
|
26526: "ZC", |
|
|
26552: "JG", |
|
|
26561: "TD", |
|
|
26588: "JG", |
|
|
26597: "CZ", |
|
|
26629: "ZS", |
|
|
26638: "YL", |
|
|
26646: "XQ", |
|
|
26653: "KG", |
|
|
26657: "XJ", |
|
|
26727: "HG", |
|
|
26894: "ZC", |
|
|
26937: "ZS", |
|
|
26946: "ZC", |
|
|
26999: "KJ", |
|
|
27099: "KJ", |
|
|
27449: "YQ", |
|
|
27481: "XS", |
|
|
27542: "ZS", |
|
|
27663: "ZS", |
|
|
27748: "TS", |
|
|
27784: "SC", |
|
|
27788: "ZD", |
|
|
27795: "TD", |
|
|
27812: "O", |
|
|
27850: "PB", |
|
|
27852: "MB", |
|
|
27895: "SL", |
|
|
27898: "PL", |
|
|
27973: "QJ", |
|
|
27981: "KH", |
|
|
27986: "HX", |
|
|
27994: "XJ", |
|
|
28044: "YC", |
|
|
28065: "WG", |
|
|
28177: "SM", |
|
|
28267: "QJ", |
|
|
28291: "KH", |
|
|
28337: "ZQ", |
|
|
28463: "TL", |
|
|
28548: "DC", |
|
|
28601: "TD", |
|
|
28689: "PB", |
|
|
28805: "JG", |
|
|
28820: "QG", |
|
|
28846: "PB", |
|
|
28952: "TD", |
|
|
28975: "ZC", |
|
|
29100: "A", |
|
|
29325: "QJ", |
|
|
29575: "SL", |
|
|
29602: "FB", |
|
|
30010: "TD", |
|
|
30044: "CX", |
|
|
30058: "PF", |
|
|
30091: "YSP", |
|
|
30111: "YN", |
|
|
30229: "XJ", |
|
|
30427: "SC", |
|
|
30465: "SX", |
|
|
30631: "YQ", |
|
|
30655: "QJ", |
|
|
30684: "QJG", |
|
|
30707: "SD", |
|
|
30729: "XH", |
|
|
30796: "LG", |
|
|
30917: "PB", |
|
|
31074: "NM", |
|
|
31085: "JZ", |
|
|
31109: "SC", |
|
|
31181: "ZC", |
|
|
31192: "MLB", |
|
|
31293: "JQ", |
|
|
31400: "YX", |
|
|
31584: "YJ", |
|
|
31896: "ZN", |
|
|
31909: "ZY", |
|
|
31995: "XJ", |
|
|
32321: "PF", |
|
|
32327: "ZY", |
|
|
32418: "HG", |
|
|
32420: "XQ", |
|
|
32421: "HG", |
|
|
32438: "LG", |
|
|
32473: "GJ", |
|
|
32488: "TD", |
|
|
32521: "QJ", |
|
|
32527: "PB", |
|
|
32562: "ZSQ", |
|
|
32564: "JZ", |
|
|
32735: "ZD", |
|
|
32793: "PB", |
|
|
33071: "PF", |
|
|
33098: "XL", |
|
|
33100: "YA", |
|
|
33152: "PB", |
|
|
33261: "CX", |
|
|
33324: "BP", |
|
|
33333: "TD", |
|
|
33406: "YA", |
|
|
33426: "WM", |
|
|
33432: "PB", |
|
|
33445: "JG", |
|
|
33486: "ZN", |
|
|
33493: "TS", |
|
|
33507: "QJ", |
|
|
33540: "QJ", |
|
|
33544: "ZC", |
|
|
33564: "XQ", |
|
|
33617: "YT", |
|
|
33632: "QJ", |
|
|
33636: "XH", |
|
|
33637: "YX", |
|
|
33694: "WG", |
|
|
33705: "PF", |
|
|
33728: "YW", |
|
|
33882: "SR", |
|
|
34067: "WM", |
|
|
34074: "YW", |
|
|
34121: "QJ", |
|
|
34255: "ZC", |
|
|
34259: "XL", |
|
|
34425: "JH", |
|
|
34430: "XH", |
|
|
34485: "KH", |
|
|
34503: "YS", |
|
|
34532: "HG", |
|
|
34552: "XS", |
|
|
34558: "YE", |
|
|
34593: "ZL", |
|
|
34660: "YQ", |
|
|
34892: "XH", |
|
|
34928: "SC", |
|
|
34999: "QJ", |
|
|
35048: "PB", |
|
|
35059: "SC", |
|
|
35098: "ZC", |
|
|
35203: "TQ", |
|
|
35265: "JX", |
|
|
35299: "JX", |
|
|
35782: "SZ", |
|
|
35828: "YS", |
|
|
35830: "E", |
|
|
35843: "TD", |
|
|
35895: "YG", |
|
|
35977: "MH", |
|
|
36158: "JG", |
|
|
36228: "QJ", |
|
|
36426: "XQ", |
|
|
36466: "DC", |
|
|
36710: "JC", |
|
|
36711: "ZYG", |
|
|
36767: "PB", |
|
|
36866: "SK", |
|
|
36951: "YW", |
|
|
37034: "YX", |
|
|
37063: "XH", |
|
|
37218: "ZC", |
|
|
37325: "ZC", |
|
|
38063: "PB", |
|
|
38079: "TD", |
|
|
38085: "QY", |
|
|
38107: "DC", |
|
|
38116: "TD", |
|
|
38123: "YD", |
|
|
38224: "HG", |
|
|
38241: "XTC", |
|
|
38271: "ZC", |
|
|
38415: "YE", |
|
|
38426: "KH", |
|
|
38461: "YD", |
|
|
38463: "AE", |
|
|
38466: "PB", |
|
|
38477: "XJ", |
|
|
38518: "YT", |
|
|
38551: "WK", |
|
|
38585: "ZC", |
|
|
38704: "XS", |
|
|
38739: "LJ", |
|
|
38761: "GJ", |
|
|
38808: "SQ", |
|
|
39048: "JG", |
|
|
39049: "XJ", |
|
|
39052: "HG", |
|
|
39076: "CZ", |
|
|
39271: "XT", |
|
|
39534: "TD", |
|
|
39552: "TD", |
|
|
39584: "PB", |
|
|
39647: "SB", |
|
|
39730: "LG", |
|
|
39748: "TPB", |
|
|
40109: "ZQ", |
|
|
40479: "ND", |
|
|
40516: "HG", |
|
|
40536: "HG", |
|
|
40583: "QJ", |
|
|
40765: "YQ", |
|
|
40784: "QJ", |
|
|
40840: "YK", |
|
|
40863: "QJG" |
|
|
}; |
|
|
|
|
|
var _checkPYCh = function (ch) { |
|
|
var uni = ch.charCodeAt(0); |
|
|
// 如果不在汉字处理范围之内,返回原字符,也可以调用自己的处理函数 |
|
|
if (uni > 40869 || uni < 19968) {return ch;} // dealWithOthers(ch); |
|
|
return (oMultiDiff[uni] ? oMultiDiff[uni] : (_ChineseFirstPY.charAt(uni - 19968))); |
|
|
}; |
|
|
|
|
|
var _mkPYRslt = function (arr) { |
|
|
var arrRslt = [""], k; |
|
|
for (var i = 0, len = arr.length; i < len; i++) { |
|
|
var str = arr[i]; |
|
|
var strlen = str.length; |
|
|
if (strlen == 1) { |
|
|
for (k = 0; k < arrRslt.length; k++) { |
|
|
arrRslt[k] += str; |
|
|
} |
|
|
} else { |
|
|
var tmpArr = arrRslt.slice(0); |
|
|
arrRslt = []; |
|
|
for (k = 0; k < strlen; k++) { |
|
|
// 复制一个相同的arrRslt |
|
|
var tmp = tmpArr.slice(0); |
|
|
// 把当前字符str[k]添加到每个元素末尾 |
|
|
for (var j = 0; j < tmp.length; j++) { |
|
|
tmp[j] += str.charAt(k); |
|
|
} |
|
|
// 把复制并修改后的数组连接到arrRslt上 |
|
|
arrRslt = arrRslt.concat(tmp); |
|
|
} |
|
|
} |
|
|
} |
|
|
return arrRslt.join("").toLowerCase(); |
|
|
}; |
|
|
|
|
|
_.extend(BI, { |
|
|
makeFirstPY: function (str) { |
|
|
if (typeof (str) !== "string") {return "" + str;} |
|
|
var arrResult = []; // 保存中间结果的数组 |
|
|
for (var i = 0, len = str.length; i < len; i++) { |
|
|
// 获得unicode码 |
|
|
var ch = str.charAt(i); |
|
|
// 检查该unicode码是否在处理范围之内,在则返回该码对映汉字的拼音首字母,不在则调用其它函数处理 |
|
|
arrResult.push(_checkPYCh(ch)); |
|
|
} |
|
|
// 处理arrResult,返回所有可能的拼音首字母串数组 |
|
|
return _mkPYRslt(arrResult); |
|
|
} |
|
|
}); |
|
|
})();/** |
|
|
* Detect Element Resize. |
|
|
* Forked in order to guard against unsafe 'window' and 'document' references. |
|
|
* |
|
|
* https://github.com/sdecima/javascript-detect-element-resize |
|
|
* Sebastian Decima |
|
|
* |
|
|
* version: 0.5.3 |
|
|
**/ |
|
|
!(function () { |
|
|
// Check `document` and `window` in case of server-side rendering |
|
|
var _window; |
|
|
if (typeof window !== "undefined") { |
|
|
_window = window; |
|
|
} else if (typeof self !== "undefined") { |
|
|
_window = self; |
|
|
} else { |
|
|
_window = this; |
|
|
} |
|
|
|
|
|
var addEventListener = typeof document !== "undefined" && document.addEventListener; |
|
|
var stylesCreated = false; |
|
|
|
|
|
if (addEventListener) { |
|
|
var requestFrame = (function () { |
|
|
var raf = _window.requestAnimationFrame || _window.mozRequestAnimationFrame || _window.webkitRequestAnimationFrame || |
|
|
function (fn) { |
|
|
return _window.setTimeout(fn, 20); |
|
|
}; |
|
|
return function (fn) { |
|
|
return raf(fn); |
|
|
}; |
|
|
})(); |
|
|
|
|
|
var cancelFrame = (function () { |
|
|
var cancel = _window.cancelAnimationFrame || _window.mozCancelAnimationFrame || _window.webkitCancelAnimationFrame || |
|
|
_window.clearTimeout; |
|
|
return function (id) { |
|
|
return cancel(id); |
|
|
}; |
|
|
})(); |
|
|
|
|
|
var resetTriggers = function (element) { |
|
|
var triggers = element.__resizeTriggers__, |
|
|
expand = triggers.firstElementChild, |
|
|
contract = triggers.lastElementChild, |
|
|
expandChild = expand.firstElementChild; |
|
|
contract.scrollLeft = contract.scrollWidth; |
|
|
contract.scrollTop = contract.scrollHeight; |
|
|
expandChild.style.width = expand.offsetWidth + 1 + "px"; |
|
|
expandChild.style.height = expand.offsetHeight + 1 + "px"; |
|
|
expand.scrollLeft = expand.scrollWidth; |
|
|
expand.scrollTop = expand.scrollHeight; |
|
|
}; |
|
|
|
|
|
var checkTriggers = function (element) { |
|
|
return element.offsetWidth !== element.__resizeLast__.width || |
|
|
element.offsetHeight !== element.__resizeLast__.height; |
|
|
}; |
|
|
|
|
|
var scrollListener = function (e) { |
|
|
var element = this; |
|
|
resetTriggers(this); |
|
|
if (this.__resizeRAF__) cancelFrame(this.__resizeRAF__); |
|
|
this.__resizeRAF__ = requestFrame(function () { |
|
|
if (checkTriggers(element)) { |
|
|
element.__resizeLast__.width = element.offsetWidth; |
|
|
element.__resizeLast__.height = element.offsetHeight; |
|
|
element.__resizeListeners__.forEach(function (fn) { |
|
|
fn.call(element, e); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
}; |
|
|
|
|
|
/* Detect CSS Animations support to detect element display/re-attach */ |
|
|
var animation = false, |
|
|
animationstring = "animation", |
|
|
keyframeprefix = "", |
|
|
animationstartevent = "animationstart", |
|
|
domPrefixes = "Webkit Moz O ms".split(" "), |
|
|
startEvents = "webkitAnimationStart animationstart oAnimationStart MSAnimationStart".split(" "), |
|
|
pfx = ""; |
|
|
{ |
|
|
var elm = document.createElement("fakeelement"); |
|
|
if (elm.style.animationName !== undefined) { |
|
|
animation = true; |
|
|
} |
|
|
|
|
|
if (animation === false) { |
|
|
for (var i = 0; i < domPrefixes.length; i++) { |
|
|
if (elm.style[domPrefixes[i] + "AnimationName"] !== undefined) { |
|
|
pfx = domPrefixes[i]; |
|
|
animationstring = pfx + "Animation"; |
|
|
keyframeprefix = "-" + pfx.toLowerCase() + "-"; |
|
|
animationstartevent = startEvents[i]; |
|
|
animation = true; |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
var animationName = "resizeanim"; |
|
|
var animationKeyframes = "@" + keyframeprefix + "keyframes " + animationName + " { from { opacity: 0; } to { opacity: 0; } } "; |
|
|
var animationStyle = keyframeprefix + "animation: 1ms " + animationName + "; "; |
|
|
} |
|
|
|
|
|
var createStyles = function () { |
|
|
if (!stylesCreated) { |
|
|
// opacity:0 works around a chrome bug https://code.google.com/p/chromium/issues/detail?id=286360 |
|
|
var css = (animationKeyframes ? animationKeyframes : "") + |
|
|
".resize-triggers { " + (animationStyle ? animationStyle : "") + "visibility: hidden; opacity: 0; } " + |
|
|
".resize-triggers, .resize-triggers > div, .contract-trigger:before { content: \" \"; display: block; position: absolute; top: 0; left: 0; height: 100%; width: 100%; overflow: hidden; } .resize-triggers > div { background: #eee; overflow: auto; } .contract-trigger:before { width: 200%; height: 200%; }", |
|
|
head = document.head || document.getElementsByTagName("head")[0], |
|
|
style = document.createElement("style"); |
|
|
|
|
|
style.type = "text/css"; |
|
|
if (style.styleSheet) { |
|
|
style.styleSheet.cssText = css; |
|
|
} else { |
|
|
style.appendChild(document.createTextNode(css)); |
|
|
} |
|
|
|
|
|
head.appendChild(style); |
|
|
stylesCreated = true; |
|
|
} |
|
|
}; |
|
|
|
|
|
var addResizeListener = function (element, fn) { |
|
|
if (addEventListener) { |
|
|
if (!element.__resizeTriggers__) { |
|
|
if (getComputedStyle(element).position === "static") element.style.position = "relative"; |
|
|
createStyles(); |
|
|
element.__resizeLast__ = {}; |
|
|
element.__resizeListeners__ = []; |
|
|
(element.__resizeTriggers__ = document.createElement("div")).className = "resize-triggers"; |
|
|
element.__resizeTriggers__.innerHTML = "<div class=\"expand-trigger\"><div></div></div>" + |
|
|
"<div class=\"contract-trigger\"></div>"; |
|
|
element.appendChild(element.__resizeTriggers__); |
|
|
resetTriggers(element); |
|
|
element.addEventListener("scroll", scrollListener, true); |
|
|
|
|
|
/* Listen for a css animation to detect element display/re-attach */ |
|
|
animationstartevent && element.__resizeTriggers__.addEventListener(animationstartevent, function (e) { |
|
|
if (e.animationName === animationName) {resetTriggers(element);} |
|
|
}); |
|
|
} |
|
|
element.__resizeListeners__.push(fn); |
|
|
|
|
|
} else { |
|
|
element.attachEvent("onresize", fn); |
|
|
} |
|
|
}; |
|
|
|
|
|
var removeResizeListener = function (element, fn) { |
|
|
if (addEventListener) { |
|
|
element.__resizeListeners__.splice(element.__resizeListeners__.indexOf(fn), 1); |
|
|
if (!element.__resizeListeners__.length) { |
|
|
element.removeEventListener("scroll", scrollListener, true); |
|
|
element.__resizeTriggers__ = !element.removeChild(element.__resizeTriggers__); |
|
|
} |
|
|
} else { |
|
|
element.detachEvent("onresize", fn); |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.ResizeDetector = { |
|
|
addResizeListener: function (widget, fn) { |
|
|
addResizeListener(widget.element[0], fn); |
|
|
return function () { |
|
|
removeResizeListener(widget.element[0], fn); |
|
|
}; |
|
|
}, |
|
|
removeResizeListener: function (widget, fn) { |
|
|
removeResizeListener(widget.element[0], fn); |
|
|
} |
|
|
}; |
|
|
}()); |
|
|
|
|
|
(function () { |
|
|
function defaultComparator (a, b) { |
|
|
return a < b; |
|
|
} |
|
|
|
|
|
BI.Heap = function (items, comparator) { |
|
|
this._items = items || []; |
|
|
this._size = this._items.length; |
|
|
this._comparator = comparator || defaultComparator; |
|
|
this._heapify(); |
|
|
}; |
|
|
|
|
|
BI.Heap.prototype = { |
|
|
constructor: BI.Heap, |
|
|
empty: function () { |
|
|
return this._size === 0; |
|
|
}, |
|
|
|
|
|
pop: function () { |
|
|
if (this._size === 0) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var elt = this._items[0]; |
|
|
|
|
|
var lastElt = this._items.pop(); |
|
|
this._size--; |
|
|
|
|
|
if (this._size > 0) { |
|
|
this._items[0] = lastElt; |
|
|
this._sinkDown(0); |
|
|
} |
|
|
|
|
|
return elt; |
|
|
}, |
|
|
|
|
|
push: function (item) { |
|
|
this._items[this._size++] = item; |
|
|
this._bubbleUp(this._size - 1); |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
peek: function () { |
|
|
if (this._size === 0) { |
|
|
return; |
|
|
} |
|
|
|
|
|
return this._items[0]; |
|
|
}, |
|
|
|
|
|
_heapify: function () { |
|
|
for (var index = Math.floor((this._size + 1) / 2); index >= 0; index--) { |
|
|
this._sinkDown(index); |
|
|
} |
|
|
}, |
|
|
|
|
|
_bubbleUp: function (index) { |
|
|
var elt = this._items[index]; |
|
|
while (index > 0) { |
|
|
var parentIndex = Math.floor((index + 1) / 2) - 1; |
|
|
var parentElt = this._items[parentIndex]; |
|
|
|
|
|
// if parentElt < elt, stop |
|
|
if (this._comparator(parentElt, elt)) { |
|
|
return; |
|
|
} |
|
|
|
|
|
// swap |
|
|
this._items[parentIndex] = elt; |
|
|
this._items[index] = parentElt; |
|
|
index = parentIndex; |
|
|
} |
|
|
}, |
|
|
|
|
|
_sinkDown: function (index) { |
|
|
var elt = this._items[index]; |
|
|
|
|
|
while (true) { |
|
|
var leftChildIndex = 2 * (index + 1) - 1; |
|
|
var rightChildIndex = 2 * (index + 1); |
|
|
var swapIndex = -1; |
|
|
|
|
|
if (leftChildIndex < this._size) { |
|
|
var leftChild = this._items[leftChildIndex]; |
|
|
if (this._comparator(leftChild, elt)) { |
|
|
swapIndex = leftChildIndex; |
|
|
} |
|
|
} |
|
|
|
|
|
if (rightChildIndex < this._size) { |
|
|
var rightChild = this._items[rightChildIndex]; |
|
|
if (this._comparator(rightChild, elt)) { |
|
|
if (swapIndex === -1 || |
|
|
this._comparator(rightChild, this._items[swapIndex])) { |
|
|
swapIndex = rightChildIndex; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
// if we don't have a swap, stop |
|
|
if (swapIndex === -1) { |
|
|
return; |
|
|
} |
|
|
|
|
|
this._items[index] = this._items[swapIndex]; |
|
|
this._items[swapIndex] = elt; |
|
|
index = swapIndex; |
|
|
} |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
(function () { |
|
|
var clamp = function (min, value, max) { |
|
|
if (value < min) { |
|
|
return min; |
|
|
} |
|
|
if (value > max) { |
|
|
return max; |
|
|
} |
|
|
return value; |
|
|
}; |
|
|
|
|
|
var BUFFER_ROWS = 5; |
|
|
var NO_ROWS_SCROLL_RESULT = { |
|
|
index: 0, |
|
|
offset: 0, |
|
|
position: 0, |
|
|
contentHeight: 0 |
|
|
}; |
|
|
|
|
|
BI.TableScrollHelper = function (rowCount, |
|
|
defaultRowHeight, |
|
|
viewportHeight, |
|
|
rowHeightGetter) { |
|
|
this._rowOffsets = BI.PrefixIntervalTree.uniform(rowCount, defaultRowHeight); |
|
|
this._storedHeights = new Array(rowCount); |
|
|
for (var i = 0; i < rowCount; ++i) { |
|
|
this._storedHeights[i] = defaultRowHeight; |
|
|
} |
|
|
this._rowCount = rowCount; |
|
|
this._position = 0; |
|
|
this._contentHeight = rowCount * defaultRowHeight; |
|
|
this._defaultRowHeight = defaultRowHeight; |
|
|
this._rowHeightGetter = rowHeightGetter ? |
|
|
rowHeightGetter : function () { |
|
|
return defaultRowHeight; |
|
|
}; |
|
|
this._viewportHeight = viewportHeight; |
|
|
|
|
|
this._updateHeightsInViewport(0, 0); |
|
|
}; |
|
|
|
|
|
BI.TableScrollHelper.prototype = { |
|
|
constructor: BI.TableScrollHelper, |
|
|
setRowHeightGetter: function (rowHeightGetter) { |
|
|
this._rowHeightGetter = rowHeightGetter; |
|
|
}, |
|
|
|
|
|
setViewportHeight: function (viewportHeight) { |
|
|
this._viewportHeight = viewportHeight; |
|
|
}, |
|
|
|
|
|
getContentHeight: function () { |
|
|
return this._contentHeight; |
|
|
}, |
|
|
|
|
|
_updateHeightsInViewport: function (firstRowIndex, |
|
|
firstRowOffset) { |
|
|
var top = firstRowOffset; |
|
|
var index = firstRowIndex; |
|
|
while (top <= this._viewportHeight && index < this._rowCount) { |
|
|
this._updateRowHeight(index); |
|
|
top += this._storedHeights[index]; |
|
|
index++; |
|
|
} |
|
|
}, |
|
|
|
|
|
_updateHeightsAboveViewport: function (firstRowIndex) { |
|
|
var index = firstRowIndex - 1; |
|
|
while (index >= 0 && index >= firstRowIndex - BUFFER_ROWS) { |
|
|
var delta = this._updateRowHeight(index); |
|
|
this._position += delta; |
|
|
index--; |
|
|
} |
|
|
}, |
|
|
|
|
|
_updateRowHeight: function (rowIndex) { |
|
|
if (rowIndex < 0 || rowIndex >= this._rowCount) { |
|
|
return 0; |
|
|
} |
|
|
var newHeight = this._rowHeightGetter(rowIndex); |
|
|
if (newHeight !== this._storedHeights[rowIndex]) { |
|
|
var change = newHeight - this._storedHeights[rowIndex]; |
|
|
this._rowOffsets.set(rowIndex, newHeight); |
|
|
this._storedHeights[rowIndex] = newHeight; |
|
|
this._contentHeight += change; |
|
|
return change; |
|
|
} |
|
|
return 0; |
|
|
}, |
|
|
|
|
|
getRowPosition: function (rowIndex) { |
|
|
this._updateRowHeight(rowIndex); |
|
|
return this._rowOffsets.sumUntil(rowIndex); |
|
|
}, |
|
|
|
|
|
scrollBy: function (delta) { |
|
|
if (this._rowCount === 0) { |
|
|
return NO_ROWS_SCROLL_RESULT; |
|
|
} |
|
|
var firstRow = this._rowOffsets.greatestLowerBound(this._position); |
|
|
firstRow = clamp(firstRow, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var firstRowPosition = this._rowOffsets.sumUntil(firstRow); |
|
|
var rowIndex = firstRow; |
|
|
var position = this._position; |
|
|
|
|
|
var rowHeightChange = this._updateRowHeight(rowIndex); |
|
|
if (firstRowPosition !== 0) { |
|
|
position += rowHeightChange; |
|
|
} |
|
|
var visibleRowHeight = this._storedHeights[rowIndex] - |
|
|
(position - firstRowPosition); |
|
|
|
|
|
if (delta >= 0) { |
|
|
|
|
|
while (delta > 0 && rowIndex < this._rowCount) { |
|
|
if (delta < visibleRowHeight) { |
|
|
position += delta; |
|
|
delta = 0; |
|
|
} else { |
|
|
delta -= visibleRowHeight; |
|
|
position += visibleRowHeight; |
|
|
rowIndex++; |
|
|
} |
|
|
if (rowIndex < this._rowCount) { |
|
|
this._updateRowHeight(rowIndex); |
|
|
visibleRowHeight = this._storedHeights[rowIndex]; |
|
|
} |
|
|
} |
|
|
} else if (delta < 0) { |
|
|
delta = -delta; |
|
|
var invisibleRowHeight = this._storedHeights[rowIndex] - visibleRowHeight; |
|
|
|
|
|
while (delta > 0 && rowIndex >= 0) { |
|
|
if (delta < invisibleRowHeight) { |
|
|
position -= delta; |
|
|
delta = 0; |
|
|
} else { |
|
|
position -= invisibleRowHeight; |
|
|
delta -= invisibleRowHeight; |
|
|
rowIndex--; |
|
|
} |
|
|
if (rowIndex >= 0) { |
|
|
var change = this._updateRowHeight(rowIndex); |
|
|
invisibleRowHeight = this._storedHeights[rowIndex]; |
|
|
position += change; |
|
|
} |
|
|
} |
|
|
} |
|
|
|
|
|
var maxPosition = this._contentHeight - this._viewportHeight; |
|
|
position = clamp(position, 0, maxPosition); |
|
|
this._position = position; |
|
|
var firstRowIndex = this._rowOffsets.greatestLowerBound(position); |
|
|
firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex); |
|
|
var firstRowOffset = firstRowPosition - position; |
|
|
|
|
|
this._updateHeightsInViewport(firstRowIndex, firstRowOffset); |
|
|
this._updateHeightsAboveViewport(firstRowIndex); |
|
|
|
|
|
return { |
|
|
index: firstRowIndex, |
|
|
offset: firstRowOffset, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
}, |
|
|
|
|
|
_getRowAtEndPosition: function (rowIndex) { |
|
|
// We need to update enough rows above the selected one to be sure that when |
|
|
// we scroll to selected position all rows between first shown and selected |
|
|
// one have most recent heights computed and will not resize |
|
|
this._updateRowHeight(rowIndex); |
|
|
var currentRowIndex = rowIndex; |
|
|
var top = this._storedHeights[currentRowIndex]; |
|
|
while (top < this._viewportHeight && currentRowIndex >= 0) { |
|
|
currentRowIndex--; |
|
|
if (currentRowIndex >= 0) { |
|
|
this._updateRowHeight(currentRowIndex); |
|
|
top += this._storedHeights[currentRowIndex]; |
|
|
} |
|
|
} |
|
|
var position = this._rowOffsets.sumTo(rowIndex) - this._viewportHeight; |
|
|
if (position < 0) { |
|
|
position = 0; |
|
|
} |
|
|
return position; |
|
|
}, |
|
|
|
|
|
scrollTo: function (position) { |
|
|
if (this._rowCount === 0) { |
|
|
return NO_ROWS_SCROLL_RESULT; |
|
|
} |
|
|
if (position <= 0) { |
|
|
// If position less than or equal to 0 first row should be fully visible |
|
|
// on top |
|
|
this._position = 0; |
|
|
this._updateHeightsInViewport(0, 0); |
|
|
|
|
|
return { |
|
|
index: 0, |
|
|
offset: 0, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
} else if (position >= this._contentHeight - this._viewportHeight) { |
|
|
// If position is equal to or greater than max scroll value, we need |
|
|
// to make sure to have bottom border of last row visible. |
|
|
var rowIndex = this._rowCount - 1; |
|
|
position = this._getRowAtEndPosition(rowIndex); |
|
|
} |
|
|
this._position = position; |
|
|
|
|
|
var firstRowIndex = this._rowOffsets.greatestLowerBound(position); |
|
|
firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex); |
|
|
var firstRowOffset = firstRowPosition - position; |
|
|
|
|
|
this._updateHeightsInViewport(firstRowIndex, firstRowOffset); |
|
|
this._updateHeightsAboveViewport(firstRowIndex); |
|
|
|
|
|
return { |
|
|
index: firstRowIndex, |
|
|
offset: firstRowOffset, |
|
|
position: this._position, |
|
|
contentHeight: this._contentHeight |
|
|
}; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Allows to scroll to selected row with specified offset. It always |
|
|
* brings that row to top of viewport with that offset |
|
|
*/ |
|
|
scrollToRow: function (rowIndex, offset) { |
|
|
rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
offset = clamp(offset, -this._storedHeights[rowIndex], 0); |
|
|
var firstRow = this._rowOffsets.sumUntil(rowIndex); |
|
|
return this.scrollTo(firstRow - offset); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Allows to scroll to selected row by bringing it to viewport with minimal |
|
|
* scrolling. This that if row is fully visible, scroll will not be changed. |
|
|
* If top border of row is above top of viewport it will be scrolled to be |
|
|
* fully visible on the top of viewport. If the bottom border of row is |
|
|
* below end of viewport, it will be scrolled up to be fully visible on the |
|
|
* bottom of viewport. |
|
|
*/ |
|
|
scrollRowIntoView: function (rowIndex) { |
|
|
rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0)); |
|
|
var rowBegin = this._rowOffsets.sumUntil(rowIndex); |
|
|
var rowEnd = rowBegin + this._storedHeights[rowIndex]; |
|
|
if (rowBegin < this._position) { |
|
|
return this.scrollTo(rowBegin); |
|
|
} else if (this._position + this._viewportHeight < rowEnd) { |
|
|
var position = this._getRowAtEndPosition(rowIndex); |
|
|
return this.scrollTo(position); |
|
|
} |
|
|
return this.scrollTo(this._position); |
|
|
} |
|
|
}; |
|
|
|
|
|
})(); |
|
|
// Data structure that allows to store values and assign positions to them |
|
|
// in a way to minimize changing positions of stored values when new ones are |
|
|
// added or when some values are replaced. Stored elements are alwasy assigned |
|
|
// a consecutive set of positoins startin from 0 up to count of elements less 1 |
|
|
// Following actions can be executed |
|
|
// * get position assigned to given value (null if value is not stored) |
|
|
// * create new entry for new value and get assigned position back |
|
|
// * replace value that is furthest from specified value range with new value |
|
|
// and get it's position back |
|
|
// All operations take amortized log(n) time where n is number of elements in |
|
|
// the set. |
|
|
BI.IntegerBufferSet = function () { |
|
|
this._valueToPositionMap = {}; |
|
|
this._size = 0; |
|
|
this._smallValues = new BI.Heap( |
|
|
[], // Initial data in the heap |
|
|
this._smallerComparator |
|
|
); |
|
|
this._largeValues = new BI.Heap( |
|
|
[], // Initial data in the heap |
|
|
this._greaterComparator |
|
|
); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.IntegerBufferSet.prototype = { |
|
|
constructor: BI.IntegerBufferSet, |
|
|
getSize: function () /* number*/ { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
getValuePosition: function (/* number*/ value) /* ?number*/ { |
|
|
if (this._valueToPositionMap[value] === undefined) { |
|
|
return null; |
|
|
} |
|
|
return this._valueToPositionMap[value]; |
|
|
}, |
|
|
|
|
|
getNewPositionForValue: function (/* number*/ value) /* number*/ { |
|
|
var newPosition = this._size; |
|
|
this._size++; |
|
|
this._pushToHeaps(newPosition, value); |
|
|
this._valueToPositionMap[value] = newPosition; |
|
|
return newPosition; |
|
|
}, |
|
|
|
|
|
replaceFurthestValuePosition: function (/* number*/ lowValue, |
|
|
/* number*/ highValue, |
|
|
/* number*/ newValue) /* ?number*/ { |
|
|
this._cleanHeaps(); |
|
|
if (this._smallValues.empty() || this._largeValues.empty()) { |
|
|
// Threre are currently no values stored. We will have to create new |
|
|
// position for this value. |
|
|
return null; |
|
|
} |
|
|
|
|
|
var minValue = this._smallValues.peek().value; |
|
|
var maxValue = this._largeValues.peek().value; |
|
|
if (minValue >= lowValue && maxValue <= highValue) { |
|
|
// All values currently stored are necessary, we can't reuse any of them. |
|
|
return null; |
|
|
} |
|
|
|
|
|
var valueToReplace; |
|
|
if (lowValue - minValue > maxValue - highValue) { |
|
|
// minValue is further from provided range. We will reuse it's position. |
|
|
valueToReplace = minValue; |
|
|
this._smallValues.pop(); |
|
|
} else { |
|
|
valueToReplace = maxValue; |
|
|
this._largeValues.pop(); |
|
|
} |
|
|
var position = this._valueToPositionMap[valueToReplace]; |
|
|
delete this._valueToPositionMap[valueToReplace]; |
|
|
this._valueToPositionMap[newValue] = position; |
|
|
this._pushToHeaps(position, newValue); |
|
|
|
|
|
return position; |
|
|
}, |
|
|
|
|
|
_pushToHeaps: function (/* number*/ position, /* number*/ value) { |
|
|
var element = { |
|
|
position: position, |
|
|
value: value |
|
|
}; |
|
|
// We can reuse the same object in both heaps, because we don't mutate them |
|
|
this._smallValues.push(element); |
|
|
this._largeValues.push(element); |
|
|
}, |
|
|
|
|
|
_cleanHeaps: function () { |
|
|
// We not usually only remove object from one heap while moving value. |
|
|
// Here we make sure that there is no stale data on top of heaps. |
|
|
this._cleanHeap(this._smallValues); |
|
|
this._cleanHeap(this._largeValues); |
|
|
var minHeapSize = |
|
|
Math.min(this._smallValues.size(), this._largeValues.size()); |
|
|
var maxHeapSize = |
|
|
Math.max(this._smallValues.size(), this._largeValues.size()); |
|
|
if (maxHeapSize > 10 * minHeapSize) { |
|
|
// There are many old values in one of heaps. We nned to get rid of them |
|
|
// to not use too avoid memory leaks |
|
|
this._recreateHeaps(); |
|
|
} |
|
|
}, |
|
|
|
|
|
_recreateHeaps: function () { |
|
|
var sourceHeap = this._smallValues.size() < this._largeValues.size() ? |
|
|
this._smallValues : |
|
|
this._largeValues; |
|
|
var newSmallValues = new Heap( |
|
|
[], // Initial data in the heap |
|
|
this._smallerComparator |
|
|
); |
|
|
var newLargeValues = new Heap( |
|
|
[], // Initial datat in the heap |
|
|
this._greaterComparator |
|
|
); |
|
|
while (!sourceHeap.empty()) { |
|
|
var element = sourceHeap.pop(); |
|
|
// Push all stil valid elements to new heaps |
|
|
if (this._valueToPositionMap[element.value] !== undefined) { |
|
|
newSmallValues.push(element); |
|
|
newLargeValues.push(element); |
|
|
} |
|
|
} |
|
|
this._smallValues = newSmallValues; |
|
|
this._largeValues = newLargeValues; |
|
|
}, |
|
|
|
|
|
_cleanHeap: function (/* object*/ heap) { |
|
|
while (!heap.empty() && |
|
|
this._valueToPositionMap[heap.peek().value] === undefined) { |
|
|
heap.pop(); |
|
|
} |
|
|
}, |
|
|
|
|
|
_smallerComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ { |
|
|
return lhs.value < rhs.value; |
|
|
}, |
|
|
|
|
|
_greaterComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ { |
|
|
return lhs.value > rhs.value; |
|
|
} |
|
|
}; |
|
|
|
|
|
!(function () { |
|
|
BI.LinkHashMap = function () { |
|
|
this.array = []; |
|
|
this.map = {}; |
|
|
}; |
|
|
BI.LinkHashMap.prototype = { |
|
|
constructor: BI.LinkHashMap, |
|
|
has: function (key) { |
|
|
if (key in this.map) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
add: function (key, value) { |
|
|
if (typeof key === "undefined") { |
|
|
return; |
|
|
} |
|
|
if (key in this.map) { |
|
|
this.map[key] = value; |
|
|
} else { |
|
|
this.array.push(key); |
|
|
this.map[key] = value; |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (key) { |
|
|
if (key in this.map) { |
|
|
delete this.map[key]; |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
if (this.array[i] == key) { |
|
|
this.array.splice(i, 1); |
|
|
break; |
|
|
} |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this.array.length; |
|
|
}, |
|
|
|
|
|
each: function (fn, scope) { |
|
|
var scope = scope || window; |
|
|
var fn = fn || null; |
|
|
if (fn == null || typeof (fn) !== "function") { |
|
|
return; |
|
|
} |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
var key = this.array[i]; |
|
|
var value = this.map[key]; |
|
|
var re = fn.call(scope, key, value, i, this.array, this.map); |
|
|
if (re == false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
get: function (key) { |
|
|
return this.map[key]; |
|
|
}, |
|
|
|
|
|
toArray: function () { |
|
|
var array = []; |
|
|
this.each(function (key, value) { |
|
|
array.push(value); |
|
|
}); |
|
|
return array; |
|
|
} |
|
|
}; |
|
|
})();_.extend(BI, { |
|
|
$import: function () { |
|
|
var _LOADED = {}; // alex:保存加载过的 |
|
|
function loadReady (src, must) { |
|
|
var $scripts = $("head script, body script"); |
|
|
$.each($scripts, function (i, item) { |
|
|
if (item.src.indexOf(src) != -1) { |
|
|
_LOADED[src] = true; |
|
|
} |
|
|
}); |
|
|
var $links = $("head link"); |
|
|
$.each($links, function (i, item) { |
|
|
if (item.href.indexOf(src) != -1 && must) { |
|
|
_LOADED[src] = false; |
|
|
$(item).remove(); |
|
|
} |
|
|
}); |
|
|
} |
|
|
|
|
|
// must=true 强行加载 |
|
|
return function (src, ext, must) { |
|
|
loadReady(src, must); |
|
|
// alex:如果已经加载过了的,直接return |
|
|
if (_LOADED[src] === true) { |
|
|
return; |
|
|
} |
|
|
if (ext === "css") { |
|
|
var link = document.createElement("link"); |
|
|
link.rel = "stylesheet"; |
|
|
link.type = "text/css"; |
|
|
link.href = src; |
|
|
var head = document.getElementsByTagName("head")[0]; |
|
|
head.appendChild(link); |
|
|
_LOADED[src] = true; |
|
|
} else { |
|
|
// alex:这里用同步调用的方式,必须等待ajax完成 |
|
|
$.ajax({ |
|
|
url: src, |
|
|
dataType: "script", // alex:指定dataType为script,jquery会帮忙做globalEval的事情 |
|
|
async: false, |
|
|
cache: true, |
|
|
complete: function (res, status) { |
|
|
/* |
|
|
* alex:发现jquery会很智能地判断一下返回的数据类型是不是script,然后做一个globalEval |
|
|
* 所以当status为success时就不需要再把其中的内容加到script里面去了 |
|
|
*/ |
|
|
if (status == "success") { |
|
|
_LOADED[src] = true; |
|
|
} |
|
|
} |
|
|
}); |
|
|
} |
|
|
}; |
|
|
}() |
|
|
}); |
|
|
!(function () { |
|
|
BI.LRU = function (limit) { |
|
|
this.size = 0; |
|
|
this.limit = limit; |
|
|
this.head = this.tail = undefined; |
|
|
this._keymap = {}; |
|
|
}; |
|
|
|
|
|
var p = BI.LRU.prototype; |
|
|
|
|
|
p.put = function (key, value) { |
|
|
var removed; |
|
|
if (this.size === this.limit) { |
|
|
removed = this.shift(); |
|
|
} |
|
|
|
|
|
var entry = this.get(key, true); |
|
|
if (!entry) { |
|
|
entry = { |
|
|
key: key |
|
|
}; |
|
|
this._keymap[key] = entry; |
|
|
if (this.tail) { |
|
|
this.tail.newer = entry; |
|
|
entry.older = this.tail; |
|
|
} else { |
|
|
this.head = entry; |
|
|
} |
|
|
this.tail = entry; |
|
|
this.size++; |
|
|
} |
|
|
entry.value = value; |
|
|
|
|
|
return removed; |
|
|
}; |
|
|
|
|
|
p.shift = function () { |
|
|
var entry = this.head; |
|
|
if (entry) { |
|
|
this.head = this.head.newer; |
|
|
this.head.older = undefined; |
|
|
entry.newer = entry.older = undefined; |
|
|
this._keymap[entry.key] = undefined; |
|
|
this.size--; |
|
|
} |
|
|
return entry; |
|
|
}; |
|
|
|
|
|
|
|
|
p.get = function (key, returnEntry) { |
|
|
var entry = this._keymap[key]; |
|
|
if (entry === undefined) return; |
|
|
if (entry === this.tail) { |
|
|
return returnEntry |
|
|
? entry |
|
|
: entry.value; |
|
|
} |
|
|
// HEAD--------------TAIL |
|
|
// <.older .newer> |
|
|
// <--- add direction -- |
|
|
// A B C <D> E |
|
|
if (entry.newer) { |
|
|
if (entry === this.head) { |
|
|
this.head = entry.newer; |
|
|
} |
|
|
entry.newer.older = entry.older; // C <-- E. |
|
|
} |
|
|
if (entry.older) { |
|
|
entry.older.newer = entry.newer; // C. --> E |
|
|
} |
|
|
entry.newer = undefined; // D --x |
|
|
entry.older = this.tail; // D. --> E |
|
|
if (this.tail) { |
|
|
this.tail.newer = entry; // E. <-- D |
|
|
} |
|
|
this.tail = entry; |
|
|
return returnEntry |
|
|
? entry |
|
|
: entry.value; |
|
|
}; |
|
|
|
|
|
p.has = function (key) { |
|
|
return this._keymap[key] != null; |
|
|
}; |
|
|
})(); |
|
|
!(function () { |
|
|
var MD5 = function (hexcase) { |
|
|
this.hexcase = !hexcase ? 0 : 1; |
|
|
/* hex output format. 0 - lowercase; 1 - uppercase */ |
|
|
this.b64pad = ""; |
|
|
/* base-64 pad character. "=" for strict RFC compliance */ |
|
|
this.chrsz = 8; |
|
|
/* bits per input character. 8 - ASCII; 16 - Unicode */ |
|
|
}; |
|
|
|
|
|
/* |
|
|
* These are the functions you'll usually want to call |
|
|
* They take string arguments and return either hex or base-64 encoded strings |
|
|
*/ |
|
|
MD5.prototype.hex_md5 = function (s) { |
|
|
return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.hex_md5_salt = function (s) { |
|
|
var md5ed = this.hex_md5(s); |
|
|
|
|
|
var items1 = []; |
|
|
var items2 = []; |
|
|
for (var i = 0; i < md5ed.length; i++) { |
|
|
if (i % 2 === 0) { |
|
|
items1.push(md5ed.charAt(i)); |
|
|
} else { |
|
|
items2.push(md5ed.charAt(i)); |
|
|
} |
|
|
} |
|
|
var result = ":" + items1.join("") + items2.join(""); |
|
|
return result; |
|
|
}; |
|
|
|
|
|
MD5.prototype.b64_md5 = function (s) { |
|
|
return this.binl2b64(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.hex_hmac_md5 = function (key, data) { |
|
|
return this.binl2hex(this.core_hmac_md5(key, data)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.b64_hmac_md5 = function (key, data) { |
|
|
return this.binl2b64(this.core_hmac_md5(key, data)); |
|
|
}; |
|
|
|
|
|
/* Backwards compatibility - same as hex_md5() */ |
|
|
MD5.prototype.calcMD5 = function (s) { |
|
|
return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz)); |
|
|
}; |
|
|
|
|
|
MD5.prototype.core_md5 = function (x, len) { |
|
|
/* append padding */ |
|
|
x[len >> 5] |= 0x80 << ((len) % 32); |
|
|
x[(((len + 64) >>> 9) << 4) + 14] = len; |
|
|
|
|
|
var a = 1732584193; |
|
|
var b = -271733879; |
|
|
var c = -1732584194; |
|
|
var d = 271733878; |
|
|
|
|
|
for (var i = 0; i < x.length; i += 16) { |
|
|
var olda = a; |
|
|
var oldb = b; |
|
|
var oldc = c; |
|
|
var oldd = d; |
|
|
|
|
|
a = this.md5_ff(a, b, c, d, x[i + 0], 7, -680876936); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 1], 12, -389564586); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 2], 17, 606105819); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 3], 22, -1044525330); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 4], 7, -176418897); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 5], 12, 1200080426); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 6], 17, -1473231341); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 7], 22, -45705983); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 8], 7, 1770035416); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 9], 12, -1958414417); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 10], 17, -42063); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 11], 22, -1990404162); |
|
|
a = this.md5_ff(a, b, c, d, x[i + 12], 7, 1804603682); |
|
|
d = this.md5_ff(d, a, b, c, x[i + 13], 12, -40341101); |
|
|
c = this.md5_ff(c, d, a, b, x[i + 14], 17, -1502002290); |
|
|
b = this.md5_ff(b, c, d, a, x[i + 15], 22, 1236535329); |
|
|
|
|
|
a = this.md5_gg(a, b, c, d, x[i + 1], 5, -165796510); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 6], 9, -1069501632); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 11], 14, 643717713); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 0], 20, -373897302); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 5], 5, -701558691); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 10], 9, 38016083); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 15], 14, -660478335); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 4], 20, -405537848); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 9], 5, 568446438); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 14], 9, -1019803690); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 3], 14, -187363961); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 8], 20, 1163531501); |
|
|
a = this.md5_gg(a, b, c, d, x[i + 13], 5, -1444681467); |
|
|
d = this.md5_gg(d, a, b, c, x[i + 2], 9, -51403784); |
|
|
c = this.md5_gg(c, d, a, b, x[i + 7], 14, 1735328473); |
|
|
b = this.md5_gg(b, c, d, a, x[i + 12], 20, -1926607734); |
|
|
|
|
|
a = this.md5_hh(a, b, c, d, x[i + 5], 4, -378558); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 8], 11, -2022574463); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 11], 16, 1839030562); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 14], 23, -35309556); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 1], 4, -1530992060); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 4], 11, 1272893353); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 7], 16, -155497632); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 10], 23, -1094730640); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 13], 4, 681279174); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 0], 11, -358537222); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 3], 16, -722521979); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 6], 23, 76029189); |
|
|
a = this.md5_hh(a, b, c, d, x[i + 9], 4, -640364487); |
|
|
d = this.md5_hh(d, a, b, c, x[i + 12], 11, -421815835); |
|
|
c = this.md5_hh(c, d, a, b, x[i + 15], 16, 530742520); |
|
|
b = this.md5_hh(b, c, d, a, x[i + 2], 23, -995338651); |
|
|
|
|
|
a = this.md5_ii(a, b, c, d, x[i + 0], 6, -198630844); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 7], 10, 1126891415); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 14], 15, -1416354905); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 5], 21, -57434055); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 12], 6, 1700485571); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 3], 10, -1894986606); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 10], 15, -1051523); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 1], 21, -2054922799); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 8], 6, 1873313359); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 15], 10, -30611744); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 6], 15, -1560198380); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 13], 21, 1309151649); |
|
|
a = this.md5_ii(a, b, c, d, x[i + 4], 6, -145523070); |
|
|
d = this.md5_ii(d, a, b, c, x[i + 11], 10, -1120210379); |
|
|
c = this.md5_ii(c, d, a, b, x[i + 2], 15, 718787259); |
|
|
b = this.md5_ii(b, c, d, a, x[i + 9], 21, -343485551); |
|
|
|
|
|
a = this.safe_add(a, olda); |
|
|
b = this.safe_add(b, oldb); |
|
|
c = this.safe_add(c, oldc); |
|
|
d = this.safe_add(d, oldd); |
|
|
} |
|
|
return Array(a, b, c, d); |
|
|
|
|
|
}; |
|
|
|
|
|
/* |
|
|
* These functions implement the four basic operations the algorithm uses. |
|
|
*/ |
|
|
MD5.prototype.md5_cmn = function (q, a, b, x, s, t) { |
|
|
return this.safe_add(this.bit_rol(this.safe_add(this.safe_add(a, q), this.safe_add(x, t)), s), b); |
|
|
}; |
|
|
MD5.prototype.md5_ff = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn((b & c) | ((~b) & d), a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_gg = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn((b & d) | (c & (~d)), a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_hh = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn(b ^ c ^ d, a, b, x, s, t); |
|
|
}; |
|
|
MD5.prototype.md5_ii = function (a, b, c, d, x, s, t) { |
|
|
return this.md5_cmn(c ^ (b | (~d)), a, b, x, s, t); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Calculate the HMAC-MD5, of a key and some data |
|
|
*/ |
|
|
MD5.prototype.core_hmac_md5 = function (key, data) { |
|
|
var bkey = this.str2binl(key); |
|
|
if (bkey.length > 16) {bkey = this.core_md5(bkey, key.length * this.chrsz);} |
|
|
|
|
|
var ipad = Array(16), opad = Array(16); |
|
|
for (var i = 0; i < 16; i++) { |
|
|
ipad[i] = bkey[i] ^ 0x36363636; |
|
|
opad[i] = bkey[i] ^ 0x5C5C5C5C; |
|
|
} |
|
|
|
|
|
var hash = this.core_md5(ipad.concat(this.str2binl(data)), 512 + data.length * this.chrsz); |
|
|
return this.core_md5(opad.concat(hash), 512 + 128); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Add integers, wrapping at 2^32. This uses 16-bit operations internally |
|
|
* to work around bugs in some JS interpreters. |
|
|
*/ |
|
|
MD5.prototype.safe_add = function (x, y) { |
|
|
var lsw = (x & 0xFFFF) + (y & 0xFFFF); |
|
|
var msw = (x >> 16) + (y >> 16) + (lsw >> 16); |
|
|
return (msw << 16) | (lsw & 0xFFFF); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Bitwise rotate a 32-bit number to the left. |
|
|
*/ |
|
|
MD5.prototype.bit_rol = function (num, cnt) { |
|
|
return (num << cnt) | (num >>> (32 - cnt)); |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert a string to an array of little-endian words |
|
|
* If chrsz is ASCII, characters >255 have their hi-byte silently ignored. |
|
|
*/ |
|
|
MD5.prototype.str2binl = function (str) { |
|
|
var bin = Array(); |
|
|
var mask = (1 << this.chrsz) - 1; |
|
|
for (var i = 0; i < str.length * this.chrsz; i += this.chrsz) {bin[i >> 5] |= (str.charCodeAt(i / this.chrsz) & mask) << (i % 32);} |
|
|
return bin; |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert an array of little-endian words to a hex string. |
|
|
*/ |
|
|
MD5.prototype.binl2hex = function (binarray) { |
|
|
var hex_tab = this.hexcase ? "0123456789ABCDEF" : "0123456789abcdef"; |
|
|
var str = ""; |
|
|
for (var i = 0; i < binarray.length * 4; i++) { |
|
|
str += hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8 + 4)) & 0xF) |
|
|
+ hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8)) & 0xF); |
|
|
} |
|
|
return str; |
|
|
}; |
|
|
|
|
|
/* |
|
|
* Convert an array of little-endian words to a base-64 string |
|
|
*/ |
|
|
MD5.prototype.binl2b64 = function (binarray) { |
|
|
var tab = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/"; |
|
|
var str = ""; |
|
|
for (var i = 0; i < binarray.length * 4; i += 3) { |
|
|
var triplet = (((binarray[i >> 2] >> 8 * (i % 4)) & 0xFF) << 16) |
|
|
| (((binarray[i + 1 >> 2] >> 8 * ((i + 1) % 4)) & 0xFF) << 8) |
|
|
| ((binarray[i + 2 >> 2] >> 8 * ((i + 2) % 4)) & 0xFF); |
|
|
for (var j = 0; j < 4; j++) { |
|
|
if (i * 8 + j * 6 > binarray.length * 32) {str += this.b64pad;} else {str += tab.charAt((triplet >> 6 * (3 - j)) & 0x3F);} |
|
|
} |
|
|
} |
|
|
return str; |
|
|
}; |
|
|
BI.MD5 = new MD5(); |
|
|
})();// 线段树 |
|
|
(function () { |
|
|
var parent = function (node) { |
|
|
return Math.floor(node / 2); |
|
|
}; |
|
|
|
|
|
var Int32Array = window.Int32Array || function (size) { |
|
|
var xs = []; |
|
|
for (var i = size - 1; i >= 0; --i) { |
|
|
xs[i] = 0; |
|
|
} |
|
|
return xs; |
|
|
}; |
|
|
|
|
|
var ceilLog2 = function (x) { |
|
|
var y = 1; |
|
|
while (y < x) { |
|
|
y *= 2; |
|
|
} |
|
|
return y; |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree = function (xs) { |
|
|
this._size = xs.length; |
|
|
this._half = ceilLog2(this._size); |
|
|
this._heap = new Int32Array(2 * this._half); |
|
|
|
|
|
var i; |
|
|
for (i = 0; i < this._size; ++i) { |
|
|
this._heap[this._half + i] = xs[i]; |
|
|
} |
|
|
|
|
|
for (i = this._half - 1; i > 0; --i) { |
|
|
this._heap[i] = this._heap[2 * i] + this._heap[2 * i + 1]; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.prototype = { |
|
|
constructor: BI.PrefixIntervalTree, |
|
|
set: function (index, value) { |
|
|
var node = this._half + index; |
|
|
this._heap[node] = value; |
|
|
|
|
|
node = parent(node); |
|
|
for (; node !== 0; node = parent(node)) { |
|
|
this._heap[node] = |
|
|
this._heap[2 * node] + this._heap[2 * node + 1]; |
|
|
} |
|
|
}, |
|
|
|
|
|
get: function (index) { |
|
|
var node = this._half + index; |
|
|
return this._heap[node]; |
|
|
}, |
|
|
|
|
|
getSize: function () { |
|
|
return this._size; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* get(0) + get(1) + ... + get(end - 1). |
|
|
*/ |
|
|
sumUntil: function (end) { |
|
|
if (end === 0) { |
|
|
return 0; |
|
|
} |
|
|
|
|
|
var node = this._half + end - 1; |
|
|
var sum = this._heap[node]; |
|
|
for (; node !== 1; node = parent(node)) { |
|
|
if (node % 2 === 1) { |
|
|
sum += this._heap[node - 1]; |
|
|
} |
|
|
} |
|
|
|
|
|
return sum; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* get(0) + get(1) + ... + get(inclusiveEnd). |
|
|
*/ |
|
|
sumTo: function (inclusiveEnd) { |
|
|
return this.sumUntil(inclusiveEnd + 1); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* sum get(begin) + get(begin + 1) + ... + get(end - 1). |
|
|
*/ |
|
|
sum: function (begin, end) { |
|
|
return this.sumUntil(end) - this.sumUntil(begin); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and sumUntil(i) <= t, or |
|
|
* -1 if no such i exists. |
|
|
*/ |
|
|
greatestLowerBound: function (t) { |
|
|
if (t < 0) { |
|
|
return -1; |
|
|
} |
|
|
|
|
|
var node = 1; |
|
|
if (this._heap[node] <= t) { |
|
|
return this._size; |
|
|
} |
|
|
|
|
|
while (node < this._half) { |
|
|
var leftSum = this._heap[2 * node]; |
|
|
if (t < leftSum) { |
|
|
node = 2 * node; |
|
|
} else { |
|
|
node = 2 * node + 1; |
|
|
t -= leftSum; |
|
|
} |
|
|
} |
|
|
|
|
|
return node - this._half; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and sumUntil(i) < t, or |
|
|
* -1 if no such i exists. |
|
|
*/ |
|
|
greatestStrictLowerBound: function (t) { |
|
|
if (t <= 0) { |
|
|
return -1; |
|
|
} |
|
|
|
|
|
var node = 1; |
|
|
if (this._heap[node] < t) { |
|
|
return this._size; |
|
|
} |
|
|
|
|
|
while (node < this._half) { |
|
|
var leftSum = this._heap[2 * node]; |
|
|
if (t <= leftSum) { |
|
|
node = 2 * node; |
|
|
} else { |
|
|
node = 2 * node + 1; |
|
|
t -= leftSum; |
|
|
} |
|
|
} |
|
|
|
|
|
return node - this._half; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and t <= sumUntil(i), or |
|
|
* size + 1 if no such i exists. |
|
|
*/ |
|
|
leastUpperBound: function (t) { |
|
|
return this.greatestStrictLowerBound(t) + 1; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* Returns the smallest i such that 0 <= i <= size and t < sumUntil(i), or |
|
|
* size + 1 if no such i exists. |
|
|
*/ |
|
|
leastStrictUpperBound: function (t) { |
|
|
return this.greatestLowerBound(t) + 1; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.uniform = function (size, initialValue) { |
|
|
var xs = []; |
|
|
for (var i = size - 1; i >= 0; --i) { |
|
|
xs[i] = initialValue; |
|
|
} |
|
|
|
|
|
return new BI.PrefixIntervalTree(xs); |
|
|
}; |
|
|
|
|
|
BI.PrefixIntervalTree.empty = function (size) { |
|
|
return BI.PrefixIntervalTree.uniform(size, 0); |
|
|
}; |
|
|
|
|
|
})(); |
|
|
|
|
|
!(function () { |
|
|
BI.Queue = function (capacity) { |
|
|
this.capacity = capacity; |
|
|
this.array = []; |
|
|
}; |
|
|
BI.Queue.prototype = { |
|
|
constructor: BI.Queue, |
|
|
|
|
|
contains: function (v) { |
|
|
return this.array.contains(v); |
|
|
}, |
|
|
|
|
|
indexOf: function (v) { |
|
|
return this.array.contains(v); |
|
|
}, |
|
|
|
|
|
getElementByIndex: function (index) { |
|
|
return this.array[index]; |
|
|
}, |
|
|
|
|
|
push: function (v) { |
|
|
this.array.push(v); |
|
|
if (this.capacity && this.array.length > this.capacity) { |
|
|
this.array.shift(); |
|
|
} |
|
|
}, |
|
|
|
|
|
pop: function () { |
|
|
this.array.pop(); |
|
|
}, |
|
|
|
|
|
shift: function () { |
|
|
this.array.shift(); |
|
|
}, |
|
|
|
|
|
unshift: function (v) { |
|
|
this.array.unshift(v); |
|
|
if (this.capacity && this.array.length > this.capacity) { |
|
|
this.array.pop(); |
|
|
} |
|
|
}, |
|
|
|
|
|
remove: function (v) { |
|
|
this.array.remove(v); |
|
|
}, |
|
|
|
|
|
splice: function () { |
|
|
this.array.splice.apply(this.array, arguments); |
|
|
}, |
|
|
|
|
|
slice: function () { |
|
|
this.array.slice.apply(this.array, arguments); |
|
|
}, |
|
|
|
|
|
size: function () { |
|
|
return this.array.length; |
|
|
}, |
|
|
|
|
|
each: function (fn, scope) { |
|
|
var scope = scope || window; |
|
|
var fn = fn || null; |
|
|
if (fn == null || typeof (fn) !== "function") { |
|
|
return; |
|
|
} |
|
|
for (var i = 0; i < this.array.length; i++) { |
|
|
var re = fn.call(scope, i, this.array[i], this.array); |
|
|
if (re == false) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
toArray: function () { |
|
|
return this.array; |
|
|
}, |
|
|
|
|
|
fromArray: function (array) { |
|
|
var self = this; |
|
|
BI.each(array, function (i, v) { |
|
|
self.push(v); |
|
|
}); |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.array.clear(); |
|
|
} |
|
|
}; |
|
|
})();!(function () { |
|
|
var Section = function (height, width, x, y) { |
|
|
this.height = height; |
|
|
this.width = width; |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
|
|
|
this._indexMap = {}; |
|
|
this._indices = []; |
|
|
}; |
|
|
|
|
|
Section.prototype = { |
|
|
constructor: Section, |
|
|
addCellIndex: function (index) { |
|
|
if (!this._indexMap[index]) { |
|
|
this._indexMap[index] = true; |
|
|
this._indices.push(index); |
|
|
} |
|
|
}, |
|
|
|
|
|
getCellIndices: function () { |
|
|
return this._indices; |
|
|
} |
|
|
}; |
|
|
|
|
|
var SECTION_SIZE = 100; |
|
|
BI.SectionManager = function (sectionSize) { |
|
|
this._sectionSize = sectionSize || SECTION_SIZE; |
|
|
this._cellMetadata = []; |
|
|
this._sections = {}; |
|
|
}; |
|
|
|
|
|
BI.SectionManager.prototype = { |
|
|
constructor: BI.SectionManager, |
|
|
getCellIndices: function (height, width, x, y) { |
|
|
var indices = {}; |
|
|
|
|
|
BI.each(this.getSections(height, width, x, y), function (i, section) { |
|
|
BI.each(section.getCellIndices(), function (j, index) { |
|
|
indices[index] = index; |
|
|
}); |
|
|
}); |
|
|
|
|
|
return BI.map(BI.keys(indices), function (i, index) { |
|
|
return indices[index]; |
|
|
}); |
|
|
}, |
|
|
|
|
|
getCellMetadata: function (index) { |
|
|
return this._cellMetadata[index]; |
|
|
}, |
|
|
|
|
|
getSections: function (height, width, x, y) { |
|
|
var sectionXStart = Math.floor(x / this._sectionSize); |
|
|
var sectionXStop = Math.floor((x + width - 1) / this._sectionSize); |
|
|
var sectionYStart = Math.floor(y / this._sectionSize); |
|
|
var sectionYStop = Math.floor((y + height - 1) / this._sectionSize); |
|
|
|
|
|
var sections = []; |
|
|
|
|
|
for (var sectionX = sectionXStart; sectionX <= sectionXStop; sectionX++) { |
|
|
for (var sectionY = sectionYStart; sectionY <= sectionYStop; sectionY++) { |
|
|
var key = sectionX + "." + sectionY; |
|
|
|
|
|
if (!this._sections[key]) { |
|
|
this._sections[key] = new Section(this._sectionSize, this._sectionSize, sectionX * this._sectionSize, sectionY * this._sectionSize); |
|
|
} |
|
|
|
|
|
sections.push(this._sections[key]); |
|
|
} |
|
|
} |
|
|
|
|
|
return sections; |
|
|
}, |
|
|
|
|
|
getTotalSectionCount: function () { |
|
|
return BI.size(this._sections); |
|
|
}, |
|
|
|
|
|
registerCell: function (cellMetadatum, index) { |
|
|
this._cellMetadata[index] = cellMetadatum; |
|
|
|
|
|
BI.each(this.getSections(cellMetadatum.height, cellMetadatum.width, cellMetadatum.x, cellMetadatum.y), function (i, section) { |
|
|
section.addCellIndex(index); |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
(function () { |
|
|
var clamp = function (value, min, max) { |
|
|
if (value < min) { |
|
|
return min; |
|
|
} |
|
|
if (value > max) { |
|
|
return max; |
|
|
} |
|
|
return value; |
|
|
}; |
|
|
var MIN_BUFFER_ROWS = 6; |
|
|
var MAX_BUFFER_ROWS = 10; |
|
|
|
|
|
BI.TableRowBuffer = function (rowsCount, |
|
|
defaultRowHeight, |
|
|
viewportHeight, |
|
|
rowHeightGetter) { |
|
|
this._bufferSet = new BI.IntegerBufferSet(); |
|
|
this._defaultRowHeight = defaultRowHeight; |
|
|
this._viewportRowsBegin = 0; |
|
|
this._viewportRowsEnd = 0; |
|
|
this._maxVisibleRowCount = Math.ceil(viewportHeight / defaultRowHeight) + 1; |
|
|
// this._bufferRowsCount = Math.floor(this._maxVisibleRowCount / 2); |
|
|
this._bufferRowsCount = clamp( |
|
|
Math.floor(this._maxVisibleRowCount / 2), |
|
|
MIN_BUFFER_ROWS, |
|
|
MAX_BUFFER_ROWS |
|
|
); |
|
|
this._rowsCount = rowsCount; |
|
|
this._rowHeightGetter = rowHeightGetter; |
|
|
this._rows = []; |
|
|
this._viewportHeight = viewportHeight; |
|
|
|
|
|
}; |
|
|
BI.TableRowBuffer.prototype = { |
|
|
constructor: BI.TableRowBuffer, |
|
|
|
|
|
getRowsWithUpdatedBuffer: function () { |
|
|
var remainingBufferRows = 2 * this._bufferRowsCount; |
|
|
var bufferRowIndex = |
|
|
Math.max(this._viewportRowsBegin - this._bufferRowsCount, 0); |
|
|
while (bufferRowIndex < this._viewportRowsBegin) { |
|
|
this._addRowToBuffer( |
|
|
bufferRowIndex, |
|
|
this._viewportRowsBegin, |
|
|
this._viewportRowsEnd - 1 |
|
|
); |
|
|
bufferRowIndex++; |
|
|
remainingBufferRows--; |
|
|
} |
|
|
bufferRowIndex = this._viewportRowsEnd; |
|
|
while (bufferRowIndex < this._rowsCount && remainingBufferRows > 0) { |
|
|
this._addRowToBuffer( |
|
|
bufferRowIndex, |
|
|
this._viewportRowsBegin, |
|
|
this._viewportRowsEnd - 1 |
|
|
); |
|
|
bufferRowIndex++; |
|
|
remainingBufferRows--; |
|
|
} |
|
|
return this._rows; |
|
|
}, |
|
|
|
|
|
getRows: function (firstRowIndex, |
|
|
firstRowOffset) { |
|
|
var top = firstRowOffset; |
|
|
var totalHeight = top; |
|
|
var rowIndex = firstRowIndex; |
|
|
var endIndex = |
|
|
Math.min(firstRowIndex + this._maxVisibleRowCount, this._rowsCount); |
|
|
|
|
|
this._viewportRowsBegin = firstRowIndex; |
|
|
while (rowIndex < endIndex || |
|
|
(totalHeight < this._viewportHeight && rowIndex < this._rowsCount)) { |
|
|
this._addRowToBuffer( |
|
|
rowIndex, |
|
|
firstRowIndex, |
|
|
endIndex - 1 |
|
|
); |
|
|
totalHeight += this._rowHeightGetter(rowIndex); |
|
|
++rowIndex; |
|
|
// Store index after the last viewport row as end, to be able to |
|
|
// distinguish when there are no rows rendered in viewport |
|
|
this._viewportRowsEnd = rowIndex; |
|
|
} |
|
|
|
|
|
return this._rows; |
|
|
}, |
|
|
|
|
|
_addRowToBuffer: function (rowIndex, |
|
|
firstViewportRowIndex, |
|
|
lastViewportRowIndex) { |
|
|
var rowPosition = this._bufferSet.getValuePosition(rowIndex); |
|
|
var viewportRowsCount = lastViewportRowIndex - firstViewportRowIndex + 1; |
|
|
var allowedRowsCount = viewportRowsCount + this._bufferRowsCount * 2; |
|
|
if (rowPosition === null && |
|
|
this._bufferSet.getSize() >= allowedRowsCount) { |
|
|
rowPosition = |
|
|
this._bufferSet.replaceFurthestValuePosition( |
|
|
firstViewportRowIndex, |
|
|
lastViewportRowIndex, |
|
|
rowIndex |
|
|
); |
|
|
} |
|
|
if (rowPosition === null) { |
|
|
// We can't reuse any of existing positions for this row. We have to |
|
|
// create new position |
|
|
rowPosition = this._bufferSet.getNewPositionForValue(rowIndex); |
|
|
this._rows[rowPosition] = rowIndex; |
|
|
} else { |
|
|
// This row already is in the table with rowPosition position or it |
|
|
// can replace row that is in that position |
|
|
this._rows[rowPosition] = rowIndex; |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
})(); |
|
|
|
|
|
(function () { |
|
|
BI.Tree = function () { |
|
|
this.root = new BI.Node(BI.UUID()); |
|
|
}; |
|
|
|
|
|
BI.Tree.prototype = { |
|
|
constructor: BI.Tree, |
|
|
addNode: function (node, newNode, index) { |
|
|
if (BI.isNull(newNode)) { |
|
|
this.root.addChild(node, index); |
|
|
} else if (BI.isNull(node)) { |
|
|
this.root.addChild(newNode, index); |
|
|
} else { |
|
|
node.addChild(newNode, index); |
|
|
} |
|
|
}, |
|
|
|
|
|
isRoot: function (node) { |
|
|
return node === this.root; |
|
|
}, |
|
|
|
|
|
getRoot: function () { |
|
|
return this.root; |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.root.clear(); |
|
|
}, |
|
|
|
|
|
initTree: function (nodes) { |
|
|
var self = this; |
|
|
this.clear(); |
|
|
var queue = []; |
|
|
BI.each(nodes, function (i, node) { |
|
|
var n = new BI.Node(node); |
|
|
n.set("data", node); |
|
|
self.addNode(n); |
|
|
queue.push(n); |
|
|
}); |
|
|
while (!BI.isEmpty(queue)) { |
|
|
var parent = queue.shift(); |
|
|
var node = parent.get("data"); |
|
|
BI.each(node.children, function (i, child) { |
|
|
var n = new BI.Node(child); |
|
|
n.set("data", child); |
|
|
queue.push(n); |
|
|
self.addNode(parent, n); |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
_toJSON: function (node) { |
|
|
var self = this; |
|
|
var children = []; |
|
|
BI.each(node.getChildren(), function (i, child) { |
|
|
children.push(self._toJSON(child)); |
|
|
}); |
|
|
return BI.extend({ |
|
|
id: node.id |
|
|
}, BI.deepClone(node.get("data")), (children.length > 0 ? { |
|
|
children: children |
|
|
} : {})); |
|
|
}, |
|
|
|
|
|
toJSON: function (node) { |
|
|
var self = this, result = []; |
|
|
BI.each((node || this.root).getChildren(), function (i, child) { |
|
|
result.push(self._toJSON(child)); |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
_toJSONWithNode: function (node) { |
|
|
var self = this; |
|
|
var children = []; |
|
|
BI.each(node.getChildren(), function (i, child) { |
|
|
children.push(self._toJSONWithNode(child)); |
|
|
}); |
|
|
return BI.extend({ |
|
|
id: node.id |
|
|
}, BI.deepClone(node.get("data")), { |
|
|
node: node |
|
|
}, (children.length > 0 ? { |
|
|
children: children |
|
|
} : {})); |
|
|
}, |
|
|
|
|
|
toJSONWithNode: function (node) { |
|
|
var self = this, result = []; |
|
|
BI.each((node || this.root).getChildren(), function (i, child) { |
|
|
result.push(self._toJSONWithNode(child)); |
|
|
}); |
|
|
return result; |
|
|
}, |
|
|
|
|
|
search: function (root, target, param) { |
|
|
if (!(root instanceof BI.Node)) { |
|
|
return arguments.callee.apply(this, [this.root, root, target]); |
|
|
} |
|
|
var self = this, next = null; |
|
|
|
|
|
if (BI.isNull(target)) { |
|
|
return null; |
|
|
} |
|
|
if (BI.isEqual(root[param || "id"], target)) { |
|
|
return root; |
|
|
} |
|
|
BI.any(root.getChildren(), function (i, child) { |
|
|
next = self.search(child, target, param); |
|
|
if (null !== next) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
return next; |
|
|
}, |
|
|
|
|
|
_traverse: function (node, callback) { |
|
|
var queue = []; |
|
|
queue.push(node); |
|
|
while (!BI.isEmpty(queue)) { |
|
|
var temp = queue.shift(); |
|
|
var b = callback && callback(temp); |
|
|
if (b === false) { |
|
|
break; |
|
|
} |
|
|
if (b === true) { |
|
|
continue; |
|
|
} |
|
|
if (temp != null) { |
|
|
queue = queue.concat(temp.getChildren()); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
traverse: function (callback) { |
|
|
this._traverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
_recursion: function (node, route, callback) { |
|
|
var self = this; |
|
|
return BI.every(node.getChildren(), function (i, child) { |
|
|
var next = BI.clone(route); |
|
|
next.push(child.id); |
|
|
var b = callback && callback(child, next); |
|
|
if (b === false) { |
|
|
return false; |
|
|
} |
|
|
if (b === true) { |
|
|
return true; |
|
|
} |
|
|
return self._recursion(child, next, callback); |
|
|
}); |
|
|
}, |
|
|
|
|
|
recursion: function (callback) { |
|
|
this._recursion(this.root, [], callback); |
|
|
}, |
|
|
|
|
|
inOrderTraverse: function (callback) { |
|
|
this._inOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 中序遍历(递归) |
|
|
_inOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
this._inOrderTraverse(node.getLeft()); |
|
|
callback && callback(node); |
|
|
this._inOrderTraverse(node.getRight()); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 中序遍历(非递归) |
|
|
nrInOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
while (node != null) { |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
node = stack.pop(); |
|
|
callback && callback(node); |
|
|
node = node.getRight(); |
|
|
} |
|
|
}, |
|
|
|
|
|
preOrderTraverse: function (callback) { |
|
|
this._preOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 先序遍历(递归) |
|
|
_preOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
callback && callback(node); |
|
|
this._preOrderTraverse(node.getLeft()); |
|
|
this._preOrderTraverse(node.getRight()); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 先序遍历(非递归) |
|
|
nrPreOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
|
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
|
|
|
while (node != null) { |
|
|
callback && callback(node); |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
node = stack.pop(); |
|
|
node = node.getRight(); |
|
|
} |
|
|
}, |
|
|
|
|
|
postOrderTraverse: function (callback) { |
|
|
this._postOrderTraverse(this.root, callback); |
|
|
}, |
|
|
|
|
|
// 后序遍历(递归) |
|
|
_postOrderTraverse: function (node, callback) { |
|
|
if (node != null) { |
|
|
this._postOrderTraverse(node.getLeft()); |
|
|
this._postOrderTraverse(node.getRight()); |
|
|
callback && callback(node); |
|
|
} |
|
|
}, |
|
|
|
|
|
// 后续遍历(非递归) |
|
|
nrPostOrderTraverse: function (callback) { |
|
|
|
|
|
var stack = []; |
|
|
var node = this.root; |
|
|
var preNode = null;// 表示最近一次访问的节点 |
|
|
|
|
|
while (node != null || !BI.isEmpty(stack)) { |
|
|
|
|
|
while (node != null) { |
|
|
stack.push(node); |
|
|
node = node.getLeft(); |
|
|
} |
|
|
|
|
|
node = BI.last(stack); |
|
|
|
|
|
if (node.getRight() == null || node.getRight() == preNode) { |
|
|
callback && callback(node); |
|
|
node = stack.pop(); |
|
|
preNode = node; |
|
|
node = null; |
|
|
} else { |
|
|
node = node.getRight(); |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Node = function (id) { |
|
|
if (BI.isObject(id)) { |
|
|
BI.extend(this, id); |
|
|
} else { |
|
|
this.id = id; |
|
|
} |
|
|
this.clear.apply(this, arguments); |
|
|
}; |
|
|
|
|
|
BI.Node.prototype = { |
|
|
constructor: BI.Node, |
|
|
|
|
|
set: function (key, value) { |
|
|
if (BI.isObject(key)) { |
|
|
BI.extend(this, key); |
|
|
return; |
|
|
} |
|
|
this[key] = value; |
|
|
}, |
|
|
|
|
|
get: function (key) { |
|
|
return this[key]; |
|
|
}, |
|
|
|
|
|
isLeaf: function () { |
|
|
return BI.isEmpty(this.children); |
|
|
}, |
|
|
|
|
|
getChildren: function () { |
|
|
return this.children; |
|
|
}, |
|
|
|
|
|
getChildrenLength: function () { |
|
|
return this.children.length; |
|
|
}, |
|
|
|
|
|
getFirstChild: function () { |
|
|
return BI.first(this.children); |
|
|
}, |
|
|
|
|
|
getLastChild: function () { |
|
|
return BI.last(this.children); |
|
|
}, |
|
|
|
|
|
setLeft: function (left) { |
|
|
this.left = left; |
|
|
}, |
|
|
|
|
|
getLeft: function () { |
|
|
return this.left; |
|
|
}, |
|
|
|
|
|
setRight: function (right) { |
|
|
this.right = right; |
|
|
}, |
|
|
|
|
|
getRight: function () { |
|
|
return this.right; |
|
|
}, |
|
|
|
|
|
setParent: function (parent) { |
|
|
this.parent = parent; |
|
|
}, |
|
|
|
|
|
getParent: function () { |
|
|
return this.parent; |
|
|
}, |
|
|
|
|
|
getChild: function (index) { |
|
|
return this.children[index]; |
|
|
}, |
|
|
|
|
|
getChildIndex: function (id) { |
|
|
return BI.findIndex(this.children, function (i, ch) { |
|
|
return ch.get("id") === id; |
|
|
}); |
|
|
}, |
|
|
|
|
|
removeChild: function (id) { |
|
|
this.removeChildByIndex(this.getChildIndex(id)); |
|
|
}, |
|
|
|
|
|
removeChildByIndex: function (index) { |
|
|
var before = this.getChild(index - 1); |
|
|
var behind = this.getChild(index + 1); |
|
|
if (before != null) { |
|
|
before.setRight(behind || null); |
|
|
} |
|
|
if (behind != null) { |
|
|
behind.setLeft(before || null); |
|
|
} |
|
|
this.children.splice(index, 1); |
|
|
}, |
|
|
|
|
|
removeAllChilds: function () { |
|
|
this.children = []; |
|
|
}, |
|
|
|
|
|
addChild: function (child, index) { |
|
|
var cur = null; |
|
|
if (BI.isUndefined(index)) { |
|
|
cur = this.children.length - 1; |
|
|
} else { |
|
|
cur = index - 1; |
|
|
} |
|
|
child.setParent(this); |
|
|
if (cur >= 0) { |
|
|
this.getChild(cur) && this.getChild(cur).setRight(child); |
|
|
child.setLeft(this.getChild(cur)); |
|
|
} |
|
|
if (BI.isUndefined(index)) { |
|
|
this.children.push(child); |
|
|
} else { |
|
|
this.children.splice(index, 0, child); |
|
|
} |
|
|
}, |
|
|
|
|
|
equals: function (obj) { |
|
|
return this === obj || this.id === obj.id; |
|
|
}, |
|
|
|
|
|
clear: function () { |
|
|
this.parent = null; |
|
|
this.left = null; |
|
|
this.right = null; |
|
|
this.children = []; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.extend(BI.Tree, { |
|
|
transformToArrayFormat: function (nodes, pId) { |
|
|
if (!nodes) return []; |
|
|
var r = []; |
|
|
if (BI.isArray(nodes)) { |
|
|
for (var i = 0, l = nodes.length; i < l; i++) { |
|
|
var node = BI.clone(nodes[i]); |
|
|
node.pId = node.pId == null ? pId : node.pId; |
|
|
delete node.children; |
|
|
r.push(node); |
|
|
if (nodes[i]["children"]) { |
|
|
r = r.concat(BI.Tree.transformToArrayFormat(nodes[i]["children"], node.id)); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var newNodes = BI.clone(nodes); |
|
|
newNodes.pId = newNodes.pId == null ? pId : newNodes.pId; |
|
|
delete newNodes.children; |
|
|
r.push(newNodes); |
|
|
if (nodes["children"]) { |
|
|
r = r.concat(BI.Tree.transformToArrayFormat(nodes["children"], newNodes.id)); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
}, |
|
|
|
|
|
arrayFormat: function (nodes, pId) { |
|
|
if (!nodes) { |
|
|
return []; |
|
|
} |
|
|
var r = []; |
|
|
if (BI.isArray(nodes)) { |
|
|
for (var i = 0, l = nodes.length; i < l; i++) { |
|
|
var node = nodes[i]; |
|
|
node.pId = node.pId == null ? pId : node.pId; |
|
|
r.push(node); |
|
|
if (nodes[i]["children"]) { |
|
|
r = r.concat(BI.Tree.arrayFormat(nodes[i]["children"], node.id)); |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var newNodes = nodes; |
|
|
newNodes.pId = newNodes.pId == null ? pId : newNodes.pId; |
|
|
r.push(newNodes); |
|
|
if (nodes["children"]) { |
|
|
r = r.concat(BI.Tree.arrayFormat(nodes["children"], newNodes.id)); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
}, |
|
|
|
|
|
transformToTreeFormat: function (sNodes) { |
|
|
var i, l; |
|
|
if (!sNodes) { |
|
|
return []; |
|
|
} |
|
|
|
|
|
if (BI.isArray(sNodes)) { |
|
|
var r = []; |
|
|
var tmpMap = []; |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (BI.isNull(sNodes[i].id)) { |
|
|
return sNodes; |
|
|
} |
|
|
tmpMap[sNodes[i].id] = BI.clone(sNodes[i]); |
|
|
} |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) { |
|
|
if (!tmpMap[sNodes[i].pId].children) { |
|
|
tmpMap[sNodes[i].pId].children = []; |
|
|
} |
|
|
tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]); |
|
|
} else { |
|
|
r.push(tmpMap[sNodes[i].id]); |
|
|
} |
|
|
delete tmpMap[sNodes[i].id].pId; |
|
|
} |
|
|
return r; |
|
|
} |
|
|
return [sNodes]; |
|
|
|
|
|
}, |
|
|
|
|
|
treeFormat: function (sNodes) { |
|
|
var i, l; |
|
|
if (!sNodes) { |
|
|
return []; |
|
|
} |
|
|
|
|
|
if (BI.isArray(sNodes)) { |
|
|
var r = []; |
|
|
var tmpMap = []; |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (BI.isNull(sNodes[i].id)) { |
|
|
return sNodes; |
|
|
} |
|
|
tmpMap[sNodes[i].id] = sNodes[i]; |
|
|
} |
|
|
for (i = 0, l = sNodes.length; i < l; i++) { |
|
|
if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) { |
|
|
if (!tmpMap[sNodes[i].pId].children) { |
|
|
tmpMap[sNodes[i].pId].children = []; |
|
|
} |
|
|
tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]); |
|
|
} else { |
|
|
r.push(tmpMap[sNodes[i].id]); |
|
|
} |
|
|
} |
|
|
return r; |
|
|
} |
|
|
return [sNodes]; |
|
|
|
|
|
}, |
|
|
|
|
|
traversal: function (array, callback) { |
|
|
if (BI.isNull(array)) { |
|
|
return; |
|
|
} |
|
|
var self = this; |
|
|
BI.any(array, function (i, item) { |
|
|
if (callback(i, item) === false) { |
|
|
return true; |
|
|
} |
|
|
self.traversal(item.children, callback); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
})();// 向量操作 |
|
|
BI.Vector = function (x, y) { |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
}; |
|
|
BI.Vector.prototype = { |
|
|
constructor: BI.Vector, |
|
|
cross: function (v) { |
|
|
return (this.x * v.y - this.y * v.x); |
|
|
}, |
|
|
length: function (v) { |
|
|
return (Math.sqrt(this.x * v.x + this.y * v.y)); |
|
|
} |
|
|
}; |
|
|
BI.Region = function (x, y, w, h) { |
|
|
this.x = x; |
|
|
this.y = y; |
|
|
this.w = w; |
|
|
this.h = h; |
|
|
}; |
|
|
BI.Region.prototype = { |
|
|
constructor: BI.Region, |
|
|
// 判断两个区域是否相交,若相交,则要么顶点互相包含,要么矩形边界(或对角线)相交 |
|
|
isIntersects: function (obj) { |
|
|
if (this.isPointInside(obj.x, obj.y) || |
|
|
this.isPointInside(obj.x + obj.w, obj.y) || |
|
|
this.isPointInside(obj.x, obj.y + obj.h) || |
|
|
this.isPointInside(obj.x + obj.w, obj.y + obj.h)) { |
|
|
return true; |
|
|
} else if (obj.isPointInside(this.x, this.y) || |
|
|
obj.isPointInside(this.x + this.w, this.y) || |
|
|
obj.isPointInside(this.x, this.y + this.h) || |
|
|
obj.isPointInside(this.x + this.w, this.y + this.h)) { |
|
|
return true; |
|
|
} else if (obj.x != null && obj.y != null)// 判断矩形对角线相交 |v1 X v2||v1 X v3| < 0 |
|
|
{ |
|
|
var vector1 = new BI.Vector(this.w, this.h);// 矩形对角线向量 |
|
|
var vector2 = new BI.Vector(obj.x - this.x, obj.y - this.y); |
|
|
var vector3 = new BI.Vector(vector2.x + obj.w, vector2.y + obj.h); |
|
|
if ((vector1.cross(vector2) * vector1.cross(vector3)) < 0) { |
|
|
return true; |
|
|
} |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
// 判断一个点是否在这个区域内部 |
|
|
isPointInside: function (x, y) { |
|
|
if (this.x == null || this.y == null) { |
|
|
return false; |
|
|
} |
|
|
if (x >= this.x && x <= this.x + this.w && y >= this.y && y <= this.y + this.h) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
// 返回区域的重心,因为是矩形所以返回中点 |
|
|
getPosition: function () { |
|
|
var pos = []; |
|
|
pos.push(this.x + this.w / 2); |
|
|
pos.push(this.y + this.h / 2); |
|
|
return pos; |
|
|
} |
|
|
};BI.BehaviorFactory = { |
|
|
createBehavior: function (key, options) { |
|
|
var behavior; |
|
|
switch (key) { |
|
|
case "highlight": |
|
|
behavior = BI.HighlightBehavior; |
|
|
break; |
|
|
case "redmark": |
|
|
behavior = BI.RedMarkBehavior; |
|
|
break; |
|
|
} |
|
|
return new behavior(options); |
|
|
} |
|
|
}; |
|
|
|
|
|
/** |
|
|
* guy |
|
|
* 行为控件 |
|
|
* @class BI.Behavior |
|
|
* @extends BI.OB |
|
|
*/ |
|
|
BI.Behavior = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.Behavior.superclass._defaultConfig.apply(this, arguments), { |
|
|
rule: function () {return true;} |
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.Behavior.superclass._init.apply(this, arguments); |
|
|
|
|
|
}, |
|
|
|
|
|
doBehavior: function () { |
|
|
|
|
|
} |
|
|
});/** |
|
|
* 布局容器类 |
|
|
* @class BI.Layout |
|
|
* @extends BI.Widget |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
* @cfg {Boolean} [options.scrollable=false] 子组件超出容器边界之后是否会出现滚动条 |
|
|
* @cfg {Boolean} [options.scrollx=false] 子组件超出容器边界之后是否会出现横向滚动条 |
|
|
* @cfg {Boolean} [options.scrolly=false] 子组件超出容器边界之后是否会出现纵向滚动条 |
|
|
*/ |
|
|
BI.Layout = BI.inherit(BI.Widget, { |
|
|
props: function () { |
|
|
return { |
|
|
scrollable: null, // true, false, null |
|
|
scrollx: false, // true, false |
|
|
scrolly: false, // true, false |
|
|
items: [] |
|
|
}; |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
this._init4Margin(); |
|
|
this._init4Scroll(); |
|
|
}, |
|
|
|
|
|
_init4Margin: function () { |
|
|
if (this.options.top) { |
|
|
this.element.css("top", this.options.top); |
|
|
} |
|
|
if (this.options.left) { |
|
|
this.element.css("left", this.options.left); |
|
|
} |
|
|
if (this.options.bottom) { |
|
|
this.element.css("bottom", this.options.bottom); |
|
|
} |
|
|
if (this.options.right) { |
|
|
this.element.css("right", this.options.right); |
|
|
} |
|
|
}, |
|
|
|
|
|
_init4Scroll: function () { |
|
|
switch (this.options.scrollable) { |
|
|
case true: |
|
|
this.element.css("overflow", "auto"); |
|
|
break; |
|
|
case false: |
|
|
this.element.css("overflow", "hidden"); |
|
|
break; |
|
|
default : |
|
|
break; |
|
|
} |
|
|
if (this.options.scrollx) { |
|
|
this.element.css({ |
|
|
"overflow-x": "auto", |
|
|
"overflow-y": "hidden" |
|
|
}); |
|
|
} |
|
|
if (this.options.scrolly) { |
|
|
this.element.css({ |
|
|
"overflow-x": "hidden", |
|
|
"overflow-y": "auto" |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.element.append(frag); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getChildName: function (index) { |
|
|
return index + ""; |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var self = this, w; |
|
|
if (!this.hasWidget(this._getChildName(i))) { |
|
|
w = BI.createWidget(item); |
|
|
w.on(BI.Events.DESTROY, function () { |
|
|
BI.each(self._children, function (name, child) { |
|
|
if (child === w) { |
|
|
BI.remove(self._children, child); |
|
|
self.removeItemAt(name | 0); |
|
|
} |
|
|
}); |
|
|
}); |
|
|
this.addWidget(this._getChildName(i), w); |
|
|
} else { |
|
|
w = this.getWidgetByName(this._getChildName(i)); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
_getOptions: function (item) { |
|
|
if (item instanceof BI.Widget) { |
|
|
item = item.options; |
|
|
} |
|
|
item = BI.stripEL(item); |
|
|
if (item instanceof BI.Widget) { |
|
|
item = item.options; |
|
|
} |
|
|
return item; |
|
|
}, |
|
|
|
|
|
_compare: function (item1, item2) { |
|
|
var self = this; |
|
|
return eq(item1, item2); |
|
|
|
|
|
// 不比较函数 |
|
|
function eq (a, b, aStack, bStack) { |
|
|
if (a === b) { |
|
|
return a !== 0 || 1 / a === 1 / b; |
|
|
} |
|
|
if (a == null || b == null) { |
|
|
return a === b; |
|
|
} |
|
|
var className = Object.prototype.toString.call(a); |
|
|
switch (className) { |
|
|
case "[object RegExp]": |
|
|
case "[object String]": |
|
|
return "" + a === "" + b; |
|
|
case "[object Number]": |
|
|
if (+a !== +a) { |
|
|
return +b !== +b; |
|
|
} |
|
|
return +a === 0 ? 1 / +a === 1 / b : +a === +b; |
|
|
case "[object Date]": |
|
|
case "[object Boolean]": |
|
|
return +a === +b; |
|
|
} |
|
|
|
|
|
var areArrays = className === "[object Array]"; |
|
|
if (!areArrays) { |
|
|
if (BI.isFunction(a) && BI.isFunction(b)) { |
|
|
return true; |
|
|
} |
|
|
a = self._getOptions(a); |
|
|
b = self._getOptions(b); |
|
|
} |
|
|
|
|
|
aStack = aStack || []; |
|
|
bStack = bStack || []; |
|
|
var length = aStack.length; |
|
|
while (length--) { |
|
|
if (aStack[length] === a) { |
|
|
return bStack[length] === b; |
|
|
} |
|
|
} |
|
|
|
|
|
aStack.push(a); |
|
|
bStack.push(b); |
|
|
|
|
|
if (areArrays) { |
|
|
length = a.length; |
|
|
if (length !== b.length) { |
|
|
return false; |
|
|
} |
|
|
while (length--) { |
|
|
if (!eq(a[length], b[length], aStack, bStack)) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} else { |
|
|
var keys = _.keys(a), key; |
|
|
length = keys.length; |
|
|
if (_.keys(b).length !== length) { |
|
|
return false; |
|
|
} |
|
|
while (length--) { |
|
|
key = keys[length]; |
|
|
if (!(_.has(b, key) && eq(a[key], b[key], aStack, bStack))) { |
|
|
return false; |
|
|
} |
|
|
} |
|
|
} |
|
|
aStack.pop(); |
|
|
bStack.pop(); |
|
|
return true; |
|
|
} |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.element; |
|
|
}, |
|
|
|
|
|
_addItemAt: function (index, item) { |
|
|
for (var i = this.options.items.length; i > index; i--) { |
|
|
this._children[this._getChildName(i)] = this._children[this._getChildName(i - 1)]; |
|
|
} |
|
|
delete this._children[this._getChildName(index)]; |
|
|
this.options.items.splice(index, 0, item); |
|
|
}, |
|
|
|
|
|
_removeItemAt: function (index) { |
|
|
for (var i = index; i < this.options.items.length - 1; i++) { |
|
|
this._children[this._getChildName(i)] = this._children[this._getChildName(i + 1)]; |
|
|
} |
|
|
delete this._children[this._getChildName(this.options.items.length - 1)]; |
|
|
this.options.items.splice(index, 1); |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 添加一个子组件到容器中 |
|
|
* @param {JSON/BI.Widget} item 子组件 |
|
|
*/ |
|
|
addItem: function (item) { |
|
|
return this.addItemAt(this.options.items.length, item); |
|
|
}, |
|
|
|
|
|
prependItem: function (item) { |
|
|
return this.addItemAt(0, item); |
|
|
}, |
|
|
|
|
|
addItemAt: function (index, item) { |
|
|
if (index < 0 || index > this.options.items.length) { |
|
|
return; |
|
|
} |
|
|
this._addItemAt(index, item); |
|
|
var w = this._addElement(index, item); |
|
|
if (index > 0) { |
|
|
this._children[this._getChildName(index - 1)].element.after(w.element); |
|
|
} else { |
|
|
w.element.prependTo(this._getWrapper()); |
|
|
} |
|
|
w._mount(); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
removeItemAt: function (indexes) { |
|
|
indexes = BI.isArray(indexes) ? indexes : [indexes]; |
|
|
var deleted = []; |
|
|
var newItems = [], newChildren = {}; |
|
|
for (var i = 0, len = this.options.items.length; i < len; i++) { |
|
|
var child = this._children[this._getChildName(i)]; |
|
|
if (indexes.contains(i)) { |
|
|
child && deleted.push(child); |
|
|
} else { |
|
|
newChildren[this._getChildName(newItems.length)] = child; |
|
|
newItems.push(this.options.items[i]); |
|
|
} |
|
|
} |
|
|
this.options.items = newItems; |
|
|
this._children = newChildren; |
|
|
BI.each(deleted, function (i, c) { |
|
|
c._destroy(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
shouldUpdateItem: function (index, item) { |
|
|
if (index < 0 || index > this.options.items.length - 1) { |
|
|
return false; |
|
|
} |
|
|
var child = this._children[this._getChildName(index)]; |
|
|
if (!child.shouldUpdate) { |
|
|
return null; |
|
|
} |
|
|
return child.shouldUpdate(this._getOptions(item)) === true; |
|
|
}, |
|
|
|
|
|
updateItemAt: function (index, item) { |
|
|
if (index < 0 || index > this.options.items.length - 1) { |
|
|
return; |
|
|
} |
|
|
|
|
|
var child = this._children[this._getChildName(index)]; |
|
|
var updated; |
|
|
if (updated = child.update(this._getOptions(item))) { |
|
|
return updated; |
|
|
} |
|
|
var del = this._children[this._getChildName(index)]; |
|
|
delete this._children[this._getChildName(index)]; |
|
|
this.options.items.splice(index, 1); |
|
|
var w = this._addElement(index, item); |
|
|
this.options.items.splice(index, 0, item); |
|
|
this._children[this._getChildName(index)] = w; |
|
|
if (index > 0) { |
|
|
this._children[this._getChildName(index - 1)].element.after(w.element); |
|
|
} else { |
|
|
w.element.prependTo(this._getWrapper()); |
|
|
} |
|
|
del._destroy(); |
|
|
w._mount(); |
|
|
}, |
|
|
|
|
|
addItems: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var fragment = document.createDocumentFragment(); |
|
|
var added = []; |
|
|
BI.each(items, function (i, item) { |
|
|
var w = self._addElement(o.items.length, item); |
|
|
self._children[self._getChildName(o.items.length)] = w; |
|
|
o.items.push(item); |
|
|
added.push(w); |
|
|
fragment.appendChild(w.element[0]); |
|
|
}); |
|
|
this._getWrapper().append(fragment); |
|
|
BI.each(added, function (i, w) { |
|
|
w._mount(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
prependItems: function (items) { |
|
|
var self = this; |
|
|
items = items || []; |
|
|
var fragment = document.createDocumentFragment(); |
|
|
var added = []; |
|
|
for (var i = items.length - 1; i >= 0; i--) { |
|
|
this._addItemAt(0, items[i]); |
|
|
var w = this._addElement(0, items[i]); |
|
|
self._children[self._getChildName(0)] = w; |
|
|
this.options.items.unshift(items[i]); |
|
|
added.push(w); |
|
|
fragment.appendChild(w.element[0]); |
|
|
} |
|
|
this._getWrapper().prepend(fragment); |
|
|
BI.each(added, function (i, w) { |
|
|
w._mount(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
getValue: function () { |
|
|
var self = this, value = [], child; |
|
|
BI.each(this.options.items, function (i) { |
|
|
if (child = self._children[self._getChildName(i)]) { |
|
|
var v = child.getValue(); |
|
|
v = BI.isArray(v) ? v : [v]; |
|
|
value = value.concat(v); |
|
|
} |
|
|
}); |
|
|
return value; |
|
|
}, |
|
|
|
|
|
setValue: function (v) { |
|
|
var self = this, child; |
|
|
BI.each(this.options.items, function (i) { |
|
|
if (child = self._children[self._getChildName(i)]) { |
|
|
child.setValue(v); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
setText: function (v) { |
|
|
var self = this, child; |
|
|
BI.each(this.options.items, function (i) { |
|
|
if (child = self._children[self._getChildName(i)]) { |
|
|
child.setText(v); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
patchItem: function (oldVnode, vnode, index) { |
|
|
var shouldUpdate = this.shouldUpdateItem(index, vnode); |
|
|
if (shouldUpdate === true || (shouldUpdate === null && !this._compare(oldVnode, vnode))) { |
|
|
return this.updateItemAt(index, vnode); |
|
|
} |
|
|
}, |
|
|
|
|
|
updateChildren: function (oldCh, newCh) { |
|
|
var self = this; |
|
|
var oldStartIdx = 0, newStartIdx = 0; |
|
|
var oldEndIdx = oldCh.length - 1; |
|
|
var oldStartVnode = oldCh[0]; |
|
|
var oldEndVnode = oldCh[oldEndIdx]; |
|
|
var newEndIdx = newCh.length - 1; |
|
|
var newStartVnode = newCh[0]; |
|
|
var newEndVnode = newCh[newEndIdx]; |
|
|
var before; |
|
|
var updated; |
|
|
var children = {}; |
|
|
BI.each(oldCh, function (i, child) { |
|
|
child = self._getOptions(child); |
|
|
var key = child.key == null ? i : child.key; |
|
|
if (BI.isKey(key)) { |
|
|
children[key] = self._children[self._getChildName(i)]; |
|
|
} |
|
|
}); |
|
|
|
|
|
while (oldStartIdx <= oldEndIdx && newStartIdx <= newEndIdx) { |
|
|
if (BI.isNull(oldStartVnode)) { |
|
|
oldStartVnode = oldCh[++oldStartIdx]; |
|
|
} else if (BI.isNull(oldEndVnode)) { |
|
|
oldEndVnode = oldCh[--oldEndIdx]; |
|
|
} else if (sameVnode(oldStartVnode, newStartVnode, oldStartIdx, newStartIdx)) { |
|
|
updated = this.patchItem(oldStartVnode, newStartVnode, oldStartIdx) || updated; |
|
|
children[oldStartVnode.key == null ? this._getChildName(oldStartIdx) : oldStartVnode.key] = this._children[this._getChildName(oldStartIdx)]; |
|
|
oldStartVnode = oldCh[++oldStartIdx]; |
|
|
newStartVnode = newCh[++newStartIdx]; |
|
|
} else if (sameVnode(oldEndVnode, newEndVnode, oldEndIdx, newEndIdx)) { |
|
|
updated = this.patchItem(oldEndVnode, newEndVnode, oldEndIdx) || updated; |
|
|
children[oldEndVnode.key == null ? this._getChildName(oldEndIdx) : oldEndVnode.key] = this._children[this._getChildName(oldEndIdx)]; |
|
|
oldEndVnode = oldCh[--oldEndIdx]; |
|
|
newEndVnode = newCh[--newEndIdx]; |
|
|
} else if (sameVnode(oldStartVnode, newEndVnode)) { |
|
|
updated = this.patchItem(oldStartVnode, newEndVnode, oldStartIdx) || updated; |
|
|
children[oldStartVnode.key == null ? this._getChildName(oldStartIdx) : oldStartVnode.key] = this._children[this._getChildName(oldStartIdx)]; |
|
|
insertBefore(oldStartVnode, oldEndVnode, true); |
|
|
oldStartVnode = oldCh[++oldStartIdx]; |
|
|
newEndVnode = newCh[--newEndIdx]; |
|
|
} else if (sameVnode(oldEndVnode, newStartVnode)) { |
|
|
updated = this.patchItem(oldEndVnode, newStartVnode, oldEndIdx) || updated; |
|
|
children[oldEndVnode.key == null ? this._getChildName(oldEndIdx) : oldEndVnode.key] = this._children[this._getChildName(oldEndIdx)]; |
|
|
insertBefore(oldEndVnode, oldStartVnode); |
|
|
oldEndVnode = oldCh[--oldEndIdx]; |
|
|
newStartVnode = newCh[++newStartIdx]; |
|
|
} else { |
|
|
var node = addNode(newStartVnode); |
|
|
insertBefore(node, oldStartVnode); |
|
|
newStartVnode = newCh[++newStartIdx]; |
|
|
} |
|
|
} |
|
|
if (oldStartIdx > oldEndIdx) { |
|
|
before = BI.isNull(newCh[newEndIdx + 1]) ? null : newCh[newEndIdx + 1].elm; |
|
|
addVnodes(before, newCh, newStartIdx, newEndIdx); |
|
|
} else if (newStartIdx > newEndIdx) { |
|
|
removeVnodes(oldCh, oldStartIdx, oldEndIdx); |
|
|
} |
|
|
|
|
|
this._children = {}; |
|
|
BI.each(newCh, function (i, child) { |
|
|
var node = self._getOptions(child); |
|
|
var key = node.key == null ? i : node.key; |
|
|
children[key]._mount(); |
|
|
self._children[self._getChildName(i)] = children[key]; |
|
|
}); |
|
|
|
|
|
function sameVnode (vnode1, vnode2, oldIndex, newIndex) { |
|
|
vnode1 = self._getOptions(vnode1); |
|
|
vnode2 = self._getOptions(vnode2); |
|
|
if (BI.isKey(vnode1.key)) { |
|
|
return vnode1.key === vnode2.key; |
|
|
} |
|
|
if (oldIndex >= 0) { |
|
|
return oldIndex === newIndex; |
|
|
} |
|
|
} |
|
|
|
|
|
function addNode (vnode, index) { |
|
|
var opt = self._getOptions(vnode); |
|
|
var key = opt.key == null ? index : opt.key; |
|
|
return children[key] = self._addElement(key, vnode); |
|
|
} |
|
|
|
|
|
function addVnodes (before, vnodes, startIdx, endIdx) { |
|
|
for (; startIdx <= endIdx; ++startIdx) { |
|
|
var node = addNode(vnodes[startIdx], startIdx); |
|
|
insertBefore(node, before, false, startIdx); |
|
|
} |
|
|
} |
|
|
|
|
|
function removeVnodes (vnodes, startIdx, endIdx) { |
|
|
for (; startIdx <= endIdx; ++startIdx) { |
|
|
var node = self._getOptions(vnodes[startIdx]); |
|
|
var key = node.key == null ? startIdx : node.key; |
|
|
children[key]._destroy(); |
|
|
} |
|
|
} |
|
|
|
|
|
function insertBefore (insert, before, isNext, index) { |
|
|
insert = self._getOptions(insert); |
|
|
before = before && self._getOptions(before); |
|
|
var insertKey = BI.isKey(insert.key) ? insert.key : index; |
|
|
if (before && children[before.key]) { |
|
|
var beforeKey = BI.isKey(before.key) ? before.key : index; |
|
|
var next; |
|
|
if (isNext) { |
|
|
next = children[beforeKey].element.next(); |
|
|
} else { |
|
|
next = children[beforeKey].element; |
|
|
} |
|
|
if (next.length > 0) { |
|
|
next.before(children[insertKey].element); |
|
|
} else { |
|
|
self._getWrapper().append(children[insertKey].element); |
|
|
} |
|
|
} else { |
|
|
self._getWrapper().append(children[insertKey].element); |
|
|
} |
|
|
} |
|
|
|
|
|
return updated; |
|
|
}, |
|
|
|
|
|
update: function (opt) { |
|
|
var o = this.options; |
|
|
var items = opt.items || []; |
|
|
var updated = this.updateChildren(o.items, items); |
|
|
this.options.items = items; |
|
|
return updated; |
|
|
// var updated, i, len; |
|
|
// for (i = 0, len = Math.min(o.items.length, items.length); i < len; i++) { |
|
|
// if (!this._compare(o.items[i], items[i])) { |
|
|
// updated = this.updateItemAt(i, items[i]) || updated; |
|
|
// } |
|
|
// } |
|
|
// if (o.items.length > items.length) { |
|
|
// var deleted = []; |
|
|
// for (i = items.length; i < o.items.length; i++) { |
|
|
// deleted.push(this._children[this._getChildName(i)]); |
|
|
// delete this._children[this._getChildName(i)]; |
|
|
// } |
|
|
// o.items.splice(items.length); |
|
|
// BI.each(deleted, function (i, w) { |
|
|
// w._destroy(); |
|
|
// }) |
|
|
// } else if (items.length > o.items.length) { |
|
|
// for (i = o.items.length; i < items.length; i++) { |
|
|
// this.addItemAt(i, items[i]); |
|
|
// } |
|
|
// } |
|
|
// return updated; |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this; |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
self._addElement(i, item); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
removeWidget: function (nameOrWidget) { |
|
|
var removeIndex; |
|
|
if (BI.isWidget(nameOrWidget)) { |
|
|
BI.each(this._children, function (name, child) { |
|
|
if (child === nameOrWidget) { |
|
|
removeIndex = name; |
|
|
} |
|
|
}); |
|
|
} else { |
|
|
removeIndex = nameOrWidget; |
|
|
} |
|
|
if (removeIndex) { |
|
|
this._removeItemAt(removeIndex | 0); |
|
|
} |
|
|
}, |
|
|
|
|
|
empty: function () { |
|
|
BI.Layout.superclass.empty.apply(this, arguments); |
|
|
this.options.items = []; |
|
|
}, |
|
|
|
|
|
destroy: function () { |
|
|
BI.Layout.superclass.destroy.apply(this, arguments); |
|
|
this.options.items = []; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
var self = this, o = this.options; |
|
|
items = items || []; |
|
|
if (this._isMounted) { |
|
|
this.update({items: items}); |
|
|
return; |
|
|
} |
|
|
this.options.items = items; |
|
|
this.stroke(items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
|
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.layout", BI.Layout);BI.Plugin = BI.Plugin || {}; |
|
|
!(function () { |
|
|
var _WidgetsPlugin = {}; |
|
|
var _ObjectPlugin = {}; |
|
|
var _ConfigPlugin = {}; |
|
|
var _GlobalWidgetConfigFn, _GlobalObjectConfigFn; |
|
|
BI.extend(BI.Plugin, { |
|
|
|
|
|
getWidget: function (type, options) { |
|
|
if (_GlobalWidgetConfigFn) { |
|
|
_GlobalWidgetConfigFn(type, options); |
|
|
} |
|
|
if (_ConfigPlugin[type]) { |
|
|
for (var i = _ConfigPlugin[type].length - 1; i >= 0; i--) { |
|
|
_ConfigPlugin[type][i](options); |
|
|
} |
|
|
} |
|
|
if (_WidgetsPlugin[type]) { |
|
|
var res; |
|
|
for (var i = _WidgetsPlugin[type].length - 1; i >= 0; i--) { |
|
|
if (res = _WidgetsPlugin[type][i](options)) { |
|
|
return res; |
|
|
} |
|
|
} |
|
|
} |
|
|
return options; |
|
|
}, |
|
|
|
|
|
config: function (widgetConfigFn, objectConfigFn) { |
|
|
_GlobalWidgetConfigFn = widgetConfigFn; |
|
|
_GlobalObjectConfigFn = objectConfigFn; |
|
|
}, |
|
|
|
|
|
configWidget: function (type, fn) { |
|
|
if (!_ConfigPlugin[type]) { |
|
|
_ConfigPlugin[type] = []; |
|
|
} |
|
|
_ConfigPlugin[type].push(fn); |
|
|
}, |
|
|
|
|
|
registerWidget: function (type, fn) { |
|
|
if (!_WidgetsPlugin[type]) { |
|
|
_WidgetsPlugin[type] = []; |
|
|
} |
|
|
if (_WidgetsPlugin[type].length > 0) { |
|
|
console.log("组件已经注册过了!"); |
|
|
} |
|
|
_WidgetsPlugin[type].push(fn); |
|
|
}, |
|
|
|
|
|
relieveWidget: function (type) { |
|
|
delete _WidgetsPlugin[type]; |
|
|
}, |
|
|
|
|
|
getObject: function (type, object) { |
|
|
if (_GlobalObjectConfigFn) { |
|
|
_GlobalObjectConfigFn(type, object); |
|
|
} |
|
|
if (_ObjectPlugin[type]) { |
|
|
var res; |
|
|
for (var i = 0, len = _ObjectPlugin[type].length; i < len; i++) { |
|
|
res = _ObjectPlugin[type][i](object); |
|
|
} |
|
|
} |
|
|
return res || object; |
|
|
}, |
|
|
|
|
|
registerObject: function (type, fn) { |
|
|
if (!_ObjectPlugin[type]) { |
|
|
_ObjectPlugin[type] = []; |
|
|
} |
|
|
if (_ObjectPlugin[type].length > 0) { |
|
|
console.log("对象已经注册过了!"); |
|
|
} |
|
|
_ObjectPlugin[type].push(fn); |
|
|
}, |
|
|
|
|
|
relieveObject: function (type) { |
|
|
delete _ObjectPlugin[type]; |
|
|
} |
|
|
}); |
|
|
})();/** |
|
|
* guy |
|
|
* 由一个元素切换到另一个元素的行为 |
|
|
* @class BI.Action |
|
|
* @extends BI.OB |
|
|
* @abstract |
|
|
*/ |
|
|
BI.Action = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.Action.superclass._defaultConfig.apply(this, arguments), { |
|
|
src: null, |
|
|
tar: null |
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.Action.superclass._init.apply(this, arguments); |
|
|
}, |
|
|
|
|
|
actionPerformed: function (src, tar, callback) { |
|
|
|
|
|
}, |
|
|
|
|
|
actionBack: function (tar, src, callback) { |
|
|
|
|
|
} |
|
|
}); |
|
|
|
|
|
BI.ActionFactory = { |
|
|
createAction: function (key, options) { |
|
|
var action; |
|
|
switch (key) { |
|
|
case "show": |
|
|
action = BI.ShowAction; |
|
|
break; |
|
|
} |
|
|
return new action(options); |
|
|
} |
|
|
};/** |
|
|
* guy |
|
|
* 由一个元素切换到另一个元素的行为 |
|
|
* @class BI.ShowAction |
|
|
* @extends BI.Action |
|
|
*/ |
|
|
BI.ShowAction = BI.inherit(BI.Action, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.ShowAction.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.ShowAction.superclass._init.apply(this, arguments); |
|
|
}, |
|
|
|
|
|
actionPerformed: function (src, tar, callback) { |
|
|
tar = tar || this.options.tar; |
|
|
tar.setVisible(true); |
|
|
callback && callback(); |
|
|
}, |
|
|
|
|
|
actionBack: function (tar, src, callback) { |
|
|
tar = tar || this.options.tar; |
|
|
tar.setVisible(false); |
|
|
callback && callback(); |
|
|
} |
|
|
});(function () { |
|
|
if (!window.BI) { |
|
|
window.BI = {}; |
|
|
} |
|
|
|
|
|
function isEmpty (value) { |
|
|
// 判断是否为空值 |
|
|
var result = value === "" || value === null || value === undefined; |
|
|
return result; |
|
|
} |
|
|
|
|
|
// 判断是否是无效的日期 |
|
|
function isInvalidDate (date) { |
|
|
return date == "Invalid Date" || date == "NaN"; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 科学计数格式 |
|
|
*/ |
|
|
function _eFormat (text, fmt) { |
|
|
var e = fmt.indexOf("E"); |
|
|
var eleft = fmt.substr(0, e), eright = fmt.substr(e + 1); |
|
|
if (/^[0\.-]+$/.test(text)) { |
|
|
text = BI._numberFormat(0.0, eleft) + "E" + BI._numberFormat(0, eright); |
|
|
} else { |
|
|
var isNegative = text < 0; |
|
|
if (isNegative) { |
|
|
text = text.substr(1); |
|
|
} |
|
|
var elvl = (eleft.split(".")[0] || "").length; |
|
|
var point = text.indexOf("."); |
|
|
if (point < 0) { |
|
|
point = text.length; |
|
|
} |
|
|
var i = 0; // 第一个不为0的数的位置 |
|
|
text = text.replace(".", ""); |
|
|
for (var len = text.length; i < len; i++) { |
|
|
var ech = text.charAt(i); |
|
|
if (ech <= "9" && ech >= "1") { |
|
|
break; |
|
|
} |
|
|
} |
|
|
var right = point - i - elvl; |
|
|
var left = text.substr(i, elvl); |
|
|
var dis = i + elvl - text.length; |
|
|
if (dis > 0) { |
|
|
// 末位补全0 |
|
|
for (var k = 0; k < dis; k++) { |
|
|
left += "0"; |
|
|
} |
|
|
} else { |
|
|
left += "." + text.substr(i + elvl); |
|
|
} |
|
|
left = left.replace(/^[0]+/, ""); |
|
|
if (right < 0 && eright.indexOf("-") < 0) { |
|
|
eright += ";-" + eright; |
|
|
} |
|
|
text = BI._numberFormat(left, eleft) + "E" + BI._numberFormat(right, eright); |
|
|
if (isNegative) { |
|
|
text = "-" + text; |
|
|
} |
|
|
} |
|
|
return text; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 数字格式 |
|
|
*/ |
|
|
function _numberFormat (text, format) { |
|
|
var text = text + ""; |
|
|
// 数字格式,区分正负数 |
|
|
var numMod = format.indexOf(";"); |
|
|
if (numMod > -1) { |
|
|
if (text >= 0) { |
|
|
return _numberFormat(text + "", format.substring(0, numMod)); |
|
|
} |
|
|
return _numberFormat((-text) + "", format.substr(numMod + 1)); |
|
|
|
|
|
} |
|
|
// 兼容格式处理负数的情况(copy:fr-jquery.format.js) |
|
|
if (+text < 0 && format.charAt(0) !== "-") { |
|
|
return _numberFormat((-text) + "", "-" + format); |
|
|
} |
|
|
|
|
|
var tp = text.split("."), fp = format.split("."), |
|
|
tleft = tp[0] || "", fleft = fp[0] || "", |
|
|
tright = tp[1] || "", fright = fp[1] || ""; |
|
|
// 百分比,千分比的小数点移位处理 |
|
|
if (/[%‰]$/.test(format)) { |
|
|
var paddingZero = /[%]$/.test(format) ? "00" : "000"; |
|
|
tright += paddingZero; |
|
|
tleft += tright.substr(0, paddingZero.length); |
|
|
tleft = tleft.replace(/^0+/gi, ""); |
|
|
tright = tright.substr(paddingZero.length).replace(/0+$/gi, ""); |
|
|
} |
|
|
var right = _dealWithRight(tright, fright); |
|
|
if (right.leftPlus) { |
|
|
// 小数点后有进位 |
|
|
tleft = parseInt(tleft) + 1 + ""; |
|
|
|
|
|
tleft = isNaN(tleft) ? "1" : tleft; |
|
|
} |
|
|
right = right.num; |
|
|
var left = _dealWithLeft(tleft, fleft); |
|
|
if (!(/[0-9]/.test(left))) { |
|
|
left = left + "0"; |
|
|
} |
|
|
if (!(/[0-9]/.test(right))) { |
|
|
return left + right; |
|
|
} |
|
|
return left + "." + right; |
|
|
|
|
|
} |
|
|
|
|
|
/** |
|
|
* 处理小数点右边小数部分 |
|
|
* @param tright 右边内容 |
|
|
* @param fright 右边格式 |
|
|
* @returns {JSON} 返回处理结果和整数部分是否需要进位 |
|
|
* @private |
|
|
*/ |
|
|
function _dealWithRight (tright, fright) { |
|
|
var right = "", j = 0, i = 0; |
|
|
for (var len = fright.length; i < len; i++) { |
|
|
var ch = fright.charAt(i); |
|
|
var c = tright.charAt(j); |
|
|
switch (ch) { |
|
|
case "0": |
|
|
if (isEmpty(c)) { |
|
|
c = "0"; |
|
|
} |
|
|
right += c; |
|
|
j++; |
|
|
break; |
|
|
case "#": |
|
|
right += c; |
|
|
j++; |
|
|
break; |
|
|
default : |
|
|
right += ch; |
|
|
break; |
|
|
} |
|
|
} |
|
|
var rll = tright.substr(j); |
|
|
var result = {}; |
|
|
if (!isEmpty(rll) && rll.charAt(0) > 4) { |
|
|
// 有多余字符,需要四舍五入 |
|
|
result.leftPlus = true; |
|
|
var numReg = right.match(/^[0-9]+/); |
|
|
if (numReg) { |
|
|
var num = numReg[0]; |
|
|
var orilen = num.length; |
|
|
var newnum = parseInt(num) + 1 + ""; |
|
|
// 进位到整数部分 |
|
|
if (newnum.length > orilen) { |
|
|
newnum = newnum.substr(1); |
|
|
} else { |
|
|
newnum = BI.leftPad(newnum, orilen, "0"); |
|
|
result.leftPlus = false; |
|
|
} |
|
|
right = right.replace(/^[0-9]+/, newnum); |
|
|
} |
|
|
} |
|
|
result.num = right; |
|
|
return result; |
|
|
} |
|
|
|
|
|
/** |
|
|
* 处理小数点左边整数部分 |
|
|
* @param tleft 左边内容 |
|
|
* @param fleft 左边格式 |
|
|
* @returns {string} 返回处理结果 |
|
|
* @private |
|
|
*/ |
|
|
function _dealWithLeft (tleft, fleft) { |
|
|
var left = ""; |
|
|
var j = tleft.length - 1; |
|
|
var combo = -1, last = -1; |
|
|
var i = fleft.length - 1; |
|
|
for (; i >= 0; i--) { |
|
|
var ch = fleft.charAt(i); |
|
|
var c = tleft.charAt(j); |
|
|
switch (ch) { |
|
|
case "0": |
|
|
if (isEmpty(c)) { |
|
|
c = "0"; |
|
|
} |
|
|
last = -1; |
|
|
left = c + left; |
|
|
j--; |
|
|
break; |
|
|
case "#": |
|
|
last = i; |
|
|
left = c + left; |
|
|
j--; |
|
|
break; |
|
|
case ",": |
|
|
if (!isEmpty(c)) { |
|
|
// 计算一个,分隔区间的长度 |
|
|
var com = fleft.match(/,[#0]+/); |
|
|
if (com) { |
|
|
combo = com[0].length - 1; |
|
|
} |
|
|
left = "," + left; |
|
|
} |
|
|
break; |
|
|
default : |
|
|
left = ch + left; |
|
|
break; |
|
|
} |
|
|
} |
|
|
if (last > -1) { |
|
|
// 处理剩余字符 |
|
|
var tll = tleft.substr(0, j + 1); |
|
|
left = left.substr(0, last) + tll + left.substr(last); |
|
|
} |
|
|
if (combo > 0) { |
|
|
// 处理,分隔区间 |
|
|
var res = left.match(/[0-9]+,/); |
|
|
if (res) { |
|
|
res = res[0]; |
|
|
var newstr = "", n = res.length - 1 - combo; |
|
|
for (; n >= 0; n = n - combo) { |
|
|
newstr = res.substr(n, combo) + "," + newstr; |
|
|
} |
|
|
var lres = res.substr(0, n + combo); |
|
|
if (!isEmpty(lres)) { |
|
|
newstr = lres + "," + newstr; |
|
|
} |
|
|
} |
|
|
left = left.replace(/[0-9]+,/, newstr); |
|
|
} |
|
|
return left; |
|
|
} |
|
|
|
|
|
BI.cjkEncode = function (text) { |
|
|
// alex:如果非字符串,返回其本身(cjkEncode(234) 返回 ""是不对的) |
|
|
if (typeof text !== "string") { |
|
|
return text; |
|
|
} |
|
|
|
|
|
var newText = ""; |
|
|
for (var i = 0; i < text.length; i++) { |
|
|
var code = text.charCodeAt(i); |
|
|
if (code >= 128 || code === 91 || code === 93) {// 91 is "[", 93 is "]". |
|
|
newText += "[" + code.toString(16) + "]"; |
|
|
} else { |
|
|
newText += text.charAt(i); |
|
|
} |
|
|
} |
|
|
|
|
|
return newText; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 将cjkEncode处理过的字符串转化为原始字符串 |
|
|
* |
|
|
* @static |
|
|
* @param text 需要做解码的字符串 |
|
|
* @return {String} 解码后的字符串 |
|
|
*/ |
|
|
BI.cjkDecode = function (text) { |
|
|
if (text == null) { |
|
|
return ""; |
|
|
} |
|
|
// 查找没有 "[", 直接返回. kunsnat:数字的时候, 不支持indexOf方法, 也是直接返回. |
|
|
if (!isNaN(text) || text.indexOf("[") == -1) { |
|
|
return text; |
|
|
} |
|
|
|
|
|
var newText = ""; |
|
|
for (var i = 0; i < text.length; i++) { |
|
|
var ch = text.charAt(i); |
|
|
if (ch == "[") { |
|
|
var rightIdx = text.indexOf("]", i + 1); |
|
|
if (rightIdx > i + 1) { |
|
|
var subText = text.substring(i + 1, rightIdx); |
|
|
// james:主要是考虑[CDATA[]]这样的值的出现 |
|
|
if (subText.length > 0) { |
|
|
ch = String.fromCharCode(eval("0x" + subText)); |
|
|
} |
|
|
|
|
|
i = rightIdx; |
|
|
} |
|
|
} |
|
|
|
|
|
newText += ch; |
|
|
} |
|
|
|
|
|
return newText; |
|
|
}; |
|
|
|
|
|
// replace the html special tags |
|
|
BI.htmlEncode = function (text) { |
|
|
return (text == null) ? "" : String(text).replace(/&/g, "&").replace(/\"/g, """).replace(/</g, "<").replace(/>/g, ">").replace(/\s/g, " "); |
|
|
}; |
|
|
// html decode |
|
|
BI.htmlDecode = function (text) { |
|
|
return (text == null) ? "" : String(text).replace(/&/g, "&").replace(/"/g, "\"").replace(/</g, "<").replace(/>/g, ">").replace(/ /g, " "); |
|
|
}; |
|
|
|
|
|
BI.cjkEncodeDO = function (o) { |
|
|
if (BI.isPlainObject(o)) { |
|
|
var result = {}; |
|
|
_.each(o, function (v, k) { |
|
|
if (!(typeof v === "string")) { |
|
|
v = BI.jsonEncode(v); |
|
|
} |
|
|
// wei:bug 43338,如果key是中文,cjkencode后o的长度就加了1,ie9以下版本死循环,所以新建对象result。 |
|
|
k = BI.cjkEncode(k); |
|
|
result[k] = BI.cjkEncode(v); |
|
|
}); |
|
|
return result; |
|
|
} |
|
|
return o; |
|
|
}; |
|
|
|
|
|
BI.jsonEncode = function (o) { |
|
|
// james:这个Encode是抄的EXT的 |
|
|
var useHasOwn = !!{}.hasOwnProperty; |
|
|
|
|
|
// crashes Safari in some instances |
|
|
// var validRE = /^("(\\.|[^"\\\n\r])*?"|[,:{}\[\]0-9.\-+Eaeflnr-u \n\r\t])+?$/; |
|
|
|
|
|
var m = { |
|
|
"\b": "\\b", |
|
|
"\t": "\\t", |
|
|
"\n": "\\n", |
|
|
"\f": "\\f", |
|
|
"\r": "\\r", |
|
|
"\"": "\\\"", |
|
|
"\\": "\\\\" |
|
|
}; |
|
|
|
|
|
var encodeString = function (s) { |
|
|
if (/["\\\x00-\x1f]/.test(s)) { |
|
|
return "\"" + s.replace(/([\x00-\x1f\\"])/g, function (a, b) { |
|
|
var c = m[b]; |
|
|
if (c) { |
|
|
return c; |
|
|
} |
|
|
c = b.charCodeAt(); |
|
|
return "\\u00" + |
|
|
Math.floor(c / 16).toString(16) + |
|
|
(c % 16).toString(16); |
|
|
}) + "\""; |
|
|
} |
|
|
return "\"" + s + "\""; |
|
|
}; |
|
|
|
|
|
var encodeArray = function (o) { |
|
|
var a = ["["], b, i, l = o.length, v; |
|
|
for (i = 0; i < l; i += 1) { |
|
|
v = o[i]; |
|
|
switch (typeof v) { |
|
|
case "undefined": |
|
|
case "function": |
|
|
case "unknown": |
|
|
break; |
|
|
default: |
|
|
if (b) { |
|
|
a.push(","); |
|
|
} |
|
|
a.push(v === null ? "null" : BI.jsonEncode(v)); |
|
|
b = true; |
|
|
} |
|
|
} |
|
|
a.push("]"); |
|
|
return a.join(""); |
|
|
}; |
|
|
|
|
|
if (typeof o === "undefined" || o === null) { |
|
|
return "null"; |
|
|
} else if (BI.isArray(o)) { |
|
|
return encodeArray(o); |
|
|
} else if (o instanceof Date) { |
|
|
/* |
|
|
* alex:原来只是把年月日时分秒简单地拼成一个String,无法decode |
|
|
* 现在这么处理就可以decode了,但是JS.jsonDecode和Java.JSONObject也要跟着改一下 |
|
|
*/ |
|
|
return BI.jsonEncode({ |
|
|
__time__: o.getTime() |
|
|
}); |
|
|
} else if (typeof o === "string") { |
|
|
return encodeString(o); |
|
|
} else if (typeof o === "number") { |
|
|
return isFinite(o) ? String(o) : "null"; |
|
|
} else if (typeof o === "boolean") { |
|
|
return String(o); |
|
|
} else if (BI.isFunction(o)) { |
|
|
return String(o); |
|
|
} |
|
|
var a = ["{"], b, i, v; |
|
|
for (i in o) { |
|
|
if (!useHasOwn || o.hasOwnProperty(i)) { |
|
|
v = o[i]; |
|
|
switch (typeof v) { |
|
|
case "undefined": |
|
|
case "unknown": |
|
|
break; |
|
|
default: |
|
|
if (b) { |
|
|
a.push(","); |
|
|
} |
|
|
a.push(BI.jsonEncode(i), ":", |
|
|
v === null ? "null" : BI.jsonEncode(v)); |
|
|
b = true; |
|
|
} |
|
|
} |
|
|
} |
|
|
a.push("}"); |
|
|
return a.join(""); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.jsonDecode = function (text) { |
|
|
|
|
|
try { |
|
|
// 注意0啊 |
|
|
// var jo = $.parseJSON(text) || {}; |
|
|
var jo = $ ? $.parseJSON(text) : window.JSON.parse(text); |
|
|
if (jo == null) { |
|
|
jo = {}; |
|
|
} |
|
|
} catch (e) { |
|
|
/* |
|
|
* richie:浏览器只支持标准的JSON字符串转换,而jQuery会默认调用浏览器的window.JSON.parse()函数进行解析 |
|
|
* 比如:var str = "{'a':'b'}",这种形式的字符串转换为JSON就会抛异常 |
|
|
*/ |
|
|
try { |
|
|
jo = new Function("return " + text)() || {}; |
|
|
} catch (e) { |
|
|
// do nothing |
|
|
} |
|
|
if (jo == null) { |
|
|
jo = []; |
|
|
} |
|
|
} |
|
|
if (!_hasDateInJson(text)) { |
|
|
return jo; |
|
|
} |
|
|
|
|
|
function _hasDateInJson (json) { |
|
|
if (!json || typeof json !== "string") { |
|
|
return false; |
|
|
} |
|
|
return json.indexOf("__time__") != -1; |
|
|
} |
|
|
|
|
|
return (function (o) { |
|
|
if (typeof o === "string") { |
|
|
return o; |
|
|
} |
|
|
if (o && o.__time__ != null) { |
|
|
return new Date(o.__time__); |
|
|
} |
|
|
for (var a in o) { |
|
|
if (o[a] == o || typeof o[a] === "object" || _.isFunction(o[a])) { |
|
|
break; |
|
|
} |
|
|
o[a] = arguments.callee(o[a]); |
|
|
} |
|
|
|
|
|
return o; |
|
|
})(jo); |
|
|
}; |
|
|
|
|
|
BI.contentFormat = function (cv, fmt) { |
|
|
if (isEmpty(cv)) { |
|
|
// 原值为空,返回空字符 |
|
|
return ""; |
|
|
} |
|
|
var text = cv.toString(); |
|
|
if (isEmpty(fmt)) { |
|
|
// 格式为空,返回原字符 |
|
|
return text; |
|
|
} |
|
|
if (fmt.match(/^T/)) { |
|
|
// T - 文本格式 |
|
|
return text; |
|
|
} else if (fmt.match(/^D/)) { |
|
|
// D - 日期(时间)格式 |
|
|
if (!(cv instanceof Date)) { |
|
|
if (typeof cv === "number") { |
|
|
// 毫秒数类型 |
|
|
cv = new Date(cv); |
|
|
} else { |
|
|
// 字符串类型,如yyyyMMdd、MMddyyyy等这样无分隔符的结构 |
|
|
cv = Date.parseDate(cv + "", Date.patterns.ISO8601Long); |
|
|
} |
|
|
} |
|
|
if (!BI.isNull(cv)) { |
|
|
var needTrim = fmt.match(/^DT/); |
|
|
text = BI.date2Str(cv, fmt.substring(needTrim ? 2 : 1)); |
|
|
} |
|
|
} else if (fmt.match(/E/)) { |
|
|
// 科学计数格式 |
|
|
text = _eFormat(text, fmt); |
|
|
} else { |
|
|
// 数字格式 |
|
|
var s = []; |
|
|
BI.clamp(s); |
|
|
text = _numberFormat(text, fmt); |
|
|
} |
|
|
// ¤ - 货币格式 |
|
|
text = text.replace(/¤/g, "¥"); |
|
|
return text; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 将Java提供的日期格式字符串装换为JS识别的日期格式字符串 |
|
|
* @class FR.parseFmt |
|
|
* @param fmt 日期格式 |
|
|
* @returns {String} |
|
|
*/ |
|
|
BI.parseFmt = function (fmt) { |
|
|
if (!fmt) { |
|
|
return ""; |
|
|
} |
|
|
//日期 |
|
|
fmt = String(fmt) |
|
|
//年 |
|
|
.replace(/y{4,}/g, "%Y")//yyyy的时候替换为Y |
|
|
.replace(/y{2}/g, "%y")//yy的时候替换为y |
|
|
//月 |
|
|
.replace(/M{4,}/g, "%b")//MMMM的时候替换为b,八 |
|
|
.replace(/M{3}/g, "%B")//MMM的时候替换为M,八月 |
|
|
.replace(/M{2}/g, "%X")//MM的时候替换为X,08 |
|
|
.replace(/M{1}/g, "%x")//M的时候替换为x,8 |
|
|
.replace(/a{1}/g, "%p"); |
|
|
//天 |
|
|
if (new RegExp("d{2,}", "g").test(fmt)) { |
|
|
fmt = fmt.replace(/d{2,}/g, "%d");//dd的时候替换为d |
|
|
} else { |
|
|
fmt = fmt.replace(/d{1}/g, "%e");//d的时候替换为j |
|
|
} |
|
|
//时 |
|
|
if (new RegExp("h{2,}", "g").test(fmt)) {//12小时制 |
|
|
fmt = fmt.replace(/h{2,}/g, "%I"); |
|
|
} else { |
|
|
fmt = fmt.replace(/h{1}/g, "%I"); |
|
|
} |
|
|
if (new RegExp("H{2,}", "g").test(fmt)) {//24小时制 |
|
|
fmt = fmt.replace(/H{2,}/g, "%H"); |
|
|
} else { |
|
|
fmt = fmt.replace(/H{1}/g, "%H"); |
|
|
} |
|
|
fmt = fmt.replace(/m{2,}/g, "%M")//分 |
|
|
//秒 |
|
|
.replace(/s{2,}/g, "%S"); |
|
|
|
|
|
return fmt; |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 把字符串按照对应的格式转化成日期对象 |
|
|
* |
|
|
* @example |
|
|
* var result = FR.str2Date('2013-12-12', 'yyyy-MM-dd');//Thu Dec 12 2013 00:00:00 GMT+0800 |
|
|
* |
|
|
* @class FR.str2Date |
|
|
* @param str 字符串 |
|
|
* @param format 日期格式 |
|
|
* @returns {*} |
|
|
*/ |
|
|
BI.str2Date = function (str, format) { |
|
|
if (typeof str != "string" || typeof format != "string") { |
|
|
return null; |
|
|
} |
|
|
var fmt = BI.parseFmt(format); |
|
|
return BI.parseDateTime(str, fmt); |
|
|
}; |
|
|
|
|
|
/** |
|
|
* 把日期对象按照指定格式转化成字符串 |
|
|
* |
|
|
* @example |
|
|
* var date = new Date('Thu Dec 12 2013 00:00:00 GMT+0800'); |
|
|
* var result = BI.date2Str(date, 'yyyy-MM-dd');//2013-12-12 |
|
|
* |
|
|
* @class BI.date2Str |
|
|
* @param date 日期 |
|
|
* @param format 日期格式 |
|
|
* @returns {String} |
|
|
*/ |
|
|
BI.date2Str = function (date, format) { |
|
|
if (!date) { |
|
|
return ""; |
|
|
} |
|
|
// O(len(format)) |
|
|
var len = format.length, result = ""; |
|
|
if (len > 0) { |
|
|
var flagch = format.charAt(0), start = 0, str = flagch; |
|
|
for (var i = 1; i < len; i++) { |
|
|
var ch = format.charAt(i); |
|
|
if (flagch !== ch) { |
|
|
result += compileJFmt({ |
|
|
char: flagch, |
|
|
str: str, |
|
|
len: i - start |
|
|
}, date); |
|
|
flagch = ch; |
|
|
start = i; |
|
|
str = flagch; |
|
|
} else { |
|
|
str += ch; |
|
|
} |
|
|
} |
|
|
result += compileJFmt({ |
|
|
char: flagch, |
|
|
str: str, |
|
|
len: len - start |
|
|
}, date); |
|
|
} |
|
|
return result; |
|
|
|
|
|
function compileJFmt (jfmt, date) { |
|
|
var str = jfmt.str, len = jfmt.len, ch = jfmt["char"]; |
|
|
switch (ch) { |
|
|
case "E": // 星期 |
|
|
str = Date._DN[date.getDay()]; |
|
|
break; |
|
|
case "y": // 年 |
|
|
if (len <= 3) { |
|
|
str = (date.getFullYear() + "").slice(2, 4); |
|
|
} else { |
|
|
str = date.getFullYear(); |
|
|
} |
|
|
break; |
|
|
case "M": // 月 |
|
|
if (len > 2) { |
|
|
str = Date._MN[date.getMonth()]; |
|
|
} else if (len < 2) { |
|
|
str = date.getMonth() + 1; |
|
|
} else { |
|
|
str = BI.leftPad(date.getMonth() + 1 + "", 2, "0"); |
|
|
} |
|
|
break; |
|
|
case "d": // 日 |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getDate() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getDate(); |
|
|
} |
|
|
break; |
|
|
case "h": // 时(12) |
|
|
var hour = date.getHours() % 12; |
|
|
if (hour === 0) { |
|
|
hour = 12; |
|
|
} |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(hour + "", 2, "0"); |
|
|
} else { |
|
|
str = hour; |
|
|
} |
|
|
break; |
|
|
case "H": // 时(24) |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getHours() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getHours(); |
|
|
} |
|
|
break; |
|
|
case "m": |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getMinutes() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getMinutes(); |
|
|
} |
|
|
break; |
|
|
case "s": |
|
|
if (len > 1) { |
|
|
str = BI.leftPad(date.getSeconds() + "", 2, "0"); |
|
|
} else { |
|
|
str = date.getSeconds(); |
|
|
} |
|
|
break; |
|
|
case "a": |
|
|
str = date.getHours() < 12 ? "am" : "pm"; |
|
|
break; |
|
|
case "z": |
|
|
str = date.getTimezone(); |
|
|
break; |
|
|
default: |
|
|
str = jfmt.str; |
|
|
break; |
|
|
} |
|
|
return str; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.object2Number = function (value) { |
|
|
if (value == null) { |
|
|
return 0; |
|
|
} |
|
|
if (typeof value === "number") { |
|
|
return value; |
|
|
} |
|
|
var str = value + ""; |
|
|
if (str.indexOf(".") === -1) { |
|
|
return parseInt(str); |
|
|
} |
|
|
return parseFloat(str); |
|
|
}; |
|
|
|
|
|
BI.object2Date = function (obj) { |
|
|
if (obj == null) { |
|
|
return new Date(); |
|
|
} |
|
|
if (obj instanceof Date) { |
|
|
return obj; |
|
|
} else if (typeof obj === "number") { |
|
|
return new Date(obj); |
|
|
} |
|
|
var str = obj + ""; |
|
|
str = str.replace(/-/g, "/"); |
|
|
var dt = new Date(str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
|
|
|
return new Date(); |
|
|
|
|
|
}; |
|
|
|
|
|
BI.object2Time = function (obj) { |
|
|
if (obj == null) { |
|
|
return new Date(); |
|
|
} |
|
|
if (obj instanceof Date) { |
|
|
return obj; |
|
|
} |
|
|
var str = obj + ""; |
|
|
str = str.replace(/-/g, "/"); |
|
|
var dt = new Date(str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
if (str.indexOf("/") === -1 && str.indexOf(":") !== -1) { |
|
|
dt = new Date("1970/01/01 " + str); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
} |
|
|
dt = BI.parseDateTime(str, "HH:mm:ss"); |
|
|
if (!isInvalidDate(dt)) { |
|
|
return dt; |
|
|
} |
|
|
return new Date(); |
|
|
|
|
|
}; |
|
|
})(); |
|
|
/** |
|
|
* guy |
|
|
* |
|
|
* @class BI.HighlightBehavior |
|
|
* @extends BI.Behavior |
|
|
*/ |
|
|
BI.HighlightBehavior = BI.inherit(BI.Behavior, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.HighlightBehavior.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.HighlightBehavior.superclass._init.apply(this, arguments); |
|
|
|
|
|
}, |
|
|
|
|
|
doBehavior: function (items) { |
|
|
var args = Array.prototype.slice.call(arguments, 1), |
|
|
o = this.options; |
|
|
BI.each(items, function (i, item) { |
|
|
if (item instanceof BI.Single) { |
|
|
var rule = o.rule(item.getValue(), item); |
|
|
|
|
|
function doBe (run) { |
|
|
if (run === true) { |
|
|
item.doHighLight && item.doHighLight.apply(item, args); |
|
|
} else { |
|
|
item.unHighLight && item.unHighLight.apply(item, args); |
|
|
} |
|
|
} |
|
|
|
|
|
if (BI.isFunction(rule)) { |
|
|
rule(doBe); |
|
|
} else { |
|
|
doBe(rule); |
|
|
} |
|
|
} else { |
|
|
item.doBehavior && item.doBehavior.apply(item, args); |
|
|
} |
|
|
}); |
|
|
} |
|
|
});/** |
|
|
* guy |
|
|
* 标红行为 |
|
|
* @class BI.RedMarkBehavior |
|
|
* @extends BI.Behavior |
|
|
*/ |
|
|
BI.RedMarkBehavior = BI.inherit(BI.Behavior, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.RedMarkBehavior.superclass._defaultConfig.apply(this, arguments), { |
|
|
|
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.RedMarkBehavior.superclass._init.apply(this, arguments); |
|
|
|
|
|
}, |
|
|
|
|
|
doBehavior: function (items) { |
|
|
var args = Array.prototype.slice.call(arguments, 1), |
|
|
o = this.options; |
|
|
BI.each(items, function (i, item) { |
|
|
if(item instanceof BI.Single) { |
|
|
if (o.rule(item.getValue(), item)) { |
|
|
item.doRedMark && item.doRedMark.apply(item, args); |
|
|
} else { |
|
|
item.doRedMark && item.unRedMark.apply(item, args); |
|
|
} |
|
|
} else { |
|
|
item.doBehavior && item.doBehavior.apply(item, args); |
|
|
} |
|
|
}); |
|
|
} |
|
|
});// 工程配置 |
|
|
(function () { |
|
|
// 注册布局 |
|
|
var isSupportFlex = BI.isSupportCss3("flex"); |
|
|
BI.Plugin.registerWidget("bi.horizontal", function (ob) { |
|
|
if (isSupportFlex) { |
|
|
return BI.extend(ob, {type: "bi.flex_horizontal"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
BI.Plugin.registerWidget("bi.center_adapt", function (ob) { |
|
|
if (isSupportFlex && ob.items && ob.items.length <= 1) { |
|
|
// 有滚动条的情况下需要用到flex_wrapper_center布局 |
|
|
if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) { |
|
|
// 不是IE用flex_wrapper_center布局 |
|
|
if (!BI.isIE()) { |
|
|
return BI.extend(ob, {type: "bi.flex_wrapper_center"}); |
|
|
} |
|
|
return ob; |
|
|
} |
|
|
return BI.extend(ob, {type: "bi.flex_center"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
BI.Plugin.registerWidget("bi.vertical_adapt", function (ob) { |
|
|
if (isSupportFlex) { |
|
|
// 有滚动条的情况下需要用到flex_wrapper_center布局 |
|
|
if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) { |
|
|
// 不是IE用flex_wrapper_center布局 |
|
|
if (!BI.isIE()) { |
|
|
return BI.extend({}, ob, {type: "bi.flex_wrapper_vertical_center"}); |
|
|
} |
|
|
return ob; |
|
|
} |
|
|
return BI.extend(ob, {type: "bi.flex_vertical_center"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
BI.Plugin.registerWidget("bi.float_center_adapt", function (ob) { |
|
|
if (isSupportFlex) { |
|
|
// 有滚动条的情况下需要用到flex_wrapper_center布局 |
|
|
if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) { |
|
|
// 不是IE用flex_wrapper_center布局 |
|
|
if (!BI.isIE()) { |
|
|
return BI.extend({}, ob, {type: "bi.flex_wrapper_center"}); |
|
|
} |
|
|
return ob; |
|
|
} |
|
|
return BI.extend(ob, {type: "bi.flex_center"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
// 注册滚动条 |
|
|
BI.Plugin.registerWidget("bi.grid_table_scrollbar", function (ob) { |
|
|
if (BI.isIE9Below()) { |
|
|
return BI.extend(ob, {type: "bi.native_table_scrollbar"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
BI.Plugin.registerWidget("bi.grid_table_horizontal_scrollbar", function (ob) { |
|
|
if (BI.isIE9Below()) { |
|
|
return BI.extend(ob, {type: "bi.native_table_horizontal_scrollbar"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
|
|
|
// 注册控件 |
|
|
BI.Plugin.registerWidget("bi.grid_table", function (ob) { |
|
|
// 非chrome下滚动条滑动效果不好,禁止掉 |
|
|
if (!(BI.isChrome() && BI.isWindows() && !BI.isEdge())) { |
|
|
return BI.extend(ob, {type: "bi.quick_grid_table"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
BI.Plugin.registerWidget("bi.collection_table", function (ob) { |
|
|
// 非chrome下滚动条滑动效果不好,禁止掉 |
|
|
if (!(BI.isChrome() && BI.isWindows() && !BI.isEdge())) { |
|
|
return BI.extend(ob, {type: "bi.quick_collection_table"}); |
|
|
} |
|
|
return ob; |
|
|
|
|
|
}); |
|
|
// IE8下滚动条用原生的 |
|
|
$(function () { |
|
|
if (BI.isIE9Below()) { |
|
|
BI.GridTableScrollbar.SIZE = 18; |
|
|
} |
|
|
}); |
|
|
}());/** |
|
|
* guy |
|
|
* 控制器 |
|
|
* Controller层超类 |
|
|
* @class BI.Controller |
|
|
* @extends BI.OB |
|
|
* @abstract |
|
|
*/ |
|
|
BI.Controller = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.Controller.superclass._defaultConfig.apply(this, arguments), { |
|
|
|
|
|
}); |
|
|
}, |
|
|
_init: function () { |
|
|
BI.Controller.superclass._init.apply(this, arguments); |
|
|
}, |
|
|
|
|
|
destroy: function () { |
|
|
|
|
|
} |
|
|
}); |
|
|
BI.Controller.EVENT_CHANGE = "__EVENT_CHANGE__";/** |
|
|
* 广播 |
|
|
* |
|
|
* Created by GUY on 2015/12/23. |
|
|
* @class |
|
|
*/ |
|
|
BI.BroadcastController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.BroadcastController.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.BroadcastController.superclass._init.apply(this, arguments); |
|
|
this._broadcasts = {}; |
|
|
}, |
|
|
|
|
|
on: function (name, fn) { |
|
|
var self = this; |
|
|
if (!this._broadcasts[name]) { |
|
|
this._broadcasts[name] = []; |
|
|
} |
|
|
this._broadcasts[name].push(fn); |
|
|
return function () { |
|
|
self.remove(name, fn); |
|
|
}; |
|
|
}, |
|
|
|
|
|
send: function (name) { |
|
|
var args = [].slice.call(arguments, 1); |
|
|
BI.each(this._broadcasts[name], function (i, fn) { |
|
|
fn.apply(null, args); |
|
|
}); |
|
|
}, |
|
|
|
|
|
remove: function (name, fn) { |
|
|
if (fn) { |
|
|
this._broadcasts[name].remove(fn); |
|
|
if (this._broadcasts[name].length === 0) { |
|
|
delete this._broadcasts[name]; |
|
|
} |
|
|
} else { |
|
|
delete this._broadcasts[name]; |
|
|
} |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* 气泡图控制器 |
|
|
* 控制气泡图的显示方向 |
|
|
* |
|
|
* Created by GUY on 2015/8/21. |
|
|
* @class |
|
|
*/ |
|
|
BI.BubblesController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.BubblesController.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_const: { |
|
|
bubbleHeight: 35 |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.BubblesController.superclass._init.apply(this, arguments); |
|
|
var self = this; |
|
|
this.bubblesManager = {}; |
|
|
this.storeBubbles = {}; |
|
|
BI.Resizers.add("bubbleController" + BI.uniqueId(), function () { |
|
|
BI.each(self.bubblesManager, function (name) { |
|
|
self.remove(name); |
|
|
}); |
|
|
self.bubblesManager = {}; |
|
|
self.storeBubbles = {}; |
|
|
}); |
|
|
}, |
|
|
|
|
|
_createBubble: function (direct, text, level, height) { |
|
|
return BI.createWidget({ |
|
|
type: "bi.bubble", |
|
|
text: text, |
|
|
level: level, |
|
|
height: height || 35, |
|
|
direction: direct |
|
|
}); |
|
|
}, |
|
|
|
|
|
_getOffsetLeft: function (name, context, offsetStyle) { |
|
|
var left = 0; |
|
|
if ("center" === offsetStyle) { |
|
|
left = context.element.offset().left + (context.element.bounds().width - this.get(name).element.bounds().width) / 2; |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
return left; |
|
|
} |
|
|
if ("right" === offsetStyle) { |
|
|
left = context.element.offset().left + context.element.bounds().width - this.get(name).element.bounds().width; |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
return left; |
|
|
} |
|
|
return context.element.offset().left; |
|
|
}, |
|
|
|
|
|
_getOffsetTop: function (name, context, offsetStyle) { |
|
|
var top = 0; |
|
|
if ("center" === offsetStyle) { |
|
|
top = context.element.offset().top + (context.element.bounds().height - this.get(name).element.bounds().height) / 2; |
|
|
if (top < 0) { |
|
|
top = 0; |
|
|
} |
|
|
return top; |
|
|
} else if ("right" === offsetStyle) { |
|
|
top = context.element.offset().top + context.element.bounds().height - this.get(name).element.bounds().height; |
|
|
if (top < 0) { |
|
|
top = 0; |
|
|
} |
|
|
return top; |
|
|
} |
|
|
return context.element.offset().top; |
|
|
}, |
|
|
|
|
|
_getLeftPosition: function (name, context, offsetStyle) { |
|
|
var position = $.getLeftPosition(context, this.get(name)); |
|
|
position.top = this._getOffsetTop(name, context, offsetStyle); |
|
|
return position; |
|
|
}, |
|
|
|
|
|
_getBottomPosition: function (name, context, offsetStyle) { |
|
|
var position = $.getBottomPosition(context, this.get(name)); |
|
|
position.left = this._getOffsetLeft(name, context, offsetStyle); |
|
|
return position; |
|
|
}, |
|
|
|
|
|
_getTopPosition: function (name, context, offsetStyle) { |
|
|
var position = $.getTopPosition(context, this.get(name)); |
|
|
position.left = this._getOffsetLeft(name, context, offsetStyle); |
|
|
return position; |
|
|
}, |
|
|
|
|
|
_getRightPosition: function (name, context, offsetStyle) { |
|
|
var position = $.getRightPosition(context, this.get(name)); |
|
|
position.top = this._getOffsetTop(name, context, offsetStyle); |
|
|
return position; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* |
|
|
* @param name |
|
|
* @param text |
|
|
* @param context |
|
|
* @param offsetStyle center, left, right三种类型, 默认left |
|
|
* @returns {BI.BubblesController} |
|
|
*/ |
|
|
show: function (name, text, context, opt) { |
|
|
opt || (opt = {}); |
|
|
var container = opt.container || context; |
|
|
var offsetStyle = opt.offsetStyle || {}; |
|
|
var level = opt.level || "error"; |
|
|
if (!this.storeBubbles[name]) { |
|
|
this.storeBubbles[name] = {}; |
|
|
} |
|
|
if (!this.storeBubbles[name]["top"]) { |
|
|
this.storeBubbles[name]["top"] = this._createBubble("top", text, level); |
|
|
} |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: container, |
|
|
items: [{ |
|
|
el: this.storeBubbles[name]["top"] |
|
|
}] |
|
|
}); |
|
|
this.set(name, this.storeBubbles[name]["top"]); |
|
|
var position = this._getTopPosition(name, context, offsetStyle); |
|
|
this.get(name).element.css({left: position.left, top: position.top}); |
|
|
this.get(name).invisible(); |
|
|
if (!$.isTopSpaceEnough(context, this.get(name))) { |
|
|
if (!this.storeBubbles[name]["left"]) { |
|
|
this.storeBubbles[name]["left"] = this._createBubble("left", text, level, 30); |
|
|
} |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: container, |
|
|
items: [{ |
|
|
el: this.storeBubbles[name]["left"] |
|
|
}] |
|
|
}); |
|
|
this.set(name, this.storeBubbles[name]["left"]); |
|
|
var position = this._getLeftPosition(name, context, offsetStyle); |
|
|
this.get(name).element.css({left: position.left, top: position.top}); |
|
|
this.get(name).invisible(); |
|
|
if (!$.isLeftSpaceEnough(context, this.get(name))) { |
|
|
if (!this.storeBubbles[name]["right"]) { |
|
|
this.storeBubbles[name]["right"] = this._createBubble("right", text, level, 30); |
|
|
} |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: container, |
|
|
items: [{ |
|
|
el: this.storeBubbles[name]["right"] |
|
|
}] |
|
|
}); |
|
|
this.set(name, this.storeBubbles[name]["right"]); |
|
|
var position = this._getRightPosition(name, context, offsetStyle); |
|
|
this.get(name).element.css({left: position.left, top: position.top}); |
|
|
this.get(name).invisible(); |
|
|
if (!$.isRightSpaceEnough(context, this.get(name))) { |
|
|
if (!this.storeBubbles[name]["bottom"]) { |
|
|
this.storeBubbles[name]["bottom"] = this._createBubble("bottom", text, level); |
|
|
} |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: container, |
|
|
items: [{ |
|
|
el: this.storeBubbles[name]["bottom"] |
|
|
}] |
|
|
}); |
|
|
this.set(name, this.storeBubbles[name]["bottom"]); |
|
|
var position = this._getBottomPosition(name, context, offsetStyle); |
|
|
this.get(name).element.css({left: position.left, top: position.top}); |
|
|
this.get(name).invisible(); |
|
|
} |
|
|
} |
|
|
} |
|
|
this.get(name).setText(text); |
|
|
this.get(name).visible(); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
hide: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.get(name).invisible(); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
add: function (name, bubble) { |
|
|
if (this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.set(name, bubble); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.bubblesManager[name]; |
|
|
}, |
|
|
|
|
|
set: function (name, bubble) { |
|
|
this.bubblesManager[name] = bubble; |
|
|
}, |
|
|
|
|
|
has: function (name) { |
|
|
return this.bubblesManager[name] != null; |
|
|
}, |
|
|
|
|
|
remove: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
BI.each(this.storeBubbles[name], function (dir, bubble) { |
|
|
bubble.destroy(); |
|
|
}); |
|
|
delete this.storeBubbles[name]; |
|
|
delete this.bubblesManager[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* 弹出层面板控制器, z-index在10w层级 |
|
|
* |
|
|
* Created by GUY on 2015/6/24. |
|
|
* @class |
|
|
*/ |
|
|
BI.LayerController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.LayerController.superclass._defaultConfig.apply(this, arguments), { |
|
|
render: "body" |
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.LayerController.superclass._init.apply(this, arguments); |
|
|
this.layerManager = {}; |
|
|
this.layouts = {}; |
|
|
this.zindex = BI.zIndex_layer; |
|
|
BI.Resizers.add("layerController" + BI.uniqueId(), BI.bind(this._resize, this)); |
|
|
}, |
|
|
|
|
|
_resize: function () { |
|
|
BI.each(this.layouts, function (i, layer) { |
|
|
if (layer.element.is(":visible")) { |
|
|
layer.element.trigger("__resize__"); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
make: function (name, container, op, context) { |
|
|
if (BI.isWidget(container)) { |
|
|
op = op || {}; |
|
|
op.container = container; |
|
|
} else { |
|
|
context = op; |
|
|
op = container; |
|
|
} |
|
|
return this.create(name, null, op, context); |
|
|
}, |
|
|
|
|
|
create: function (name, from, op, context) { |
|
|
if (this.has(name)) { |
|
|
return this.get(name); |
|
|
} |
|
|
op || (op = {}); |
|
|
var offset = op.offset || {}; |
|
|
var w = from; |
|
|
if (BI.isWidget(from)) { |
|
|
w = from.element; |
|
|
} |
|
|
if (BI.isNotEmptyString(w)) { |
|
|
w = $(w); |
|
|
} |
|
|
if (this.has(name)) { |
|
|
return this.get(name); |
|
|
} |
|
|
var widget = BI.createWidget((op.render || {}), BI.extend({ |
|
|
type: "bi.layout" |
|
|
}, op), context); |
|
|
var layout = BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
items: [{ |
|
|
el: widget, |
|
|
left: 0, |
|
|
right: 0, |
|
|
top: 0, |
|
|
bottom: 0 |
|
|
}] |
|
|
}, context); |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: op.container || this.options.render, |
|
|
items: [{ |
|
|
el: layout, |
|
|
left: offset.left || 0, |
|
|
right: offset.right || 0, |
|
|
top: offset.top || 0, |
|
|
bottom: offset.bottom || 0 |
|
|
}] |
|
|
}); |
|
|
if (w) { |
|
|
layout.element.addClass("bi-popup-view"); |
|
|
layout.element.css({ |
|
|
left: w.offset().left + (offset.left || 0), |
|
|
top: w.offset().top + (offset.top || 0), |
|
|
width: offset.width || (w.outerWidth() - (offset.left || 0) - (offset.right || 0)) || "", |
|
|
height: offset.height || (w.outerHeight() - (offset.top || 0) - (offset.bottom || 0)) || "" |
|
|
}); |
|
|
layout.element.on("__resize__", function () { |
|
|
w.is(":visible") && |
|
|
layout.element.css({ |
|
|
left: w.offset().left + (offset.left || 0), |
|
|
top: w.offset().top + (offset.top || 0), |
|
|
width: offset.width || (w.outerWidth() - (offset.left || 0) - (offset.right || 0)) || "", |
|
|
height: offset.height || (w.outerHeight() - (offset.top || 0) - (offset.bottom || 0)) || "" |
|
|
}); |
|
|
}); |
|
|
} |
|
|
this.add(name, widget, layout); |
|
|
return widget; |
|
|
}, |
|
|
|
|
|
hide: function (name, callback) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this._getLayout(name).invisible(); |
|
|
this._getLayout(name).element.hide(0, callback); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
show: function (name, callback) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this._getLayout(name).visible(); |
|
|
this._getLayout(name).element.css("z-index", this.zindex++).show(0, callback).trigger("__resize__"); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
isVisible: function (name) { |
|
|
return this.has(name) && this._getLayout(name).isVisible(); |
|
|
}, |
|
|
|
|
|
add: function (name, layer, layout) { |
|
|
if (this.has(name)) { |
|
|
throw new Error("name is already exist"); |
|
|
} |
|
|
layout.setVisible(false); |
|
|
this.layerManager[name] = layer; |
|
|
this.layouts[name] = layout; |
|
|
layout.element.css("z-index", this.zindex++); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
_getLayout: function (name) { |
|
|
return this.layouts[name]; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.layerManager[name]; |
|
|
}, |
|
|
|
|
|
has: function (name) { |
|
|
return this.layerManager[name] != null; |
|
|
}, |
|
|
|
|
|
remove: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.layerManager[name].destroy(); |
|
|
this.layouts[name].destroy(); |
|
|
delete this.layerManager[name]; |
|
|
delete this.layouts[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* 遮罩面板, z-index在1亿层级 |
|
|
* |
|
|
* Created by GUY on 2015/6/24. |
|
|
* @class |
|
|
*/ |
|
|
BI.MaskersController = BI.inherit(BI.LayerController, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.MaskersController.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.MaskersController.superclass._init.apply(this, arguments); |
|
|
this.zindex = BI.zIndex_masker; |
|
|
} |
|
|
});/** |
|
|
* guy |
|
|
* popover弹出层控制器, z-index在100w层级 |
|
|
* @class BI.popoverController |
|
|
* @extends BI.Controller |
|
|
*/ |
|
|
BI.PopoverController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.PopoverController.superclass._defaultConfig.apply(this, arguments), { |
|
|
modal: true, // 模态窗口 |
|
|
render: "body" |
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.PopoverController.superclass._init.apply(this, arguments); |
|
|
this.modal = this.options.modal; |
|
|
this.floatManager = {}; |
|
|
this.floatLayer = {}; |
|
|
this.floatContainer = {}; |
|
|
this.floatOpened = {}; |
|
|
this.zindex = BI.zIndex_popover; |
|
|
this.zindexMap = {}; |
|
|
}, |
|
|
|
|
|
_check: function (name) { |
|
|
return BI.isNotNull(this.floatManager[name]); |
|
|
}, |
|
|
|
|
|
create: function (name, options, context) { |
|
|
if (this._check(name)) { |
|
|
return this; |
|
|
} |
|
|
var popover = BI.createWidget(options || {}, { |
|
|
type: "bi.popover" |
|
|
}, context); |
|
|
this.add(name, popover, options, context); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
add: function (name, popover, options, context) { |
|
|
var self = this; |
|
|
options || (options = {}); |
|
|
if (this._check(name)) { |
|
|
return this; |
|
|
} |
|
|
this.floatContainer[name] = BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
cls: "bi-popup-view", |
|
|
items: [{ |
|
|
el: (this.floatLayer[name] = BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
items: [popover] |
|
|
}, context)), |
|
|
left: 0, |
|
|
right: 0, |
|
|
top: 0, |
|
|
bottom: 0 |
|
|
}] |
|
|
}); |
|
|
this.floatManager[name] = popover; |
|
|
(function (key) { |
|
|
popover.on(BI.Popover.EVENT_CLOSE, function () { |
|
|
self.close(key); |
|
|
}); |
|
|
})(name); |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: options.container || this.options.render, |
|
|
items: [{ |
|
|
el: this.floatContainer[name], |
|
|
left: 0, |
|
|
right: 0, |
|
|
top: 0, |
|
|
bottom: 0 |
|
|
}] |
|
|
}); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
open: function (name) { |
|
|
if (!this._check(name)) { |
|
|
return this; |
|
|
} |
|
|
if (!this.floatOpened[name]) { |
|
|
this.floatOpened[name] = true; |
|
|
var container = this.floatContainer[name]; |
|
|
container.element.css("zIndex", this.zindex++); |
|
|
this.modal && container.element.__hasZIndexMask__(this.zindexMap[name]) && container.element.__releaseZIndexMask__(this.zindexMap[name]); |
|
|
this.zindexMap[name] = this.zindex; |
|
|
this.modal && container.element.__buildZIndexMask__(this.zindex++); |
|
|
this.get(name).setZindex(this.zindex++); |
|
|
this.floatContainer[name].visible(); |
|
|
var popover = this.get(name); |
|
|
popover.show && popover.show(); |
|
|
var W = $(this.options.render).width(), H = $(this.options.render).height(); |
|
|
var w = popover.element.width(), h = popover.element.height(); |
|
|
var left = (W - w) / 2, top = (H - h) / 2; |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
if (top < 0) { |
|
|
top = 0; |
|
|
} |
|
|
popover.element.css({ |
|
|
left: left + "px", |
|
|
top: top + "px" |
|
|
}); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
close: function (name) { |
|
|
if (!this._check(name)) { |
|
|
return this; |
|
|
} |
|
|
if (this.floatOpened[name]) { |
|
|
delete this.floatOpened[name]; |
|
|
this.floatContainer[name].invisible(); |
|
|
this.modal && this.floatContainer[name].element.__releaseZIndexMask__(this.zindexMap[name]); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.floatManager[name]; |
|
|
}, |
|
|
|
|
|
remove: function (name) { |
|
|
if (!this._check(name)) { |
|
|
return this; |
|
|
} |
|
|
this.floatContainer[name].destroy(); |
|
|
this.modal && this.floatContainer[name].element.__releaseZIndexMask__(this.zindexMap[name]); |
|
|
delete this.floatManager[name]; |
|
|
delete this.floatLayer[name]; |
|
|
delete this.zindexMap[name]; |
|
|
delete this.floatContainer[name]; |
|
|
delete this.floatOpened[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* window.resize 控制器 |
|
|
* |
|
|
* Created by GUY on 2015/6/24. |
|
|
* @class |
|
|
*/ |
|
|
BI.ResizeController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.ResizeController.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.ResizeController.superclass._init.apply(this, arguments); |
|
|
var self = this; |
|
|
this.resizerManger = {}; |
|
|
var fn = BI.debounce(function (ev) { |
|
|
// if (BI.isWindow(ev.target)) { |
|
|
self._resize(ev); |
|
|
// } |
|
|
}, 30); |
|
|
$(window).resize(fn); |
|
|
}, |
|
|
|
|
|
_resize: function (ev) { |
|
|
BI.each(this.resizerManger, function (key, resizer) { |
|
|
if (resizer instanceof $) { |
|
|
if (resizer.is(":visible")) { |
|
|
resizer.trigger("__resize__"); |
|
|
} |
|
|
return; |
|
|
} |
|
|
if (resizer instanceof BI.Layout) { |
|
|
resizer.resize(); |
|
|
return; |
|
|
} |
|
|
if (BI.isFunction(resizer)) { |
|
|
resizer(ev); |
|
|
return; |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
add: function (name, resizer) { |
|
|
var self = this; |
|
|
if (this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.resizerManger[name] = resizer; |
|
|
return function () { |
|
|
self.remove(name); |
|
|
}; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.resizerManger[name]; |
|
|
}, |
|
|
|
|
|
has: function (name) { |
|
|
return this.resizerManger[name] != null; |
|
|
}, |
|
|
|
|
|
remove: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
delete this.resizerManger[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* tooltip控制器 |
|
|
* 控制tooltip的显示, 且页面中只有一个tooltip显示 |
|
|
* |
|
|
* Created by GUY on 2015/9/8. |
|
|
* @class BI.TooltipsController |
|
|
* @extends BI.Controller |
|
|
*/ |
|
|
BI.TooltipsController = BI.inherit(BI.Controller, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.TooltipsController.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_const: { |
|
|
height: 20 |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.TooltipsController.superclass._init.apply(this, arguments); |
|
|
this.tooltipsManager = {}; |
|
|
this.showingTips = {};// 存储正在显示的tooltip |
|
|
}, |
|
|
|
|
|
_createTooltip: function (text, level) { |
|
|
return BI.createWidget({ |
|
|
type: "bi.tooltip", |
|
|
text: text, |
|
|
level: level, |
|
|
stopEvent: true, |
|
|
height: this._const.height |
|
|
}); |
|
|
}, |
|
|
|
|
|
hide: function (name, callback) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
delete this.showingTips[name]; |
|
|
this.get(name).element.hide(0, callback); |
|
|
this.get(name).invisible(); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
create: function (name, text, level, context) { |
|
|
if (!this.has(name)) { |
|
|
var tooltip = this._createTooltip(text, level); |
|
|
this.add(name, tooltip); |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: context || "body", |
|
|
items: [{ |
|
|
el: tooltip |
|
|
}] |
|
|
}); |
|
|
tooltip.invisible(); |
|
|
} |
|
|
return this.get(name); |
|
|
}, |
|
|
|
|
|
// opt: {container: '', belowMouse: false} |
|
|
show: function (e, name, text, level, context, opt) { |
|
|
opt || (opt = {}); |
|
|
var self = this; |
|
|
BI.each(this.showingTips, function (i, tip) { |
|
|
self.hide(i); |
|
|
}); |
|
|
this.showingTips = {}; |
|
|
if (!this.has(name)) { |
|
|
this.create(name, text, level, opt.container || context); |
|
|
} |
|
|
if (!opt.belowMouse) { |
|
|
var offset = context.element.offset(); |
|
|
var bounds = context.element.bounds(); |
|
|
if (bounds.height === 0 || bounds.width === 0) { |
|
|
return; |
|
|
} |
|
|
var top = offset.top + bounds.height + 5; |
|
|
} |
|
|
var tooltip = this.get(name); |
|
|
tooltip.setText(text); |
|
|
tooltip.element.css({ |
|
|
left: "0px", |
|
|
top: "0px" |
|
|
}); |
|
|
tooltip.visible(); |
|
|
tooltip.element.height(tooltip.element[0].scrollHeight); |
|
|
this.showingTips[name] = true; |
|
|
var x = (e.pageX || e.clientX) + 15, y = (e.pageY || e.clientY) + 15; |
|
|
if (x + tooltip.element.outerWidth() > $("body").outerWidth()) { |
|
|
x -= tooltip.element.outerWidth() + 15; |
|
|
} |
|
|
if (y + tooltip.element.outerHeight() > $("body").outerHeight()) { |
|
|
y -= tooltip.element.outerHeight() + 15; |
|
|
!opt.belowMouse && (y = Math.min(y, offset.top - tooltip.element.outerHeight() - 5)); |
|
|
} else { |
|
|
!opt.belowMouse && (y = Math.max(y, top)); |
|
|
} |
|
|
tooltip.element.css({ |
|
|
left: x < 0 ? 0 : x + "px", |
|
|
top: y < 0 ? 0 : y + "px" |
|
|
}); |
|
|
tooltip.element.hover(function () { |
|
|
self.remove(name); |
|
|
context.element.trigger("mouseleave.title" + context.getName()); |
|
|
}); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
add: function (name, bubble) { |
|
|
if (this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.set(name, bubble); |
|
|
return this; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.tooltipsManager[name]; |
|
|
}, |
|
|
|
|
|
set: function (name, bubble) { |
|
|
this.tooltipsManager[name] = bubble; |
|
|
}, |
|
|
|
|
|
has: function (name) { |
|
|
return this.tooltipsManager[name] != null; |
|
|
}, |
|
|
|
|
|
remove: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.tooltipsManager[name].destroy(); |
|
|
delete this.tooltipsManager[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* 事件集合 |
|
|
* @class BI.Events |
|
|
*/ |
|
|
_.extend(BI, { |
|
|
Events: { |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property keydown事件 |
|
|
*/ |
|
|
KEYDOWN: "_KEYDOWN", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 回撤事件 |
|
|
*/ |
|
|
BACKSPACE: "_BACKSPACE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 空格事件 |
|
|
*/ |
|
|
SPACE: "_SPACE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 回车事件 |
|
|
*/ |
|
|
ENTER: "_ENTER", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 确定事件 |
|
|
*/ |
|
|
CONFIRM: "_CONFIRM", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 错误事件 |
|
|
*/ |
|
|
ERROR: "_ERROR", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 暂停事件 |
|
|
*/ |
|
|
PAUSE: "_PAUSE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property destroy事件 |
|
|
*/ |
|
|
DESTROY: "_DESTROY", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 取消挂载事件 |
|
|
*/ |
|
|
UNMOUNT: "_UNMOUNT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 清除选择 |
|
|
*/ |
|
|
CLEAR: "_CLEAR", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 添加数据 |
|
|
*/ |
|
|
ADD: "_ADD", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 正在编辑状态事件 |
|
|
*/ |
|
|
EDITING: "_EDITING", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 空状态事件 |
|
|
*/ |
|
|
EMPTY: "_EMPTY", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 显示隐藏事件 |
|
|
*/ |
|
|
VIEW: "_VIEW", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 窗体改变大小 |
|
|
*/ |
|
|
RESIZE: "_RESIZE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 编辑前事件 |
|
|
*/ |
|
|
BEFOREEDIT: "_BEFOREEDIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 编辑后事件 |
|
|
*/ |
|
|
AFTEREDIT: "_AFTEREDIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 开始编辑事件 |
|
|
*/ |
|
|
STARTEDIT: "_STARTEDIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 停止编辑事件 |
|
|
*/ |
|
|
STOPEDIT: "_STOPEDIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 值改变事件 |
|
|
*/ |
|
|
CHANGE: "_CHANGE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 下拉弹出菜单事件 |
|
|
*/ |
|
|
EXPAND: "_EXPAND", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 关闭下拉菜单事件 |
|
|
*/ |
|
|
COLLAPSE: "_COLLAPSE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 回调事件 |
|
|
*/ |
|
|
CALLBACK: "_CALLBACK", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 点击事件 |
|
|
*/ |
|
|
CLICK: "_CLICK", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 状态改变事件,一般是用在复选按钮和单选按钮 |
|
|
*/ |
|
|
STATECHANGE: "_STATECHANGE", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 状态改变前事件 |
|
|
*/ |
|
|
BEFORESTATECHANGE: "_BEFORESTATECHANGE", |
|
|
|
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 初始化事件 |
|
|
*/ |
|
|
INIT: "_INIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 初始化后事件 |
|
|
*/ |
|
|
AFTERINIT: "_AFTERINIT", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 滚动条滚动事件 |
|
|
*/ |
|
|
SCROLL: "_SCROLL", |
|
|
|
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 开始加载事件 |
|
|
*/ |
|
|
STARTLOAD: "_STARTLOAD", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 加载后事件 |
|
|
*/ |
|
|
AFTERLOAD: "_AFTERLOAD", |
|
|
|
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 提交前事件 |
|
|
*/ |
|
|
BS: "beforesubmit", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 提交后事件 |
|
|
*/ |
|
|
AS: "aftersubmit", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 提交完成事件 |
|
|
*/ |
|
|
SC: "submitcomplete", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 提交失败事件 |
|
|
*/ |
|
|
SF: "submitfailure", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 提交成功事件 |
|
|
*/ |
|
|
SS: "submitsuccess", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 校验提交前事件 |
|
|
*/ |
|
|
BVW: "beforeverifywrite", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 校验提交后事件 |
|
|
*/ |
|
|
AVW: "afterverifywrite", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 校验后事件 |
|
|
*/ |
|
|
AV: "afterverify", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 填报前事件 |
|
|
*/ |
|
|
BW: "beforewrite", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 填报后事件 |
|
|
*/ |
|
|
AW: "afterwrite", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 填报成功事件 |
|
|
*/ |
|
|
WS: "writesuccess", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 填报失败事件 |
|
|
*/ |
|
|
WF: "writefailure", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 添加行前事件 |
|
|
*/ |
|
|
BA: "beforeappend", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 添加行后事件 |
|
|
*/ |
|
|
AA: "afterappend", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 删除行前事件 |
|
|
*/ |
|
|
BD: "beforedelete", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 删除行后事件 |
|
|
*/ |
|
|
AD: "beforedelete", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 未提交离开事件 |
|
|
*/ |
|
|
UC: "unloadcheck", |
|
|
|
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property PDF导出前事件 |
|
|
*/ |
|
|
BTOPDF: "beforetopdf", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property PDF导出后事件 |
|
|
*/ |
|
|
ATOPDF: "aftertopdf", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Excel导出前事件 |
|
|
*/ |
|
|
BTOEXCEL: "beforetoexcel", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Excel导出后事件 |
|
|
*/ |
|
|
ATOEXCEL: "aftertoexcel", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Word导出前事件 |
|
|
*/ |
|
|
BTOWORD: "beforetoword", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Word导出后事件 |
|
|
*/ |
|
|
ATOWORD: "aftertoword", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 图片导出前事件 |
|
|
*/ |
|
|
BTOIMAGE: "beforetoimage", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 图片导出后事件 |
|
|
*/ |
|
|
ATOIMAGE: "aftertoimage", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property HTML导出前事件 |
|
|
*/ |
|
|
BTOHTML: "beforetohtml", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property HTML导出后事件 |
|
|
*/ |
|
|
ATOHTML: "aftertohtml", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Excel导入前事件 |
|
|
*/ |
|
|
BIMEXCEL: "beforeimportexcel", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Excel导出后事件 |
|
|
*/ |
|
|
AIMEXCEL: "afterimportexcel", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property PDF打印前事件 |
|
|
*/ |
|
|
BPDFPRINT: "beforepdfprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property PDF打印后事件 |
|
|
*/ |
|
|
APDFPRINT: "afterpdfprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Flash打印前事件 |
|
|
*/ |
|
|
BFLASHPRINT: "beforeflashprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Flash打印后事件 |
|
|
*/ |
|
|
AFLASHPRINT: "afterflashprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Applet打印前事件 |
|
|
*/ |
|
|
BAPPLETPRINT: "beforeappletprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property Applet打印后事件 |
|
|
*/ |
|
|
AAPPLETPRINT: "afterappletprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 服务器打印前事件 |
|
|
*/ |
|
|
BSEVERPRINT: "beforeserverprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 服务器打印后事件 |
|
|
*/ |
|
|
ASERVERPRINT: "afterserverprint", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 邮件发送前事件 |
|
|
*/ |
|
|
BEMAIL: "beforeemail", |
|
|
|
|
|
/** |
|
|
* @static |
|
|
* @property 邮件发送后事件 |
|
|
*/ |
|
|
AEMAIL: "afteremail" |
|
|
} |
|
|
});/** |
|
|
* guy |
|
|
* 最基础的dom操作 |
|
|
*/ |
|
|
BI.extend(jQuery.fn, { |
|
|
|
|
|
destroy: function () { |
|
|
this.remove(); |
|
|
if (BI.isIE() === true) { |
|
|
this[0].outerHTML = ""; |
|
|
} |
|
|
}, |
|
|
/** |
|
|
* 高亮显示 |
|
|
* @param text 必需 |
|
|
* @param keyword |
|
|
* @param py 必需 |
|
|
* @returns {*} |
|
|
* @private |
|
|
*/ |
|
|
__textKeywordMarked__: function (text, keyword, py) { |
|
|
if (!BI.isKey(keyword) || (text + "").length > 100) { |
|
|
return this.html(BI.htmlEncode(text)); |
|
|
} |
|
|
keyword = keyword + ""; |
|
|
keyword = BI.toUpperCase(keyword); |
|
|
var textLeft = (text || "") + ""; |
|
|
py = (py || BI.makeFirstPY(text)) + ""; |
|
|
if (py != null) { |
|
|
py = BI.toUpperCase(py); |
|
|
} |
|
|
this.empty(); |
|
|
while (true) { |
|
|
var tidx = BI.toUpperCase(textLeft).indexOf(keyword); |
|
|
var pidx = null; |
|
|
if (py != null) { |
|
|
pidx = py.indexOf(keyword); |
|
|
if (pidx >= 0) { |
|
|
pidx = pidx % text.length; |
|
|
} |
|
|
} |
|
|
|
|
|
if (tidx >= 0) { |
|
|
this.append(textLeft.substr(0, tidx)); |
|
|
this.append($("<span>").addClass("bi-keyword-red-mark") |
|
|
.html(BI.htmlEncode(textLeft.substr(tidx, keyword.length)))); |
|
|
|
|
|
textLeft = textLeft.substr(tidx + keyword.length); |
|
|
if (py != null) { |
|
|
py = py.substr(tidx + keyword.length); |
|
|
} |
|
|
} else if (pidx != null && pidx >= 0 && Math.floor(pidx / text.length) === Math.floor((pidx + keyword.length - 1) / text.length)) { |
|
|
this.append(textLeft.substr(0, pidx)); |
|
|
this.append($("<span>").addClass("bi-keyword-red-mark") |
|
|
.html(BI.htmlEncode(textLeft.substr(pidx, keyword.length)))); |
|
|
if (py != null) { |
|
|
py = py.substr(pidx + keyword.length); |
|
|
} |
|
|
textLeft = textLeft.substr(pidx + keyword.length); |
|
|
} else { |
|
|
this.append(textLeft); |
|
|
break; |
|
|
} |
|
|
} |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
getDomHeight: function (parent) { |
|
|
var clone = $(this).clone(); |
|
|
clone.appendTo($(parent || "body")); |
|
|
var height = clone.height(); |
|
|
clone.remove(); |
|
|
return height; |
|
|
}, |
|
|
|
|
|
// 是否有竖直滚动条 |
|
|
hasVerticalScroll: function () { |
|
|
return this.height() > 0 && this[0].clientWidth < this[0].offsetWidth; |
|
|
}, |
|
|
|
|
|
// 是否有水平滚动条 |
|
|
hasHorizonScroll: function () { |
|
|
return this.width() > 0 && this[0].clientHeight < this[0].offsetHeight; |
|
|
}, |
|
|
|
|
|
// 获取计算后的样式 |
|
|
getStyle: function (name) { |
|
|
var node = this[0]; |
|
|
var computedStyle = void 0; |
|
|
|
|
|
// W3C Standard |
|
|
if (window.getComputedStyle) { |
|
|
// In certain cases such as within an iframe in FF3, this returns null. |
|
|
computedStyle = window.getComputedStyle(node, null); |
|
|
if (computedStyle) { |
|
|
return computedStyle.getPropertyValue(BI.hyphenate(name)); |
|
|
} |
|
|
} |
|
|
// Safari |
|
|
if (document.defaultView && document.defaultView.getComputedStyle) { |
|
|
computedStyle = document.defaultView.getComputedStyle(node, null); |
|
|
// A Safari bug causes this to return null for `display: none` elements. |
|
|
if (computedStyle) { |
|
|
return computedStyle.getPropertyValue(BI.hyphenate(name)); |
|
|
} |
|
|
if (name === "display") { |
|
|
return "none"; |
|
|
} |
|
|
} |
|
|
// Internet Explorer |
|
|
if (node.currentStyle) { |
|
|
if (name === "float") { |
|
|
return node.currentStyle.cssFloat || node.currentStyle.styleFloat; |
|
|
} |
|
|
return node.currentStyle[BI.camelize(name)]; |
|
|
} |
|
|
return node.style && node.style[BI.camelize(name)]; |
|
|
}, |
|
|
|
|
|
__isMouseInBounds__: function (e) { |
|
|
var offset2Body = this.offset(); |
|
|
return !(e.pageX < offset2Body.left || e.pageX > offset2Body.left + this.outerWidth() |
|
|
|| e.pageY < offset2Body.top || e.pageY > offset2Body.top + this.outerHeight()); |
|
|
}, |
|
|
|
|
|
__hasZIndexMask__: function (zindex) { |
|
|
return zindex && this.zIndexMask[zindex] != null; |
|
|
}, |
|
|
|
|
|
__buildZIndexMask__: function (zindex, domArray) { |
|
|
this.zIndexMask = this.zIndexMask || {};// 存储z-index的mask |
|
|
this.indexMask = this.indexMask || [];// 存储mask |
|
|
var mask = BI.createWidget({ |
|
|
type: "bi.center_adapt", |
|
|
cls: "bi-z-index-mask", |
|
|
items: domArray |
|
|
}); |
|
|
|
|
|
mask.element.css({"z-index": zindex}); |
|
|
BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
element: this, |
|
|
items: [{ |
|
|
el: mask, |
|
|
left: 0, |
|
|
right: 0, |
|
|
top: 0, |
|
|
bottom: 0 |
|
|
}] |
|
|
}); |
|
|
this.indexMask.push(mask); |
|
|
zindex && (this.zIndexMask[zindex] = mask); |
|
|
return mask.element; |
|
|
}, |
|
|
|
|
|
__releaseZIndexMask__: function (zindex) { |
|
|
if (zindex && this.zIndexMask[zindex]) { |
|
|
this.indexMask.remove(this.zIndexMask[zindex]); |
|
|
this.zIndexMask[zindex].destroy(); |
|
|
return; |
|
|
} |
|
|
this.indexMask = this.indexMask || []; |
|
|
var indexMask = this.indexMask.pop(); |
|
|
indexMask && indexMask.destroy(); |
|
|
} |
|
|
}); |
|
|
|
|
|
BI.extend(jQuery, { |
|
|
|
|
|
getLeftPosition: function (combo, popup, extraWidth) { |
|
|
return { |
|
|
left: combo.element.offset().left - popup.element.outerWidth() - (extraWidth || 0) |
|
|
}; |
|
|
}, |
|
|
|
|
|
getRightPosition: function (combo, popup, extraWidth) { |
|
|
var el = combo.element; |
|
|
return { |
|
|
left: el.offset().left + el.outerWidth() + (extraWidth || 0) |
|
|
}; |
|
|
}, |
|
|
|
|
|
getTopPosition: function (combo, popup, extraHeight) { |
|
|
return { |
|
|
top: combo.element.offset().top - popup.element.outerHeight() - (extraHeight || 0) |
|
|
}; |
|
|
}, |
|
|
|
|
|
getBottomPosition: function (combo, popup, extraHeight) { |
|
|
var el = combo.element; |
|
|
return { |
|
|
top: el.offset().top + el.outerHeight() + (extraHeight || 0) |
|
|
}; |
|
|
}, |
|
|
|
|
|
isLeftSpaceEnough: function (combo, popup, extraWidth) { |
|
|
return $.getLeftPosition(combo, popup, extraWidth).left >= 0; |
|
|
}, |
|
|
|
|
|
isRightSpaceEnough: function (combo, popup, extraWidth) { |
|
|
var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds(); |
|
|
return $.getRightPosition(combo, popup, extraWidth).left + viewBounds.width <= windowBounds.width; |
|
|
}, |
|
|
|
|
|
isTopSpaceEnough: function (combo, popup, extraHeight) { |
|
|
return $.getTopPosition(combo, popup, extraHeight).top >= 0; |
|
|
}, |
|
|
|
|
|
isBottomSpaceEnough: function (combo, popup, extraHeight) { |
|
|
var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds(); |
|
|
return $.getBottomPosition(combo, popup, extraHeight).top + viewBounds.height <= windowBounds.height; |
|
|
}, |
|
|
|
|
|
isRightSpaceLarger: function (combo) { |
|
|
var windowBounds = $("body").bounds(); |
|
|
return windowBounds.width - combo.element.offset().left - combo.element.bounds().width >= combo.element.offset().left; |
|
|
}, |
|
|
|
|
|
isBottomSpaceLarger: function (combo) { |
|
|
var windowBounds = $("body").bounds(); |
|
|
return windowBounds.height - combo.element.offset().top - combo.element.bounds().height >= combo.element.offset().top; |
|
|
}, |
|
|
|
|
|
getLeftAlignPosition: function (combo, popup, extraWidth) { |
|
|
var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds(); |
|
|
var left = combo.element.offset().left + extraWidth; |
|
|
if (left + viewBounds.width > windowBounds.width) { |
|
|
left = windowBounds.width - viewBounds.width; |
|
|
} |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
return { |
|
|
left: left |
|
|
}; |
|
|
}, |
|
|
|
|
|
getLeftAdaptPosition: function (combo, popup, extraWidth) { |
|
|
if ($.isLeftSpaceEnough(combo, popup, extraWidth)) { |
|
|
return $.getLeftPosition(combo, popup, extraWidth); |
|
|
} |
|
|
return { |
|
|
left: 0 |
|
|
}; |
|
|
}, |
|
|
|
|
|
getRightAlignPosition: function (combo, popup, extraWidth) { |
|
|
var comboBounds = combo.element.bounds(), viewBounds = popup.element.bounds(); |
|
|
var left = combo.element.offset().left + comboBounds.width - viewBounds.width - extraWidth; |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
return { |
|
|
left: left |
|
|
}; |
|
|
}, |
|
|
|
|
|
getRightAdaptPosition: function (combo, popup, extraWidth) { |
|
|
if ($.isRightSpaceEnough(combo, popup, extraWidth)) { |
|
|
return $.getRightPosition(combo, popup, extraWidth); |
|
|
} |
|
|
return { |
|
|
left: $("body").bounds().width - popup.element.bounds().width |
|
|
}; |
|
|
}, |
|
|
|
|
|
getTopAlignPosition: function (combo, popup, extraHeight, needAdaptHeight) { |
|
|
var comboOffset = combo.element.offset(); |
|
|
var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(), |
|
|
windowBounds = $("body").bounds(); |
|
|
var top, adaptHeight; |
|
|
if ($.isBottomSpaceEnough(combo, popup, -1 * comboBounds.height + extraHeight)) { |
|
|
top = comboOffset.top + extraHeight; |
|
|
} else if (needAdaptHeight) { |
|
|
top = comboOffset.top + extraHeight; |
|
|
adaptHeight = windowBounds.height - top; |
|
|
} else { |
|
|
top = windowBounds.height - popupBounds.height; |
|
|
if (top < extraHeight) { |
|
|
adaptHeight = windowBounds.height - extraHeight; |
|
|
} |
|
|
} |
|
|
if (top < extraHeight) { |
|
|
top = extraHeight; |
|
|
} |
|
|
return adaptHeight ? { |
|
|
top: top, |
|
|
adaptHeight: adaptHeight |
|
|
} : { |
|
|
top: top |
|
|
}; |
|
|
}, |
|
|
|
|
|
getTopAdaptPosition: function (combo, popup, extraHeight, needAdaptHeight) { |
|
|
var popupBounds = popup.element.bounds(), windowBounds = $("body").bounds(); |
|
|
if ($.isTopSpaceEnough(combo, popup, extraHeight)) { |
|
|
return $.getTopPosition(combo, popup, extraHeight); |
|
|
} |
|
|
if (needAdaptHeight) { |
|
|
return { |
|
|
top: 0, |
|
|
adaptHeight: combo.element.offset().top - extraHeight |
|
|
}; |
|
|
} |
|
|
if (popupBounds.height + extraHeight > windowBounds.height) { |
|
|
return { |
|
|
top: 0, |
|
|
adaptHeight: windowBounds.height - extraHeight |
|
|
}; |
|
|
} |
|
|
return { |
|
|
top: 0 |
|
|
}; |
|
|
}, |
|
|
|
|
|
getBottomAlignPosition: function (combo, popup, extraHeight, needAdaptHeight) { |
|
|
var comboOffset = combo.element.offset(); |
|
|
var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(), |
|
|
windowBounds = $("body").bounds(); |
|
|
var top, adaptHeight; |
|
|
if ($.isTopSpaceEnough(combo, popup, -1 * comboBounds.height + extraHeight)) { |
|
|
top = comboOffset.top + comboBounds.height - popupBounds.height - extraHeight; |
|
|
} else if (needAdaptHeight) { |
|
|
top = 0; |
|
|
adaptHeight = comboOffset.top + comboBounds.height - extraHeight; |
|
|
} else { |
|
|
top = 0; |
|
|
if (popupBounds.height + extraHeight > windowBounds.height) { |
|
|
adaptHeight = windowBounds.height - extraHeight; |
|
|
} |
|
|
} |
|
|
if (top < 0) { |
|
|
top = 0; |
|
|
} |
|
|
return adaptHeight ? { |
|
|
top: top, |
|
|
adaptHeight: adaptHeight |
|
|
} : { |
|
|
top: top |
|
|
}; |
|
|
}, |
|
|
|
|
|
getBottomAdaptPosition: function (combo, popup, extraHeight, needAdaptHeight) { |
|
|
var comboOffset = combo.element.offset(); |
|
|
var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(), |
|
|
windowBounds = $("body").bounds(); |
|
|
if ($.isBottomSpaceEnough(combo, popup, extraHeight)) { |
|
|
return $.getBottomPosition(combo, popup, extraHeight); |
|
|
} |
|
|
if (needAdaptHeight) { |
|
|
return { |
|
|
top: comboOffset.top + comboBounds.height + extraHeight, |
|
|
adaptHeight: windowBounds.height - comboOffset.top - comboBounds.height - extraHeight |
|
|
}; |
|
|
} |
|
|
if (popupBounds.height + extraHeight > windowBounds.height) { |
|
|
return { |
|
|
top: extraHeight, |
|
|
adaptHeight: windowBounds.height - extraHeight |
|
|
}; |
|
|
} |
|
|
return { |
|
|
top: windowBounds.height - popupBounds.height - extraHeight |
|
|
}; |
|
|
}, |
|
|
|
|
|
getCenterAdaptPosition: function (combo, popup) { |
|
|
var comboOffset = combo.element.offset(); |
|
|
var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(), |
|
|
windowBounds = $("body").bounds(); |
|
|
var left; |
|
|
if (comboOffset.left + comboBounds.width / 2 + popupBounds.width / 2 > windowBounds.width) { |
|
|
left = windowBounds.width - popupBounds.width; |
|
|
} else { |
|
|
left = comboOffset.left + comboBounds.width / 2 - popupBounds.width / 2; |
|
|
} |
|
|
if (left < 0) { |
|
|
left = 0; |
|
|
} |
|
|
return { |
|
|
left: left |
|
|
}; |
|
|
}, |
|
|
|
|
|
getMiddleAdaptPosition: function (combo, popup) { |
|
|
var comboOffset = combo.element.offset(); |
|
|
var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(), |
|
|
windowBounds = $("body").bounds(); |
|
|
var top; |
|
|
if (comboOffset.top + comboBounds.height / 2 + popupBounds.height / 2 > windowBounds.height) { |
|
|
top = windowBounds.height - popupBounds.height; |
|
|
} else { |
|
|
top = comboOffset.top + comboBounds.height / 2 - popupBounds.height / 2; |
|
|
} |
|
|
if (top < 0) { |
|
|
top = 0; |
|
|
} |
|
|
return { |
|
|
top: top |
|
|
}; |
|
|
}, |
|
|
|
|
|
getComboPositionByDirections: function (combo, popup, extraWidth, extraHeight, needAdaptHeight, directions) { |
|
|
extraWidth || (extraWidth = 0); |
|
|
extraHeight || (extraHeight = 0); |
|
|
var i, direct; |
|
|
var leftRight = [], topBottom = []; |
|
|
var isNeedAdaptHeight = false, tbFirst = false, lrFirst = false; |
|
|
var left, top, pos; |
|
|
for (i = 0; i < directions.length; i++) { |
|
|
direct = directions[i]; |
|
|
switch (direct) { |
|
|
case "left": |
|
|
leftRight.push(direct); |
|
|
break; |
|
|
case "right": |
|
|
leftRight.push(direct); |
|
|
break; |
|
|
case "top": |
|
|
topBottom.push(direct); |
|
|
break; |
|
|
case "bottom": |
|
|
topBottom.push(direct); |
|
|
break; |
|
|
} |
|
|
} |
|
|
for (i = 0; i < directions.length; i++) { |
|
|
direct = directions[i]; |
|
|
switch (direct) { |
|
|
case "left": |
|
|
if (!isNeedAdaptHeight) { |
|
|
var tW = tbFirst ? extraHeight : extraWidth, tH = tbFirst ? 0 : extraHeight; |
|
|
if ($.isLeftSpaceEnough(combo, popup, tW)) { |
|
|
left = $.getLeftPosition(combo, popup, tW).left; |
|
|
if (topBottom[0] === "bottom") { |
|
|
pos = $.getTopAlignPosition(combo, popup, tH, needAdaptHeight); |
|
|
pos.dir = "left,bottom"; |
|
|
} else { |
|
|
pos = $.getBottomAlignPosition(combo, popup, tH, needAdaptHeight); |
|
|
pos.dir = "left,top"; |
|
|
} |
|
|
if (tbFirst) { |
|
|
pos.change = "left"; |
|
|
} |
|
|
pos.left = left; |
|
|
return pos; |
|
|
} |
|
|
} |
|
|
lrFirst = true; |
|
|
break; |
|
|
case "right": |
|
|
if (!isNeedAdaptHeight) { |
|
|
var tW = tbFirst ? extraHeight : extraWidth, tH = tbFirst ? extraWidth : extraHeight; |
|
|
if ($.isRightSpaceEnough(combo, popup, tW)) { |
|
|
left = $.getRightPosition(combo, popup, tW).left; |
|
|
if (topBottom[0] === "bottom") { |
|
|
pos = $.getTopAlignPosition(combo, popup, tH, needAdaptHeight); |
|
|
pos.dir = "right,bottom"; |
|
|
} else { |
|
|
pos = $.getBottomAlignPosition(combo, popup, tH, needAdaptHeight); |
|
|
pos.dir = "right,top"; |
|
|
} |
|
|
if (tbFirst) { |
|
|
pos.change = "right"; |
|
|
} |
|
|
pos.left = left; |
|
|
return pos; |
|
|
} |
|
|
} |
|
|
lrFirst = true; |
|
|
break; |
|
|
case "top": |
|
|
var tW = lrFirst ? extraHeight : extraWidth, tH = lrFirst ? extraWidth : extraHeight; |
|
|
if ($.isTopSpaceEnough(combo, popup, tH)) { |
|
|
top = $.getTopPosition(combo, popup, tH).top; |
|
|
if (leftRight[0] === "right") { |
|
|
pos = $.getLeftAlignPosition(combo, popup, tW, needAdaptHeight); |
|
|
pos.dir = "top,right"; |
|
|
} else { |
|
|
pos = $.getRightAlignPosition(combo, popup, tW); |
|
|
pos.dir = "top,left"; |
|
|
} |
|
|
if (lrFirst) { |
|
|
pos.change = "top"; |
|
|
} |
|
|
pos.top = top; |
|
|
return pos; |
|
|
} |
|
|
if (needAdaptHeight) { |
|
|
isNeedAdaptHeight = true; |
|
|
} |
|
|
tbFirst = true; |
|
|
break; |
|
|
case "bottom": |
|
|
var tW = lrFirst ? extraHeight : extraWidth, tH = lrFirst ? extraWidth : extraHeight; |
|
|
if ($.isBottomSpaceEnough(combo, popup, tH)) { |
|
|
top = $.getBottomPosition(combo, popup, tH).top; |
|
|
if (leftRight[0] === "right") { |
|
|
pos = $.getLeftAlignPosition(combo, popup, tW, needAdaptHeight); |
|
|
pos.dir = "bottom,right"; |
|
|
} else { |
|
|
pos = $.getRightAlignPosition(combo, popup, tW); |
|
|
pos.dir = "bottom,left"; |
|
|
} |
|
|
if (lrFirst) { |
|
|
pos.change = "bottom"; |
|
|
} |
|
|
pos.top = top; |
|
|
return pos; |
|
|
} |
|
|
if (needAdaptHeight) { |
|
|
isNeedAdaptHeight = true; |
|
|
} |
|
|
tbFirst = true; |
|
|
break; |
|
|
} |
|
|
} |
|
|
|
|
|
switch (directions[0]) { |
|
|
case "left": |
|
|
case "right": |
|
|
if ($.isRightSpaceLarger(combo)) { |
|
|
left = $.getRightAdaptPosition(combo, popup, extraWidth).left; |
|
|
} else { |
|
|
left = $.getLeftAdaptPosition(combo, popup, extraWidth).left; |
|
|
} |
|
|
if (topBottom[0] === "bottom") { |
|
|
pos = $.getTopAlignPosition(combo, popup, extraHeight, needAdaptHeight); |
|
|
pos.left = left; |
|
|
pos.dir = directions[0] + ",bottom"; |
|
|
return pos; |
|
|
} |
|
|
pos = $.getBottomAlignPosition(combo, popup, extraHeight, needAdaptHeight); |
|
|
pos.left = left; |
|
|
pos.dir = directions[0] + ",top"; |
|
|
return pos; |
|
|
default : |
|
|
if ($.isBottomSpaceLarger(combo)) { |
|
|
pos = $.getBottomAdaptPosition(combo, popup, extraHeight, needAdaptHeight); |
|
|
} else { |
|
|
pos = $.getTopAdaptPosition(combo, popup, extraHeight, needAdaptHeight); |
|
|
} |
|
|
if (leftRight[0] === "right") { |
|
|
left = $.getLeftAlignPosition(combo, popup, extraWidth, needAdaptHeight).left; |
|
|
pos.left = left; |
|
|
pos.dir = directions[0] + ",right"; |
|
|
return pos; |
|
|
} |
|
|
left = $.getRightAlignPosition(combo, popup, extraWidth).left; |
|
|
pos.left = left; |
|
|
pos.dir = directions[0] + ",left"; |
|
|
return pos; |
|
|
} |
|
|
}, |
|
|
|
|
|
|
|
|
getComboPosition: function (combo, popup, extraWidth, extraHeight, needAdaptHeight, directions, offsetStyle) { |
|
|
extraWidth || (extraWidth = 0); |
|
|
extraHeight || (extraHeight = 0); |
|
|
var bodyHeight = $("body").bounds().height - extraHeight; |
|
|
var maxHeight = Math.min(popup.attr("maxHeight") || bodyHeight, bodyHeight); |
|
|
popup.resetHeight && popup.resetHeight(maxHeight); |
|
|
var position = $.getComboPositionByDirections(combo, popup, extraWidth, extraHeight, needAdaptHeight, directions || ["bottom", "top", "right", "left"]); |
|
|
switch (offsetStyle) { |
|
|
case "center": |
|
|
if (position.change) { |
|
|
var p = $.getMiddleAdaptPosition(combo, popup); |
|
|
position.top = p.top; |
|
|
} else { |
|
|
var p = $.getCenterAdaptPosition(combo, popup); |
|
|
position.left = p.left; |
|
|
} |
|
|
break; |
|
|
case "middle": |
|
|
if (position.change) { |
|
|
var p = $.getCenterAdaptPosition(combo, popup); |
|
|
position.left = p.left; |
|
|
} else { |
|
|
var p = $.getMiddleAdaptPosition(combo, popup); |
|
|
position.top = p.top; |
|
|
} |
|
|
break; |
|
|
} |
|
|
if (needAdaptHeight === true) { |
|
|
popup.resetHeight && popup.resetHeight(Math.min(bodyHeight - position.top, maxHeight)); |
|
|
} |
|
|
return position; |
|
|
} |
|
|
});/** |
|
|
* 基本的函数 |
|
|
* Created by GUY on 2015/6/24. |
|
|
*/ |
|
|
BI.Func = {}; |
|
|
BI.extend(BI.Func, { |
|
|
/** |
|
|
* 创建唯一的名字 |
|
|
* @param array |
|
|
* @param name |
|
|
* @returns {*} |
|
|
*/ |
|
|
createDistinctName: function (array, name) { |
|
|
var src = name, idx = 1; |
|
|
name = name || ""; |
|
|
while (true) { |
|
|
if (BI.every(array, function (i, item) { |
|
|
return item.name !== name; |
|
|
})) { |
|
|
break; |
|
|
} |
|
|
name = src + (idx++); |
|
|
} |
|
|
return name; |
|
|
}, |
|
|
/** |
|
|
* 获取搜索结果 |
|
|
* @param items |
|
|
* @param keyword |
|
|
* @param param 搜索哪个属性 |
|
|
*/ |
|
|
getSearchResult: function (items, keyword, param) { |
|
|
var isArray = BI.isArray(items); |
|
|
items = isArray ? BI.flatten(items) : items; |
|
|
param || (param = "text"); |
|
|
if (!BI.isKey(keyword)) { |
|
|
return { |
|
|
find: BI.deepClone(items), |
|
|
match: isArray ? [] : {} |
|
|
}; |
|
|
} |
|
|
var t, text, py; |
|
|
keyword = BI.toUpperCase(keyword); |
|
|
var matched = isArray ? [] : {}, find = isArray ? [] : {}; |
|
|
BI.each(items, function (i, item) { |
|
|
item = BI.deepClone(item); |
|
|
t = BI.stripEL(item); |
|
|
text = t[param] || t.text || t.value || t.name || t; |
|
|
py = BI.makeFirstPY(text); |
|
|
text = BI.toUpperCase(text); |
|
|
py = BI.toUpperCase(py); |
|
|
var pidx; |
|
|
if (text.indexOf(keyword) > -1) { |
|
|
if (text === keyword) { |
|
|
isArray ? matched.push(item) : (matched[i] = item); |
|
|
} else { |
|
|
isArray ? find.push(item) : (find[i] = item); |
|
|
} |
|
|
} else if (pidx = py.indexOf(keyword), (pidx > -1 && Math.floor(pidx / text.length) === Math.floor((pidx + keyword.length - 1) / text.length))) { |
|
|
if (text === keyword || keyword.length === text.length) { |
|
|
isArray ? matched.push(item) : (matched[i] = item); |
|
|
} else { |
|
|
isArray ? find.push(item) : (find[i] = item); |
|
|
} |
|
|
} |
|
|
}); |
|
|
return { |
|
|
match: matched, |
|
|
find: find |
|
|
}; |
|
|
} |
|
|
}); |
|
|
|
|
|
/** |
|
|
* 对DOM操作的通用函数 |
|
|
* @type {{}} |
|
|
*/ |
|
|
BI.DOM = {}; |
|
|
BI.extend(BI.DOM, { |
|
|
|
|
|
/** |
|
|
* 把dom数组或元素悬挂起来,使其不对html产生影响 |
|
|
* @param dom |
|
|
*/ |
|
|
hang: function (doms) { |
|
|
if (BI.isEmpty(doms)) { |
|
|
return; |
|
|
} |
|
|
var frag = document.createDocumentFragment(); |
|
|
BI.each(doms, function (i, dom) { |
|
|
dom instanceof BI.Widget && (dom = dom.element); |
|
|
dom instanceof $ && dom[0] && frag.appendChild(dom[0]); |
|
|
}); |
|
|
return frag; |
|
|
}, |
|
|
|
|
|
isExist: function (obj) { |
|
|
return $("body").find(obj.element).length > 0; |
|
|
}, |
|
|
|
|
|
// 预加载图片 |
|
|
preloadImages: function (srcArray, onload) { |
|
|
var count = 0, images = []; |
|
|
|
|
|
function complete () { |
|
|
count++; |
|
|
if (count >= srcArray.length) { |
|
|
onload(); |
|
|
} |
|
|
} |
|
|
|
|
|
BI.each(srcArray, function (i, src) { |
|
|
images[i] = new Image(); |
|
|
images[i].src = src; |
|
|
images[i].onload = function () { |
|
|
complete(); |
|
|
}; |
|
|
images[i].onerror = function () { |
|
|
complete(); |
|
|
}; |
|
|
}); |
|
|
}, |
|
|
|
|
|
isColor: function (color) { |
|
|
return color && (this.isRGBColor(color) || this.isHexColor(color)); |
|
|
}, |
|
|
|
|
|
isRGBColor: function (color) { |
|
|
if (!color) { |
|
|
return false; |
|
|
} |
|
|
return color.substr(0, 3) === "rgb"; |
|
|
}, |
|
|
|
|
|
isHexColor: function (color) { |
|
|
if (!color) { |
|
|
return false; |
|
|
} |
|
|
return color[0] === "#" && color.length === 7; |
|
|
}, |
|
|
|
|
|
isDarkColor: function (hex) { |
|
|
if (!hex || !this.isHexColor(hex)) { |
|
|
return false; |
|
|
} |
|
|
var rgb = this.rgb2json(this.hex2rgb(hex)); |
|
|
var grayLevel = Math.round(rgb.r * 0.299 + rgb.g * 0.587 + rgb.b * 0.114); |
|
|
if (grayLevel < 192/** 网上给的是140**/) { |
|
|
return true; |
|
|
} |
|
|
return false; |
|
|
}, |
|
|
|
|
|
// 获取对比颜色 |
|
|
getContrastColor: function (color) { |
|
|
if (!color || !this.isColor(color)) { |
|
|
return ""; |
|
|
} |
|
|
if (this.isDarkColor(color)) { |
|
|
return "#ffffff"; |
|
|
} |
|
|
return "#1a1a1a"; |
|
|
}, |
|
|
|
|
|
rgb2hex: function (rgbColour) { |
|
|
if (!rgbColour || rgbColour.substr(0, 3) != "rgb") { |
|
|
return ""; |
|
|
} |
|
|
var rgbValues = rgbColour.match(/\d+(\.\d+)?/g); |
|
|
var red = BI.parseInt(rgbValues[0]); |
|
|
var green = BI.parseInt(rgbValues[1]); |
|
|
var blue = BI.parseInt(rgbValues[2]); |
|
|
|
|
|
var hexColour = "#" + this.int2hex(red) + this.int2hex(green) + this.int2hex(blue); |
|
|
|
|
|
return hexColour; |
|
|
}, |
|
|
|
|
|
rgb2json: function (rgbColour) { |
|
|
if (!rgbColour) { |
|
|
return {}; |
|
|
} |
|
|
if (!this.isRGBColor(rgbColour)) { |
|
|
return {}; |
|
|
} |
|
|
var rgbValues = rgbColour.match(/\d+(\.\d+)?/g); |
|
|
return { |
|
|
r: BI.parseInt(rgbValues[0]), |
|
|
g: BI.parseInt(rgbValues[1]), |
|
|
b: BI.parseInt(rgbValues[2]) |
|
|
}; |
|
|
}, |
|
|
|
|
|
rgba2json: function (rgbColour) { |
|
|
if (!rgbColour) { |
|
|
return {}; |
|
|
} |
|
|
var rgbValues = rgbColour.match(/\d+(\.\d+)?/g); |
|
|
return { |
|
|
r: BI.parseInt(rgbValues[0]), |
|
|
g: BI.parseInt(rgbValues[1]), |
|
|
b: BI.parseInt(rgbValues[2]), |
|
|
a: BI.parseFloat(rgbValues[3]) |
|
|
}; |
|
|
}, |
|
|
|
|
|
json2rgb: function (rgb) { |
|
|
if (!BI.isKey(rgb.r) || !BI.isKey(rgb.g) || !BI.isKey(rgb.b)) { |
|
|
return ""; |
|
|
} |
|
|
return "rgb(" + rgb.r + "," + rgb.g + "," + rgb.b + ")"; |
|
|
}, |
|
|
|
|
|
json2rgba: function (rgba) { |
|
|
if (!BI.isKey(rgba.r) || !BI.isKey(rgba.g) || !BI.isKey(rgba.b)) { |
|
|
return ""; |
|
|
} |
|
|
return "rgba(" + rgba.r + "," + rgba.g + "," + rgba.b + "," + rgba.a + ")"; |
|
|
}, |
|
|
|
|
|
int2hex: function (strNum) { |
|
|
var hexdig = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"]; |
|
|
|
|
|
return hexdig[strNum >>> 4] + "" + hexdig[strNum & 15]; |
|
|
}, |
|
|
|
|
|
hex2rgb: function (color) { |
|
|
if (!color) { |
|
|
return ""; |
|
|
} |
|
|
if (!this.isHexColor(color)) { |
|
|
return color; |
|
|
} |
|
|
var tempValue = "rgb(", colorArray; |
|
|
|
|
|
if (color.length === 7) { |
|
|
colorArray = [BI.parseInt("0x" + color.substring(1, 3)), |
|
|
BI.parseInt("0x" + color.substring(3, 5)), |
|
|
BI.parseInt("0x" + color.substring(5, 7))]; |
|
|
} else if (color.length === 4) { |
|
|
colorArray = [BI.parseInt("0x" + color.substring(1, 2)), |
|
|
BI.parseInt("0x" + color.substring(2, 3)), |
|
|
BI.parseInt("0x" + color.substring(3, 4))]; |
|
|
} |
|
|
tempValue += colorArray[0] + ","; |
|
|
tempValue += colorArray[1] + ","; |
|
|
tempValue += colorArray[2] + ")"; |
|
|
|
|
|
return tempValue; |
|
|
}, |
|
|
|
|
|
rgba2rgb: function (rgbColour, BGcolor) { |
|
|
if (BI.isNull(BGcolor)) { |
|
|
BGcolor = 1; |
|
|
} |
|
|
if (rgbColour.substr(0, 4) != "rgba") { |
|
|
return ""; |
|
|
} |
|
|
var rgbValues = rgbColour.match(/\d+(\.\d+)?/g); |
|
|
if (rgbValues.length < 4) { |
|
|
return ""; |
|
|
} |
|
|
var R = BI.parseFloat(rgbValues[0]); |
|
|
var G = BI.parseFloat(rgbValues[1]); |
|
|
var B = BI.parseFloat(rgbValues[2]); |
|
|
var A = BI.parseFloat(rgbValues[3]); |
|
|
|
|
|
return "rgb(" + Math.floor(255 * (BGcolor * (1 - A )) + R * A) + "," + |
|
|
Math.floor(255 * (BGcolor * (1 - A )) + G * A) + "," + |
|
|
Math.floor(255 * (BGcolor * (1 - A )) + B * A) + ")"; |
|
|
}, |
|
|
|
|
|
getTextSizeWidth: function (text, fontSize) { |
|
|
var span = $("<span></span>").addClass("text-width-span").appendTo($("body")); |
|
|
|
|
|
if (fontSize == null) { |
|
|
fontSize = 12; |
|
|
} |
|
|
fontSize = fontSize + "px"; |
|
|
|
|
|
span.css("font-size", fontSize).text(text); |
|
|
|
|
|
var width = span.width(); |
|
|
span.remove(); |
|
|
|
|
|
return width; |
|
|
}, |
|
|
|
|
|
// 获取滚动条的宽度 |
|
|
getScrollWidth: function () { |
|
|
if (this._scrollWidth == null) { |
|
|
var ul = $("<div>").width(50).height(50).css({ |
|
|
position: "absolute", |
|
|
top: "-9999px", |
|
|
overflow: "scroll" |
|
|
}).appendTo($("body")); |
|
|
this._scrollWidth = ul[0].offsetWidth - ul[0].clientWidth; |
|
|
ul.destroy(); |
|
|
} |
|
|
return this._scrollWidth; |
|
|
}, |
|
|
|
|
|
getImage: function (param, fillStyle, backgroundColor) { |
|
|
var canvas = document.createElement("canvas"); |
|
|
$("body").append(canvas); |
|
|
var w = BI.DOM.getTextSizeWidth(param, 14) + 6; |
|
|
canvas.width = w; |
|
|
canvas.height = 24; |
|
|
var ctx = canvas.getContext("2d"); |
|
|
// ctx.fillStyle = "#EAF2FD"; |
|
|
ctx.font = "12px Georgia"; |
|
|
ctx.fillStyle = fillStyle || "#3D4D66"; |
|
|
ctx.textBaseline = "middle"; |
|
|
ctx.fillText(param, 6, 12); |
|
|
$(canvas).destroy(); |
|
|
var backColor = backgroundColor || "#EAF2FD"; |
|
|
return { |
|
|
width: w, |
|
|
height: 24, |
|
|
src: canvas.toDataURL("image/png"), |
|
|
style: "background-color: " + backColor + ";vertical-align: middle; margin: 0 3px;", |
|
|
param: param |
|
|
}; |
|
|
} |
|
|
});(function () { |
|
|
var constantInjection = {}; |
|
|
BI.constant = function (xtype, cls) { |
|
|
if (constantInjection[xtype] != null) { |
|
|
throw ("constant:[" + xtype + "] has been registed"); |
|
|
} |
|
|
constantInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var modelInjection = {}; |
|
|
BI.model = function (xtype, cls) { |
|
|
if (modelInjection[xtype] != null) { |
|
|
throw ("model:[" + xtype + "] has been registed"); |
|
|
} |
|
|
modelInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var storeInjection = {}; |
|
|
BI.store = function (xtype, cls) { |
|
|
if (storeInjection[xtype] != null) { |
|
|
throw ("store:[" + xtype + "] has been registed"); |
|
|
} |
|
|
storeInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var serviceInjection = {}; |
|
|
BI.service = function (xtype, cls) { |
|
|
if (serviceInjection[xtype] != null) { |
|
|
throw ("service:[" + xtype + "] has been registed"); |
|
|
} |
|
|
serviceInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
var providerInjection = {}; |
|
|
BI.provider = function (xtype, cls) { |
|
|
if (providerInjection[xtype] != null) { |
|
|
throw ("provider:[" + xtype + "] has been registed"); |
|
|
} |
|
|
providerInjection[xtype] = cls; |
|
|
}; |
|
|
|
|
|
BI.config = function (type, configFn) { |
|
|
if (constantInjection[type]) { |
|
|
return constantInjection[type] = configFn(constantInjection[type]); |
|
|
} |
|
|
if (providerInjection[type]) { |
|
|
if (!providers[type]) { |
|
|
providers[type] = new providerInjection[type](); |
|
|
} |
|
|
return configFn(providers[type]); |
|
|
} |
|
|
BI.Plugin.configWidget(type, configFn); |
|
|
}; |
|
|
|
|
|
var actions = {}; |
|
|
var globalAction = []; |
|
|
BI.action = function (type, actionFn) { |
|
|
if (BI.isFunction(type)) { |
|
|
globalAction.push(type); |
|
|
return function () { |
|
|
BI.remove(globalAction, actionFn); |
|
|
}; |
|
|
} |
|
|
if (!actions[type]) { |
|
|
actions[type] = []; |
|
|
} |
|
|
actions[type].push(actionFn); |
|
|
return function () { |
|
|
actions[type].remove(actionFn); |
|
|
if (actions[type].length === 0) { |
|
|
delete actions[type]; |
|
|
} |
|
|
}; |
|
|
}; |
|
|
|
|
|
var points = {}; |
|
|
BI.point = function (type, action, pointFn, after) { |
|
|
if (!points[type]) { |
|
|
points[type] = {}; |
|
|
} |
|
|
if (!points[type][action]) { |
|
|
points[type][action] = {}; |
|
|
} |
|
|
if (!points[type][action][after ? "after" : "before"]) { |
|
|
points[type][action][after ? "after" : "before"] = []; |
|
|
} |
|
|
points[type][action][after ? "after" : "before"].push(pointFn); |
|
|
}; |
|
|
|
|
|
BI.Constants = { |
|
|
getConstant: function (type) { |
|
|
return constantInjection[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var callPoint = function (inst, type) { |
|
|
if (points[type]) { |
|
|
for (var action in points[type]) { |
|
|
var bfns = points[type][action].before; |
|
|
if (bfns) { |
|
|
BI.aspect.before(inst, action, function (bfns) { |
|
|
return function () { |
|
|
for (var i = 0, len = bfns.length; i < len; i++) { |
|
|
try { |
|
|
bfns[i].apply(inst, arguments); |
|
|
} catch (e) { |
|
|
console.error(e); |
|
|
} |
|
|
} |
|
|
}; |
|
|
}(bfns)); |
|
|
} |
|
|
var afns = points[type][action].after; |
|
|
if (afns) { |
|
|
BI.aspect.after(inst, action, function (afns) { |
|
|
return function () { |
|
|
for (var i = 0, len = afns.length; i < len; i++) { |
|
|
try { |
|
|
afns[i].apply(inst, arguments); |
|
|
} catch (e) { |
|
|
console.error(e); |
|
|
} |
|
|
} |
|
|
}; |
|
|
}(afns)); |
|
|
} |
|
|
} |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Models = { |
|
|
getModel: function (type, config) { |
|
|
var inst = new modelInjection[type](config); |
|
|
callPoint(inst, type); |
|
|
return inst; |
|
|
} |
|
|
}; |
|
|
|
|
|
var stores = {}; |
|
|
|
|
|
BI.Stores = { |
|
|
getStore: function (type, config) { |
|
|
if (stores[type]) { |
|
|
return stores[type]; |
|
|
} |
|
|
stores[type] = new storeInjection[type](config); |
|
|
callPoint(stores[type], type); |
|
|
return stores[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var services = {}; |
|
|
|
|
|
BI.Services = { |
|
|
getService: function (type, config) { |
|
|
if (services[type]) { |
|
|
return services[type]; |
|
|
} |
|
|
services[type] = new serviceInjection[type](config); |
|
|
callPoint(services[type], type); |
|
|
return services[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
var providers = {}, providerInstance = {}; |
|
|
|
|
|
BI.Providers = { |
|
|
getProvider: function (type, config) { |
|
|
if (!providers[type]) { |
|
|
providers[type] = new providerInjection[type](); |
|
|
} |
|
|
if (!providerInstance[type]) { |
|
|
providerInstance[type] = new providers[type].$get()(config); |
|
|
} |
|
|
return providerInstance[type]; |
|
|
} |
|
|
}; |
|
|
|
|
|
BI.Actions = { |
|
|
runAction: function (type, config) { |
|
|
BI.each(actions[type], function (i, act) { |
|
|
act(config); |
|
|
}); |
|
|
}, |
|
|
runGlobalAction: function () { |
|
|
var args = [].slice.call(arguments); |
|
|
BI.each(globalAction, function (i, act) { |
|
|
act.apply(null, args); |
|
|
}); |
|
|
} |
|
|
}; |
|
|
})(); |
|
|
/** |
|
|
* guy |
|
|
* 检测某个Widget的EventChange事件然后去show某个card |
|
|
* @type {*|void|Object} |
|
|
* @class BI.ShowListener |
|
|
* @extends BI.OB |
|
|
*/ |
|
|
BI.ShowListener = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.ShowListener.superclass._defaultConfig.apply(this, arguments), { |
|
|
eventObj: BI.createWidget(), |
|
|
cardLayout: null, |
|
|
cardNameCreator: function (v) { |
|
|
return v; |
|
|
}, |
|
|
cardCreator: BI.emptyFn, |
|
|
afterCardCreated: BI.emptyFn, |
|
|
afterCardShow: BI.emptyFn |
|
|
}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.ShowListener.superclass._init.apply(this, arguments); |
|
|
var self = this, o = this.options; |
|
|
o.eventObj.on(BI.Controller.EVENT_CHANGE, function (type, v, ob) { |
|
|
if (type === BI.Events.CLICK) { |
|
|
v = v || o.eventObj.getValue(); |
|
|
v = BI.isArray(v) ? (v.length > 1 ? v.toString() : v[0]) : v; |
|
|
if (BI.isNull(v)) { |
|
|
throw new Error("value cannot be null"); |
|
|
} |
|
|
var cardName = o.cardNameCreator(v); |
|
|
if (!o.cardLayout.isCardExisted(cardName)) { |
|
|
var card = o.cardCreator(cardName); |
|
|
o.cardLayout.addCardByName(cardName, card); |
|
|
o.afterCardCreated(cardName); |
|
|
} |
|
|
o.cardLayout.showCardByName(cardName); |
|
|
BI.nextTick(function () { |
|
|
o.afterCardShow(cardName); |
|
|
self.fireEvent(BI.ShowListener.EVENT_CHANGE, cardName); |
|
|
}); |
|
|
} |
|
|
}); |
|
|
} |
|
|
}); |
|
|
BI.ShowListener.EVENT_CHANGE = "ShowListener.EVENT_CHANGE";/** |
|
|
* style加载管理器 |
|
|
* |
|
|
* Created by GUY on 2015/9/7. |
|
|
* @class |
|
|
*/ |
|
|
BI.StyleLoaderManager = BI.inherit(BI.OB, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.StyleLoaderManager.superclass._defaultConfig.apply(this, arguments), {}); |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.StyleLoaderManager.superclass._init.apply(this, arguments); |
|
|
this.stylesManager = {}; |
|
|
}, |
|
|
|
|
|
loadStyle: function (name, styleString) { |
|
|
var d = document, styles = d.createElement("style"); |
|
|
d.getElementsByTagName("head")[0].appendChild(styles); |
|
|
styles.setAttribute("type", "text/css"); |
|
|
if (styles.styleSheet) { |
|
|
styles.styleSheet.cssText = styleString; |
|
|
} else { |
|
|
styles.appendChild(document.createTextNode(styleString)); |
|
|
} |
|
|
this.stylesManager[name] = styles; |
|
|
|
|
|
return this; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return this.stylesManager[name]; |
|
|
}, |
|
|
|
|
|
has: function (name) { |
|
|
return this.stylesManager[name] != null; |
|
|
}, |
|
|
|
|
|
removeStyle: function (name) { |
|
|
if (!this.has(name)) { |
|
|
return this; |
|
|
} |
|
|
this.stylesManager[name].parentNode.removeChild(this.stylesManager[name]); |
|
|
delete this.stylesManager[name]; |
|
|
return this; |
|
|
} |
|
|
});/** |
|
|
* @class BI.Logic |
|
|
* @extends BI.OB |
|
|
*/ |
|
|
BI.Logic = BI.inherit(BI.OB, { |
|
|
createLogic: function () { |
|
|
return this.options || {}; |
|
|
} |
|
|
}); |
|
|
|
|
|
BI.LogicFactory = { |
|
|
Type: { |
|
|
Vertical: "vertical", |
|
|
Horizontal: "horizontal", |
|
|
Table: "table", |
|
|
HorizontalFill: "horizontal_fill" |
|
|
}, |
|
|
createLogic: function (key, options) { |
|
|
var logic; |
|
|
switch (key) { |
|
|
case BI.LogicFactory.Type.Vertical: |
|
|
logic = BI.VerticalLayoutLogic; |
|
|
break; |
|
|
case BI.LogicFactory.Type.Horizontal: |
|
|
logic = BI.HorizontalLayoutLogic; |
|
|
break; |
|
|
case BI.LogicFactory.Type.Table: |
|
|
logic = BI.TableLayoutLogic; |
|
|
break; |
|
|
case BI.LogicFactory.Type.HorizontalFill: |
|
|
logic = BI.HorizontalFillLayoutLogic; |
|
|
break; |
|
|
default : |
|
|
logic = BI.Logic; |
|
|
break; |
|
|
} |
|
|
return new logic(options).createLogic(); |
|
|
}, |
|
|
|
|
|
createLogicTypeByDirection: function (direction) { |
|
|
switch (direction) { |
|
|
case BI.Direction.Top: |
|
|
case BI.Direction.Bottom: |
|
|
case BI.Direction.Custom: |
|
|
return BI.LogicFactory.Type.Vertical; |
|
|
break; |
|
|
case BI.Direction.Left: |
|
|
case BI.Direction.Right: |
|
|
return BI.LogicFactory.Type.Horizontal; |
|
|
} |
|
|
}, |
|
|
|
|
|
createLogicItemsByDirection: function (direction) { |
|
|
var layout; |
|
|
var items = Array.prototype.slice.call(arguments, 1); |
|
|
items = BI.map(items, function (i, item) { |
|
|
if (BI.isWidget(item)) { |
|
|
return { |
|
|
el: item, |
|
|
width: item.options.width, |
|
|
height: item.options.height |
|
|
}; |
|
|
} |
|
|
return item; |
|
|
}); |
|
|
switch (direction) { |
|
|
case BI.Direction.Bottom: |
|
|
layout = BI.LogicFactory.Type.Vertical; |
|
|
items.reverse(); |
|
|
break; |
|
|
case BI.Direction.Right: |
|
|
layout = BI.LogicFactory.Type.Horizontal; |
|
|
items.reverse(); |
|
|
break; |
|
|
case BI.Direction.Custom: |
|
|
items = items.slice(1); |
|
|
break; |
|
|
} |
|
|
return items; |
|
|
} |
|
|
};/** |
|
|
* guy |
|
|
* 上下布局逻辑 |
|
|
* 上下布局的时候要考虑到是动态布局还是静态布局 |
|
|
* |
|
|
* @class BI.VerticalLayoutLogic |
|
|
* @extends BI.Logic |
|
|
*/ |
|
|
BI.VerticalLayoutLogic = BI.inherit(BI.Logic, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.VerticalLayoutLogic.superclass._defaultConfig.apply(this, arguments), { |
|
|
dynamic: false, |
|
|
scrollable: null, |
|
|
scrolly: false, |
|
|
scrollx: false, |
|
|
items: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
createLogic: function () { |
|
|
var layout, o = this.options; |
|
|
if (o.dynamic) { |
|
|
layout = "bi.vertical"; |
|
|
} else { |
|
|
layout = "bi.vtape"; |
|
|
} |
|
|
return { |
|
|
type: layout, |
|
|
scrollable: o.scrollable, |
|
|
scrolly: o.scrolly, |
|
|
scrollx: o.scrollx, |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
lgap: o.lgap, |
|
|
rgap: o.rgap, |
|
|
tgap: o.tgap, |
|
|
bgap: o.bgap, |
|
|
items: o.items |
|
|
}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.VerticalLayoutLogic.superclass._init.apply(this, arguments); |
|
|
} |
|
|
}); |
|
|
|
|
|
|
|
|
/** |
|
|
* guy |
|
|
* 左右布局逻辑 |
|
|
* 左右布局的时候要考虑到是动态布局还是静态布局 |
|
|
* |
|
|
* @class BI.HorizontalLayoutLogic |
|
|
* @extends BI.Logic |
|
|
*/ |
|
|
BI.HorizontalLayoutLogic = BI.inherit(BI.Logic, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.HorizontalLayoutLogic.superclass._defaultConfig.apply(this, arguments), { |
|
|
dynamic: false, |
|
|
scrollable: null, |
|
|
scrolly: false, |
|
|
scrollx: false, |
|
|
items: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
createLogic: function () { |
|
|
var layout, o = this.options; |
|
|
if (o.dynamic) { |
|
|
layout = "bi.vertical_adapt"; |
|
|
} else { |
|
|
layout = "bi.htape"; |
|
|
} |
|
|
return { |
|
|
type: layout, |
|
|
scrollable: o.scrollable, |
|
|
scrolly: o.scrolly, |
|
|
scrollx: o.scrollx, |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
lgap: o.lgap, |
|
|
rgap: o.rgap, |
|
|
tgap: o.tgap, |
|
|
bgap: o.bgap, |
|
|
items: o.items |
|
|
}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.HorizontalLayoutLogic.superclass._init.apply(this, arguments); |
|
|
} |
|
|
}); |
|
|
|
|
|
/** |
|
|
* guy |
|
|
* 表格布局逻辑 |
|
|
* 表格布局的时候要考虑到是动态布局还是静态布局 |
|
|
* |
|
|
* @class BI.TableLayoutLogic |
|
|
* @extends BI.OB |
|
|
*/ |
|
|
BI.TableLayoutLogic = BI.inherit(BI.Logic, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.TableLayoutLogic.superclass._defaultConfig.apply(this, arguments), { |
|
|
dynamic: false, |
|
|
scrollable: null, |
|
|
scrolly: false, |
|
|
scrollx: false, |
|
|
columns: 0, |
|
|
rows: 0, |
|
|
columnSize: [], |
|
|
rowSize: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
items: [] |
|
|
}); |
|
|
}, |
|
|
|
|
|
createLogic: function () { |
|
|
var layout, o = this.options; |
|
|
if (o.dynamic) { |
|
|
layout = "bi.table"; |
|
|
} else { |
|
|
layout = "bi.window"; |
|
|
} |
|
|
return { |
|
|
type: layout, |
|
|
scrollable: o.scrollable, |
|
|
scrolly: o.scrolly, |
|
|
scrollx: o.scrollx, |
|
|
columns: o.columns, |
|
|
rows: o.rows, |
|
|
columnSize: o.columnSize, |
|
|
rowSize: o.rowSize, |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
items: o.items |
|
|
}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.TableLayoutLogic.superclass._init.apply(this, arguments); |
|
|
} |
|
|
}); |
|
|
|
|
|
/** |
|
|
* guy |
|
|
* 左右充满布局逻辑 |
|
|
* |
|
|
* @class BI.HorizontalFillLayoutLogic |
|
|
* @extends BI.Logic |
|
|
*/ |
|
|
BI.HorizontalFillLayoutLogic = BI.inherit(BI.Logic, { |
|
|
_defaultConfig: function () { |
|
|
return BI.extend(BI.HorizontalFillLayoutLogic.superclass._defaultConfig.apply(this, arguments), { |
|
|
dynamic: false, |
|
|
scrollable: null, |
|
|
scrolly: false, |
|
|
scrollx: false, |
|
|
items: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
createLogic: function () { |
|
|
var layout, o = this.options; |
|
|
var columnSize = []; |
|
|
BI.each(o.items, function (i, item) { |
|
|
columnSize.push(item.width || 0); |
|
|
}); |
|
|
if (o.dynamic) { |
|
|
layout = "bi.horizontal_adapt"; |
|
|
} else { |
|
|
layout = "bi.htape"; |
|
|
} |
|
|
return { |
|
|
type: layout, |
|
|
columnSize: columnSize, |
|
|
scrollable: o.scrollable, |
|
|
scrolly: o.scrolly, |
|
|
scrollx: o.scrollx, |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
lgap: o.lgap, |
|
|
rgap: o.rgap, |
|
|
tgap: o.tgap, |
|
|
bgap: o.bgap, |
|
|
items: o.items |
|
|
}; |
|
|
}, |
|
|
|
|
|
_init: function () { |
|
|
BI.HorizontalFillLayoutLogic.superclass._init.apply(this, arguments); |
|
|
} |
|
|
});/** |
|
|
* 对数组对象的扩展 |
|
|
* @class Array |
|
|
*/ |
|
|
_.extend(Array.prototype, { |
|
|
contains: function (o) { |
|
|
return this.indexOf(o) > -1; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 从数组中移除指定的值,如果值不在数组中,则不产生任何效果 |
|
|
* @param {Object} o 要移除的值 |
|
|
* @return {Array} 移除制定值后的数组 |
|
|
*/ |
|
|
remove: function (o) { |
|
|
var index = this.indexOf(o); |
|
|
if (index !== -1) { |
|
|
this.splice(index, 1); |
|
|
} |
|
|
return this; |
|
|
}, |
|
|
|
|
|
pushArray: function (array) { |
|
|
for (var i = 0; i < array.length; i++) { |
|
|
this.push(array[i]); |
|
|
} |
|
|
}, |
|
|
pushDistinct: function (obj) { |
|
|
if (!this.contains(obj)) { |
|
|
this.push(obj); |
|
|
} |
|
|
}, |
|
|
pushDistinctArray: function (array) { |
|
|
for (var i = 0, len = array.length; i < len; i++) { |
|
|
this.pushDistinct(array[i]); |
|
|
} |
|
|
} |
|
|
}); |
|
|
$(function () { |
|
|
// 牵扯到国际化这些常量在页面加载后再生效 |
|
|
// full day names |
|
|
Date._DN = [BI.i18nText("BI-Basic_Sunday"), |
|
|
BI.i18nText("BI-Basic_Monday"), |
|
|
BI.i18nText("BI-Basic_Tuesday"), |
|
|
BI.i18nText("BI-Basic_Wednesday"), |
|
|
BI.i18nText("BI-Basic_Thursday"), |
|
|
BI.i18nText("BI-Basic_Friday"), |
|
|
BI.i18nText("BI-Basic_Saturday"), |
|
|
BI.i18nText("BI-Basic_Sunday")]; |
|
|
|
|
|
// short day names |
|
|
Date._SDN = [BI.i18nText("BI-Basic_Simple_Sunday"), |
|
|
BI.i18nText("BI-Basic_Simple_Monday"), |
|
|
BI.i18nText("BI-Basic_Simple_Tuesday"), |
|
|
BI.i18nText("BI-Basic_Simple_Wednesday"), |
|
|
BI.i18nText("BI-Basic_Simple_Thursday"), |
|
|
BI.i18nText("BI-Basic_Simple_Friday"), |
|
|
BI.i18nText("BI-Basic_Simple_Saturday"), |
|
|
BI.i18nText("BI-Basic_Simple_Sunday")]; |
|
|
|
|
|
// Monday first, etc. |
|
|
Date._FD = 1; |
|
|
|
|
|
// full month namesdat |
|
|
Date._MN = [ |
|
|
BI.i18nText("BI-Basic_January"), |
|
|
BI.i18nText("BI-Basic_February"), |
|
|
BI.i18nText("BI-Basic_March"), |
|
|
BI.i18nText("BI-Basic_April"), |
|
|
BI.i18nText("BI-Basic_May"), |
|
|
BI.i18nText("BI-Basic_June"), |
|
|
BI.i18nText("BI-Basic_July"), |
|
|
BI.i18nText("BI-Basic_August"), |
|
|
BI.i18nText("BI-Basic_September"), |
|
|
BI.i18nText("BI-Basic_October"), |
|
|
BI.i18nText("BI-Basic_November"), |
|
|
BI.i18nText("BI-Basic_December")]; |
|
|
|
|
|
// short month names |
|
|
Date._SMN = [0, |
|
|
1, |
|
|
2, |
|
|
3, |
|
|
4, |
|
|
5, |
|
|
6, |
|
|
7, |
|
|
8, |
|
|
9, |
|
|
10, |
|
|
11]; |
|
|
|
|
|
Date._QN = ["", BI.i18nText("BI-Quarter_1"), |
|
|
BI.i18nText("BI-Quarter_2"), |
|
|
BI.i18nText("BI-Quarter_3"), |
|
|
BI.i18nText("BI-Quarter_4")]; |
|
|
|
|
|
/** Adds the number of days array to the Date object. */ |
|
|
Date._MD = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31]; |
|
|
}); |
|
|
/** Constants used for time computations */ |
|
|
Date.SECOND = 1000; |
|
|
Date.MINUTE = 60 * Date.SECOND; |
|
|
Date.HOUR = 60 * Date.MINUTE; |
|
|
Date.DAY = 24 * Date.HOUR; |
|
|
Date.WEEK = 7 * Date.DAY; |
|
|
|
|
|
/** |
|
|
* 获取时区 |
|
|
* @returns {String} |
|
|
*/ |
|
|
Date.prototype.getTimezone = function () { |
|
|
return this.toString().replace(/^.* (?:\((.*)\)|([A-Z]{1,4})(?:[\-+][0-9]{4})?(?: -?\d+)?)$/, "$1$2").replace(/[^A-Z]/g, ""); |
|
|
}; |
|
|
|
|
|
/** Returns the number of days in the current month */ |
|
|
Date.prototype.getMonthDays = function (month) { |
|
|
var year = this.getFullYear(); |
|
|
if (typeof month === "undefined") { |
|
|
month = this.getMonth(); |
|
|
} |
|
|
if (((0 == (year % 4)) && ( (0 != (year % 100)) || (0 == (year % 400)))) && month == 1) { |
|
|
return 29; |
|
|
} |
|
|
return Date._MD[month]; |
|
|
|
|
|
}; |
|
|
|
|
|
/** |
|
|
* 获取每月的最后一天 |
|
|
* @returns {Date} |
|
|
*/ |
|
|
Date.prototype.getLastDateOfMonth = function () { |
|
|
return BI.getDate(this.getFullYear(), this.getMonth(), this.getMonthDays()); |
|
|
}; |
|
|
|
|
|
/** Returns the number of day in the year. */ |
|
|
Date.prototype.getDayOfYear = function () { |
|
|
var now = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0); |
|
|
var then = BI.getDate(this.getFullYear(), 0, 0, 0, 0, 0); |
|
|
var time = now - then; |
|
|
return Math.floor(time / Date.DAY); |
|
|
}; |
|
|
|
|
|
/** Returns the number of the week in year, as defined in ISO 8601. */ |
|
|
Date.prototype.getWeekNumber = function () { |
|
|
var d = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0); |
|
|
// 周一是一周第一天 |
|
|
var week = d.getDay() === 0 ? 7 : d.getDay(); |
|
|
// var week = d.getDay(); |
|
|
if (this.getMonth() === 0 && this.getDate() <= week) { |
|
|
return 1; |
|
|
} |
|
|
d.setDate(this.getDate() - (week - 1)); |
|
|
var ms = d.valueOf(); // GMT |
|
|
d.setMonth(0); |
|
|
d.setDate(1); |
|
|
var offset = Math.floor((ms - d.valueOf()) / (7 * 864e5)) + 1; |
|
|
if (d.getDay() !== 1) { |
|
|
offset++; |
|
|
} |
|
|
return offset; |
|
|
}; |
|
|
|
|
|
Date.prototype.getQuarter = function () { |
|
|
return Math.floor(this.getMonth() / 3) + 1; |
|
|
}; |
|
|
|
|
|
// 离当前时间多少天的时间 |
|
|
Date.prototype.getOffsetDate = function (offset) { |
|
|
return BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()) + offset * 864e5); |
|
|
}; |
|
|
|
|
|
Date.prototype.getOffsetQuarter = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
var day = dt.getDate(); |
|
|
var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + BI.parseInt(n) * 3, 1).getMonthDays(); |
|
|
if (day > monthDay) { |
|
|
day = monthDay; |
|
|
} |
|
|
dt.setDate(day); |
|
|
dt.setMonth(dt.getMonth() + parseInt(n) * 3); |
|
|
return dt; |
|
|
}; |
|
|
|
|
|
// 得到本季度的起始月份 |
|
|
Date.prototype.getQuarterStartMonth = function () { |
|
|
var quarterStartMonth = 0; |
|
|
var nowMonth = this.getMonth(); |
|
|
if (nowMonth < 3) { |
|
|
quarterStartMonth = 0; |
|
|
} |
|
|
if (2 < nowMonth && nowMonth < 6) { |
|
|
quarterStartMonth = 3; |
|
|
} |
|
|
if (5 < nowMonth && nowMonth < 9) { |
|
|
quarterStartMonth = 6; |
|
|
} |
|
|
if (nowMonth > 8) { |
|
|
quarterStartMonth = 9; |
|
|
} |
|
|
return quarterStartMonth; |
|
|
}; |
|
|
// 获得本季度的起始日期 |
|
|
Date.prototype.getQuarterStartDate = function () { |
|
|
return BI.getDate(this.getFullYear(), this.getQuarterStartMonth(), 1); |
|
|
}; |
|
|
// 得到本季度的结束日期 |
|
|
Date.prototype.getQuarterEndDate = function () { |
|
|
var quarterEndMonth = this.getQuarterStartMonth() + 2; |
|
|
return BI.getDate(this.getFullYear(), quarterEndMonth, this.getMonthDays(quarterEndMonth)); |
|
|
}; |
|
|
|
|
|
// 指定日期n个月之前或之后的日期 |
|
|
Date.prototype.getOffsetMonth = function (n) { |
|
|
var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds())); |
|
|
var day = dt.getDate(); |
|
|
var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + parseInt(n), 1).getMonthDays(); |
|
|
if (day > monthDay) { |
|
|
day = monthDay; |
|
|
} |
|
|
dt.setDate(day); |
|
|
dt.setMonth(dt.getMonth() + parseInt(n)); |
|
|
return dt; |
|
|
}; |
|
|
|
|
|
// 获得本周的起始日期 |
|
|
Date.prototype.getWeekStartDate = function () { |
|
|
var w = this.getDay(); |
|
|
return this.getOffsetDate(w === 0 ? -6 : 1 - w); |
|
|
}; |
|
|
// 得到本周的结束日期 |
|
|
Date.prototype.getWeekEndDate = function () { |
|
|
var w = this.getDay(); |
|
|
return this.getOffsetDate(w === 0 ? 0 : 7 - w); |
|
|
}; |
|
|
|
|
|
/** Checks date and time equality */ |
|
|
Date.prototype.equalsTo = function (date) { |
|
|
return ((this.getFullYear() == date.getFullYear()) && |
|
|
(this.getMonth() == date.getMonth()) && |
|
|
(this.getDate() == date.getDate()) && |
|
|
(this.getHours() == date.getHours()) && |
|
|
(this.getMinutes() == date.getMinutes()) && |
|
|
(this.getSeconds() == date.getSeconds())); |
|
|
}; |
|
|
|
|
|
/** Set only the year, month, date parts (keep existing time) */ |
|
|
Date.prototype.setDateOnly = function (date) { |
|
|
var tmp = BI.getDate(date); |
|
|
this.setDate(1); |
|
|
this.setFullYear(tmp.getFullYear()); |
|
|
this.setMonth(tmp.getMonth()); |
|
|
this.setDate(tmp.getDate()); |
|
|
}; |
|
|
/** Prints the date in a string according to the given format. */ |
|
|
Date.prototype.print = function (str) { |
|
|
var m = this.getMonth(); |
|
|
var d = this.getDate(); |
|
|
var y = this.getFullYear(); |
|
|
var wn = this.getWeekNumber(); |
|
|
var qr = this.getQuarter(); |
|
|
var w = this.getDay(); |
|
|
var s = {}; |
|
|
var hr = this.getHours(); |
|
|
var pm = (hr >= 12); |
|
|
var ir = (pm) ? (hr - 12) : hr; |
|
|
var dy = this.getDayOfYear(); |
|
|
if (ir == 0) { |
|
|
ir = 12; |
|
|
} |
|
|
var min = this.getMinutes(); |
|
|
var sec = this.getSeconds(); |
|
|
s["%a"] = Date._SDN[w]; // abbreviated weekday name [FIXME: I18N] |
|
|
s["%A"] = Date._DN[w]; // full weekday name |
|
|
s["%b"] = Date._SMN[m]; // abbreviated month name [FIXME: I18N] |
|
|
s["%B"] = Date._MN[m]; // full month name |
|
|
// FIXME: %c : preferred date and time representation for the current locale |
|
|
s["%C"] = 1 + Math.floor(y / 100); // the century number |
|
|
s["%d"] = (d < 10) ? ("0" + d) : d; // the day of the month (range 01 to 31) |
|
|
s["%e"] = d; // the day of the month (range 1 to 31) |
|
|
// FIXME: %D : american date style: %m/%d/%y |
|
|
// FIXME: %E, %F, %G, %g, %h (man strftime) |
|
|
s["%H"] = (hr < 10) ? ("0" + hr) : hr; // hour, range 00 to 23 (24h format) |
|
|
s["%I"] = (ir < 10) ? ("0" + ir) : ir; // hour, range 01 to 12 (12h format) |
|
|
s["%j"] = (dy < 100) ? ((dy < 10) ? ("00" + dy) : ("0" + dy)) : dy; // day of the year (range 001 to 366) |
|
|
s["%k"] = hr; // hour, range 0 to 23 (24h format) |
|
|
s["%l"] = ir; // hour, range 1 to 12 (12h format) |
|
|
s["%X"] = (m < 9) ? ("0" + (1 + m)) : (1 + m); // month, range 01 to 12 |
|
|
s["%x"] = m + 1; // month, range 1 to 12 |
|
|
s["%M"] = (min < 10) ? ("0" + min) : min; // minute, range 00 to 59 |
|
|
s["%n"] = "\n"; // a newline character |
|
|
s["%p"] = pm ? "PM" : "AM"; |
|
|
s["%P"] = pm ? "pm" : "am"; |
|
|
// FIXME: %r : the time in am/pm notation %I:%M:%S %p |
|
|
// FIXME: %R : the time in 24-hour notation %H:%M |
|
|
s["%s"] = Math.floor(this.getTime() / 1000); |
|
|
s["%S"] = (sec < 10) ? ("0" + sec) : sec; // seconds, range 00 to 59 |
|
|
s["%t"] = "\t"; // a tab character |
|
|
// FIXME: %T : the time in 24-hour notation (%H:%M:%S) |
|
|
s["%U"] = s["%W"] = s["%V"] = (wn < 10) ? ("0" + wn) : wn; |
|
|
s["%u"] = w + 1; // the day of the week (range 1 to 7, 1 = MON) |
|
|
s["%w"] = w; // the day of the week (range 0 to 6, 0 = SUN) |
|
|
// FIXME: %x : preferred date representation for the current locale without the time |
|
|
// FIXME: %X : preferred time representation for the current locale without the date |
|
|
s["%y"] = ("" + y).substr(2, 2); // year without the century (range 00 to 99) |
|
|
s["%Y"] = y; // year with the century |
|
|
s["%%"] = "%"; // a literal '%' character |
|
|
s["%Q"] = qr; |
|
|
|
|
|
var re = /%./g; |
|
|
if (!BI.isKhtml()) { |
|
|
return str.replace(re, function (par) { |
|
|
return s[par] || par; |
|
|
}); |
|
|
} |
|
|
|
|
|
var a = str.match(re); |
|
|
for (var i = 0; i < a.length; i++) { |
|
|
var tmp = s[a[i]]; |
|
|
if (tmp) { |
|
|
re = new RegExp(a[i], "g"); |
|
|
str = str.replace(re, tmp); |
|
|
} |
|
|
} |
|
|
|
|
|
return str; |
|
|
}; |
|
|
/* |
|
|
* 给jQuery.Event对象添加的工具方法 |
|
|
*/ |
|
|
$.extend($.Event.prototype, { |
|
|
// event.stopEvent |
|
|
stopEvent: function () { |
|
|
this.stopPropagation(); |
|
|
this.preventDefault(); |
|
|
} |
|
|
});Function.prototype.before = function (func) { |
|
|
var __self = this; |
|
|
return function () { |
|
|
if (func.apply(this, arguments) === false) { |
|
|
return false; |
|
|
} |
|
|
return __self.apply(this, arguments); |
|
|
}; |
|
|
}; |
|
|
|
|
|
Function.prototype.after = function (func) { |
|
|
var __self = this; |
|
|
return function () { |
|
|
var ret = __self.apply(this, arguments); |
|
|
if (ret === false) { |
|
|
return false; |
|
|
} |
|
|
func.apply(this, arguments); |
|
|
return ret; |
|
|
}; |
|
|
};if (jQuery) { |
|
|
(function ($) { |
|
|
// richer:容器在其各个边缘留出的空间 |
|
|
if (!$.fn.insets) { |
|
|
$.fn.insets = function () { |
|
|
var p = this.padding(), |
|
|
b = this.border(); |
|
|
return { |
|
|
top: p.top, |
|
|
bottom: p.bottom + b.bottom + b.top, |
|
|
left: p.left, |
|
|
right: p.right + b.right + b.left |
|
|
}; |
|
|
}; |
|
|
} |
|
|
|
|
|
// richer:获取 && 设置jQuery元素的边界 |
|
|
if (!$.fn.bounds) { |
|
|
$.fn.bounds = function (value) { |
|
|
var tmp = {hasIgnoredBounds: true}; |
|
|
|
|
|
if (value) { |
|
|
if (!isNaN(value.x)) { |
|
|
tmp.left = value.x; |
|
|
} |
|
|
if (!isNaN(value.y)) { |
|
|
tmp.top = value.y; |
|
|
} |
|
|
if (value.width != null) { |
|
|
tmp.width = (value.width - (this.outerWidth(true) - this.width())); |
|
|
tmp.width = (tmp.width >= 0) ? tmp.width : value.width; |
|
|
// fix chrome |
|
|
// tmp.width = (tmp.width >= 0) ? tmp.width : 0; |
|
|
} |
|
|
if (value.height != null) { |
|
|
tmp.height = value.height - (this.outerHeight(true) - this.height()); |
|
|
tmp.height = (tmp.height >= 0) ? tmp.height : value.height; |
|
|
// fix chrome |
|
|
// tmp.height = (tmp.height >= 0) ? tmp.height : value.0; |
|
|
} |
|
|
this.css(tmp); |
|
|
return this; |
|
|
} |
|
|
|
|
|
// richer:注意此方法只对可见元素有效 |
|
|
tmp = this.position(); |
|
|
return { |
|
|
x: tmp.left, |
|
|
y: tmp.top, |
|
|
// richer:这里计算外部宽度和高度的时候,都不包括边框 |
|
|
width: this.outerWidth(), |
|
|
height: this.outerHeight() |
|
|
}; |
|
|
|
|
|
}; |
|
|
} |
|
|
})(jQuery); |
|
|
} |
|
|
if (!Number.prototype.toFixed || (0.00008).toFixed(3) !== "0.000" || |
|
|
(0.9).toFixed(0) === "0" || (1.255).toFixed(2) !== "1.25" || |
|
|
(1000000000000000128).toFixed(0) !== "1000000000000000128") { |
|
|
(function () { |
|
|
var base, size, data, i; |
|
|
base = 1e7; |
|
|
size = 6; |
|
|
data = [0, 0, 0, 0, 0, 0]; |
|
|
function multiply (n, c) { |
|
|
var i = -1; |
|
|
while (++i < size) { |
|
|
c += n * data[i]; |
|
|
data[i] = c % base; |
|
|
c = Math.floor(c / base); |
|
|
} |
|
|
} |
|
|
|
|
|
function divide (n) { |
|
|
var i = size, c = 0; |
|
|
while (--i >= 0) { |
|
|
c += data[i]; |
|
|
data[i] = Math.floor(c / n); |
|
|
c = (c % n) * base; |
|
|
} |
|
|
} |
|
|
|
|
|
function toString () { |
|
|
var i = size; |
|
|
var s = ""; |
|
|
while (--i >= 0) { |
|
|
if (s !== "" || i === 0 || data[i] !== 0) { |
|
|
var t = String(data[i]); |
|
|
if (s === "") { |
|
|
s = t; |
|
|
} else { |
|
|
s += "0000000".slice(0, 7 - t.length) + t; |
|
|
} |
|
|
} |
|
|
} |
|
|
return s; |
|
|
} |
|
|
|
|
|
function pow (x, n, acc) { |
|
|
return (n === 0 ? acc : (n % 2 === 1 ? pow(x, n - 1, acc * x) |
|
|
: pow(x * x, n / 2, acc))); |
|
|
} |
|
|
|
|
|
function log (x) { |
|
|
var n = 0; |
|
|
while (x >= 4096) { |
|
|
n += 12; |
|
|
x /= 4096; |
|
|
} |
|
|
while (x >= 2) { |
|
|
n += 1; |
|
|
x /= 2; |
|
|
} |
|
|
return n; |
|
|
} |
|
|
|
|
|
Number.prototype.toFixed = function (fractionDigits) { |
|
|
var f, x, s, m, e, z, j, k; |
|
|
f = Number(fractionDigits); |
|
|
f = f !== f ? 0 : Math.floor(f); |
|
|
|
|
|
if (f < 0 || f > 20) { |
|
|
throw new RangeError("Number.toFixed called with invalid number of decimals"); |
|
|
} |
|
|
|
|
|
x = Number(this); |
|
|
|
|
|
if (x !== x) { |
|
|
return "NaN"; |
|
|
} |
|
|
|
|
|
if (x <= -1e21 || x > 1e21) { |
|
|
return String(x); |
|
|
} |
|
|
|
|
|
s = ""; |
|
|
|
|
|
if (x < 0) { |
|
|
s = "-"; |
|
|
x = -x; |
|
|
} |
|
|
|
|
|
m = "0"; |
|
|
|
|
|
if (x > 1e-21) { |
|
|
// 1e-21<x<1e21 |
|
|
// -70<log2(x)<70 |
|
|
e = log(x * pow(2, 69, 1)) - 69; |
|
|
z = (e < 0 ? x * pow(2, -e, 1) : x / pow(2, e, 1)); |
|
|
z *= 0x10000000000000;// Math.pow(2,52); |
|
|
e = 52 - e; |
|
|
|
|
|
// -18<e<122 |
|
|
// x=z/2^e |
|
|
if (e > 0) { |
|
|
multiply(0, z); |
|
|
j = f; |
|
|
|
|
|
while (j >= 7) { |
|
|
multiply(1e7, 0); |
|
|
j -= 7; |
|
|
} |
|
|
|
|
|
multiply(pow(10, j, 1), 0); |
|
|
j = e - 1; |
|
|
|
|
|
while (j >= 23) { |
|
|
divide(1 << 23); |
|
|
j -= 23; |
|
|
} |
|
|
divide(1 << j); |
|
|
multiply(1, 1); |
|
|
divide(2); |
|
|
m = toString(); |
|
|
} else { |
|
|
multiply(0, z); |
|
|
multiply(1 << (-e), 0); |
|
|
m = toString() + "0.00000000000000000000".slice(2, 2 + f); |
|
|
} |
|
|
} |
|
|
|
|
|
if (f > 0) { |
|
|
k = m.length; |
|
|
|
|
|
if (k <= f) { |
|
|
m = s + "0.0000000000000000000".slice(0, f - k + 2) + m; |
|
|
} else { |
|
|
m = s + m.slice(0, k - f) + "." + m.slice(k - f); |
|
|
} |
|
|
} else { |
|
|
m = s + m; |
|
|
} |
|
|
|
|
|
return m; |
|
|
}; |
|
|
|
|
|
})(); |
|
|
} |
|
|
|
|
|
|
|
|
/** |
|
|
** 加法函数,用来得到精确的加法结果 |
|
|
** 说明:javascript的加法结果会有误差,在两个浮点数相加的时候会比较明显。这个函数返回较为精确的加法结果。 |
|
|
** 调用:accAdd(arg1,arg2) |
|
|
** 返回值:arg1加上arg2的精确结果 |
|
|
**/ |
|
|
function accAdd (arg1, arg2) { |
|
|
var r1, r2, m, c; |
|
|
try { |
|
|
r1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r1 = 0; |
|
|
} |
|
|
try { |
|
|
r2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r2 = 0; |
|
|
} |
|
|
c = Math.abs(r1 - r2); |
|
|
m = Math.pow(10, Math.max(r1, r2)); |
|
|
if (c > 0) { |
|
|
var cm = Math.pow(10, c); |
|
|
if (r1 > r2) { |
|
|
arg1 = Number(arg1.toString().replace(".", "")); |
|
|
arg2 = Number(arg2.toString().replace(".", "")) * cm; |
|
|
} else { |
|
|
arg1 = Number(arg1.toString().replace(".", "")) * cm; |
|
|
arg2 = Number(arg2.toString().replace(".", "")); |
|
|
} |
|
|
} else { |
|
|
arg1 = Number(arg1.toString().replace(".", "")); |
|
|
arg2 = Number(arg2.toString().replace(".", "")); |
|
|
} |
|
|
return (arg1 + arg2) / m; |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个add方法,调用起来更加方便。 |
|
|
Number.prototype.add = function (arg) { |
|
|
return accAdd(arg, this); |
|
|
}; |
|
|
/** |
|
|
** 减法函数,用来得到精确的减法结果 |
|
|
** 说明:javascript的减法结果会有误差,在两个浮点数相减的时候会比较明显。这个函数返回较为精确的减法结果。 |
|
|
** 调用:accSub(arg1,arg2) |
|
|
** 返回值:arg1加上arg2的精确结果 |
|
|
**/ |
|
|
function accSub (arg1, arg2) { |
|
|
var r1, r2, m, n; |
|
|
try { |
|
|
r1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r1 = 0; |
|
|
} |
|
|
try { |
|
|
r2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
r2 = 0; |
|
|
} |
|
|
m = Math.pow(10, Math.max(r1, r2)); // last modify by deeka //动态控制精度长度 |
|
|
n = (r1 >= r2) ? r1 : r2; |
|
|
return ((arg1 * m - arg2 * m) / m).toFixed(n); |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个mul方法,调用起来更加方便。 |
|
|
Number.prototype.sub = function (arg) { |
|
|
return accSub(this, arg); |
|
|
}; |
|
|
/** |
|
|
** 乘法函数,用来得到精确的乘法结果 |
|
|
** 说明:javascript的乘法结果会有误差,在两个浮点数相乘的时候会比较明显。这个函数返回较为精确的乘法结果。 |
|
|
** 调用:accMul(arg1,arg2) |
|
|
** 返回值:arg1乘以 arg2的精确结果 |
|
|
**/ |
|
|
function accMul (arg1, arg2) { |
|
|
var m = 0, s1 = arg1.toString(), s2 = arg2.toString(); |
|
|
try { |
|
|
m += s1.split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
try { |
|
|
m += s2.split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
return Number(s1.replace(".", "")) * Number(s2.replace(".", "")) / Math.pow(10, m); |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个mul方法,调用起来更加方便。 |
|
|
Number.prototype.mul = function (arg) { |
|
|
return accMul(arg, this); |
|
|
}; |
|
|
/** |
|
|
** 除法函数,用来得到精确的除法结果 |
|
|
** 说明:javascript的除法结果会有误差,在两个浮点数相除的时候会比较明显。这个函数返回较为精确的除法结果。 |
|
|
** 调用:accDiv(arg1,arg2) |
|
|
** 返回值:arg1除以arg2的精确结果 |
|
|
**/ |
|
|
function accDiv (arg1, arg2) { |
|
|
var t1 = 0, t2 = 0, r1, r2; |
|
|
try { |
|
|
t1 = arg1.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
try { |
|
|
t2 = arg2.toString().split(".")[1].length; |
|
|
} catch (e) { |
|
|
} |
|
|
with (Math) { |
|
|
r1 = Number(arg1.toString().replace(".", "")); |
|
|
r2 = Number(arg2.toString().replace(".", "")); |
|
|
return (t2 > t1) ? (r1 / r2) * pow(10, t2 - t1) : (r1 / r2) / pow(10, t1 - t2); |
|
|
} |
|
|
} |
|
|
|
|
|
// 给Number类型增加一个div方法,调用起来更加方便。 |
|
|
Number.prototype.div = function (arg) { |
|
|
return accDiv(this, arg); |
|
|
};/** |
|
|
* 对字符串对象的扩展 |
|
|
* @class String |
|
|
*/ |
|
|
_.extend(String.prototype, { |
|
|
|
|
|
/** |
|
|
* 判断字符串是否已指定的字符串开始 |
|
|
* @param {String} startTag 指定的开始字符串 |
|
|
* @return {Boolean} 如果字符串以指定字符串开始则返回true,否则返回false |
|
|
*/ |
|
|
startWith: function (startTag) { |
|
|
if (startTag == null || startTag == "" || this.length === 0 || startTag.length > this.length) { |
|
|
return false; |
|
|
} |
|
|
return this.substr(0, startTag.length) == startTag; |
|
|
}, |
|
|
/** |
|
|
* 判断字符串是否以指定的字符串结束 |
|
|
* @param {String} endTag 指定的字符串 |
|
|
* @return {Boolean} 如果字符串以指定字符串结束则返回true,否则返回false |
|
|
*/ |
|
|
endWith: function (endTag) { |
|
|
if (endTag == null || endTag == "" || this.length === 0 || endTag.length > this.length) { |
|
|
return false; |
|
|
} |
|
|
return this.substring(this.length - endTag.length) == endTag; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 获取url中指定名字的参数 |
|
|
* @param {String} name 参数的名字 |
|
|
* @return {String} 参数的值 |
|
|
*/ |
|
|
getQuery: function (name) { |
|
|
var reg = new RegExp("(^|&)" + name + "=([^&]*)(&|$)"); |
|
|
var r = this.substr(this.indexOf("?") + 1).match(reg); |
|
|
if (r) { |
|
|
return unescape(r[2]); |
|
|
} |
|
|
return null; |
|
|
}, |
|
|
|
|
|
/** |
|
|
* 给url加上给定的参数 |
|
|
* @param {Object} paras 参数对象,是一个键值对对象 |
|
|
* @return {String} 添加了给定参数的url |
|
|
*/ |
|
|
appendQuery: function (paras) { |
|
|
if (!paras) { |
|
|
return this; |
|
|
} |
|
|
var src = this; |
|
|
// 没有问号说明还没有参数 |
|
|
if (src.indexOf("?") === -1) { |
|
|
src += "?"; |
|
|
} |
|
|
// 如果以问号结尾,说明没有其他参数 |
|
|
if (src.endWith("?") !== false) { |
|
|
} else { |
|
|
src += "&"; |
|
|
} |
|
|
_.each(paras, function (value, name) { |
|
|
if (typeof(name) === "string") { |
|
|
src += name + "=" + value + "&"; |
|
|
} |
|
|
}); |
|
|
src = src.substr(0, src.length - 1); |
|
|
return src; |
|
|
}, |
|
|
/** |
|
|
* 将所有符合第一个字符串所表示的字符串替换成为第二个字符串 |
|
|
* @param {String} s1 要替换的字符串的正则表达式 |
|
|
* @param {String} s2 替换的结果字符串 |
|
|
* @returns {String} 替换后的字符串 |
|
|
*/ |
|
|
replaceAll: function (s1, s2) { |
|
|
return this.replace(new RegExp(s1, "gm"), s2); |
|
|
}, |
|
|
/** |
|
|
* 总是让字符串以指定的字符开头 |
|
|
* @param {String} start 指定的字符 |
|
|
* @returns {String} 以指定字符开头的字符串 |
|
|
*/ |
|
|
perfectStart: function (start) { |
|
|
if (this.startWith(start)) { |
|
|
return this; |
|
|
} |
|
|
return start + this; |
|
|
|
|
|
}, |
|
|
|
|
|
/** |
|
|
* 获取字符串中某字符串的所有项位置数组 |
|
|
* @param {String} sub 子字符串 |
|
|
* @return {Number[]} 子字符串在父字符串中出现的所有位置组成的数组 |
|
|
*/ |
|
|
allIndexOf: function (sub) { |
|
|
if (typeof sub !== "string") { |
|
|
return []; |
|
|
} |
|
|
var str = this; |
|
|
var location = []; |
|
|
var offset = 0; |
|
|
while (str.length > 0) { |
|
|
var loc = str.indexOf(sub); |
|
|
if (loc === -1) { |
|
|
break; |
|
|
} |
|
|
location.push(offset + loc); |
|
|
str = str.substring(loc + sub.length, str.length); |
|
|
offset += loc + sub.length; |
|
|
} |
|
|
return location; |
|
|
} |
|
|
});BI.EventListener = { |
|
|
listen: function listen (target, eventType, callback) { |
|
|
if (target.addEventListener) { |
|
|
target.addEventListener(eventType, callback, false); |
|
|
return { |
|
|
remove: function remove () { |
|
|
target.removeEventListener(eventType, callback, false); |
|
|
} |
|
|
}; |
|
|
} else if (target.attachEvent) { |
|
|
target.attachEvent("on" + eventType, callback); |
|
|
return { |
|
|
remove: function remove () { |
|
|
target.detachEvent("on" + eventType, callback); |
|
|
} |
|
|
}; |
|
|
} |
|
|
}, |
|
|
|
|
|
capture: function capture (target, eventType, callback) { |
|
|
if (target.addEventListener) { |
|
|
target.addEventListener(eventType, callback, true); |
|
|
return { |
|
|
remove: function remove () { |
|
|
target.removeEventListener(eventType, callback, true); |
|
|
} |
|
|
}; |
|
|
} |
|
|
return { |
|
|
remove: BI.emptyFn |
|
|
}; |
|
|
|
|
|
}, |
|
|
|
|
|
registerDefault: function registerDefault () { |
|
|
} |
|
|
};!(function () { |
|
|
var cancelAnimationFrame = |
|
|
window.cancelAnimationFrame || |
|
|
window.webkitCancelAnimationFrame || |
|
|
window.mozCancelAnimationFrame || |
|
|
window.oCancelAnimationFrame || |
|
|
window.msCancelAnimationFrame || |
|
|
window.clearTimeout; |
|
|
|
|
|
var requestAnimationFrame = window.requestAnimationFrame || window.webkitRequestAnimationFrame || window.mozRequestAnimationFrame || window.oRequestAnimationFrame || window.msRequestAnimationFrame || window.setTimeout; |
|
|
|
|
|
|
|
|
BI.MouseMoveTracker = function (onMove, onMoveEnd, domNode) { |
|
|
this._isDragging = false; |
|
|
this._animationFrameID = null; |
|
|
this._domNode = domNode; |
|
|
this._onMove = onMove; |
|
|
this._onMoveEnd = onMoveEnd; |
|
|
|
|
|
this._onMouseMove = BI.bind(this._onMouseMove, this); |
|
|
this._onMouseUp = BI.bind(this._onMouseUp, this); |
|
|
this._didMouseMove = BI.bind(this._didMouseMove, this); |
|
|
}; |
|
|
BI.MouseMoveTracker.prototype = { |
|
|
constructor: BI.MouseMoveTracker, |
|
|
captureMouseMoves: function (/* object*/ event) { |
|
|
if (!this._eventMoveToken && !this._eventUpToken) { |
|
|
this._eventMoveToken = BI.EventListener.listen( |
|
|
this._domNode, |
|
|
"mousemove", |
|
|
this._onMouseMove |
|
|
); |
|
|
this._eventUpToken = BI.EventListener.listen( |
|
|
this._domNode, |
|
|
"mouseup", |
|
|
this._onMouseUp |
|
|
); |
|
|
} |
|
|
|
|
|
if (!this._isDragging) { |
|
|
this._deltaX = 0; |
|
|
this._deltaY = 0; |
|
|
this._isDragging = true; |
|
|
this._x = event.clientX; |
|
|
this._y = event.clientY; |
|
|
} |
|
|
event.preventDefault ? event.preventDefault() : (event.returnValue = false); |
|
|
}, |
|
|
|
|
|
releaseMouseMoves: function () { |
|
|
if (this._eventMoveToken && this._eventUpToken) { |
|
|
this._eventMoveToken.remove(); |
|
|
this._eventMoveToken = null; |
|
|
this._eventUpToken.remove(); |
|
|
this._eventUpToken = null; |
|
|
} |
|
|
|
|
|
if (this._animationFrameID !== null) { |
|
|
cancelAnimationFrame(this._animationFrameID); |
|
|
this._animationFrameID = null; |
|
|
} |
|
|
|
|
|
if (this._isDragging) { |
|
|
this._isDragging = false; |
|
|
this._x = null; |
|
|
this._y = null; |
|
|
} |
|
|
}, |
|
|
|
|
|
isDragging: function () /* boolean*/ { |
|
|
return this._isDragging; |
|
|
}, |
|
|
|
|
|
_onMouseMove: function (/* object*/ event) { |
|
|
var x = event.clientX; |
|
|
var y = event.clientY; |
|
|
|
|
|
this._deltaX += (x - this._x); |
|
|
this._deltaY += (y - this._y); |
|
|
|
|
|
if (this._animationFrameID === null) { |
|
|
// The mouse may move faster then the animation frame does. |
|
|
// Use `requestAnimationFrame` to avoid over-updating. |
|
|
this._animationFrameID = |
|
|
requestAnimationFrame(this._didMouseMove); |
|
|
} |
|
|
|
|
|
this._x = x; |
|
|
this._y = y; |
|
|
event.preventDefault ? event.preventDefault() : (event.returnValue = false); |
|
|
}, |
|
|
|
|
|
_didMouseMove: function () { |
|
|
this._animationFrameID = null; |
|
|
this._onMove(this._deltaX, this._deltaY); |
|
|
this._deltaX = 0; |
|
|
this._deltaY = 0; |
|
|
}, |
|
|
|
|
|
_onMouseUp: function () { |
|
|
if (this._animationFrameID) { |
|
|
this._didMouseMove(); |
|
|
} |
|
|
this._onMoveEnd(); |
|
|
} |
|
|
}; |
|
|
})();!(function () { |
|
|
var PIXEL_STEP = 10; |
|
|
var LINE_HEIGHT = 40; |
|
|
var PAGE_HEIGHT = 800; |
|
|
var requestAnimationFrame = window.requestAnimationFrame || window.webkitRequestAnimationFrame || window.mozRequestAnimationFrame || window.oRequestAnimationFrame || window.msRequestAnimationFrame || window.setTimeout; |
|
|
|
|
|
function normalizeWheel (/* object*/event) /* object*/ { |
|
|
var sX = 0, |
|
|
sY = 0, |
|
|
// spinX, spinY |
|
|
pX = 0, |
|
|
pY = 0; // pixelX, pixelY |
|
|
|
|
|
// Legacy |
|
|
if ("detail" in event) { |
|
|
sY = event.detail; |
|
|
} |
|
|
if ("wheelDelta" in event) { |
|
|
sY = -event.wheelDelta / 120; |
|
|
} |
|
|
if ("wheelDeltaY" in event) { |
|
|
sY = -event.wheelDeltaY / 120; |
|
|
} |
|
|
if ("wheelDeltaX" in event) { |
|
|
sX = -event.wheelDeltaX / 120; |
|
|
} |
|
|
|
|
|
// side scrolling on FF with DOMMouseScroll |
|
|
if ("axis" in event && event.axis === event.HORIZONTAL_AXIS) { |
|
|
sX = sY; |
|
|
sY = 0; |
|
|
} |
|
|
|
|
|
pX = sX * PIXEL_STEP; |
|
|
pY = sY * PIXEL_STEP; |
|
|
|
|
|
if ("deltaY" in event) { |
|
|
pY = event.deltaY; |
|
|
} |
|
|
if ("deltaX" in event) { |
|
|
pX = event.deltaX; |
|
|
} |
|
|
|
|
|
if ((pX || pY) && event.deltaMode) { |
|
|
if (event.deltaMode === 1) { |
|
|
// delta in LINE units |
|
|
pX *= LINE_HEIGHT; |
|
|
pY *= LINE_HEIGHT; |
|
|
} else { |
|
|
// delta in PAGE units |
|
|
pX *= PAGE_HEIGHT; |
|
|
pY *= PAGE_HEIGHT; |
|
|
} |
|
|
} |
|
|
|
|
|
// Fall-back if spin cannot be determined |
|
|
if (pX && !sX) { |
|
|
sX = pX < 1 ? -1 : 1; |
|
|
} |
|
|
if (pY && !sY) { |
|
|
sY = pY < 1 ? -1 : 1; |
|
|
} |
|
|
|
|
|
return { |
|
|
spinX: sX, |
|
|
spinY: sY, |
|
|
pixelX: pX, |
|
|
pixelY: pY |
|
|
}; |
|
|
} |
|
|
|
|
|
BI.WheelHandler = function (onWheel, handleScrollX, handleScrollY, stopPropagation) { |
|
|
this._animationFrameID = null; |
|
|
this._deltaX = 0; |
|
|
this._deltaY = 0; |
|
|
this._didWheel = BI.bind(this._didWheel, this); |
|
|
if (typeof handleScrollX !== "function") { |
|
|
handleScrollX = handleScrollX ? |
|
|
function () { |
|
|
return true; |
|
|
} : |
|
|
function () { |
|
|
return false; |
|
|
}; |
|
|
} |
|
|
|
|
|
if (typeof handleScrollY !== "function") { |
|
|
handleScrollY = handleScrollY ? |
|
|
function () { |
|
|
return true; |
|
|
} : |
|
|
function () { |
|
|
return false; |
|
|
}; |
|
|
} |
|
|
|
|
|
if (typeof stopPropagation !== "function") { |
|
|
stopPropagation = stopPropagation ? |
|
|
function () { |
|
|
return true; |
|
|
} : |
|
|
function () { |
|
|
return false; |
|
|
}; |
|
|
} |
|
|
|
|
|
this._handleScrollX = handleScrollX; |
|
|
this._handleScrollY = handleScrollY; |
|
|
this._stopPropagation = stopPropagation; |
|
|
this._onWheelCallback = onWheel; |
|
|
this.onWheel = BI.bind(this.onWheel, this); |
|
|
}; |
|
|
BI.WheelHandler.prototype = { |
|
|
constructor: BI.WheelHandler, |
|
|
onWheel: function (/* object*/ event) { |
|
|
var normalizedEvent = normalizeWheel(event); |
|
|
var deltaX = this._deltaX + normalizedEvent.pixelX; |
|
|
var deltaY = this._deltaY + normalizedEvent.pixelY; |
|
|
var handleScrollX = this._handleScrollX(deltaX, deltaY); |
|
|
var handleScrollY = this._handleScrollY(deltaY, deltaX); |
|
|
if (!handleScrollX && !handleScrollY) { |
|
|
return; |
|
|
} |
|
|
|
|
|
this._deltaX += handleScrollX ? normalizedEvent.pixelX : 0; |
|
|
this._deltaY += handleScrollY ? normalizedEvent.pixelY : 0; |
|
|
event.preventDefault ? event.preventDefault() : (event.returnValue = false); |
|
|
|
|
|
var changed; |
|
|
if (this._deltaX !== 0 || this._deltaY !== 0) { |
|
|
if (this._stopPropagation()) { |
|
|
event.stopPropagation ? event.stopPropagation() : (event.cancelBubble = true); |
|
|
} |
|
|
changed = true; |
|
|
} |
|
|
|
|
|
if (changed === true && this._animationFrameID === null) { |
|
|
this._animationFrameID = requestAnimationFrame(this._didWheel); |
|
|
} |
|
|
}, |
|
|
|
|
|
_didWheel: function () { |
|
|
this._animationFrameID = null; |
|
|
this._onWheelCallback(this._deltaX, this._deltaY); |
|
|
this._deltaX = 0; |
|
|
this._deltaY = 0; |
|
|
} |
|
|
}; |
|
|
})();/** |
|
|
* 常量 |
|
|
*/ |
|
|
|
|
|
_.extend(BI, { |
|
|
MAX: 0xfffffffffffffff, |
|
|
MIN: -0xfffffffffffffff, |
|
|
EVENT_RESPONSE_TIME: 200, |
|
|
zIndex_layer: 1e5, |
|
|
zIndex_popover: 1e6, |
|
|
zIndex_popup: 1e7, |
|
|
zIndex_masker: 1e8, |
|
|
zIndex_tip: 1e9, |
|
|
emptyStr: "", |
|
|
emptyFn: function () { |
|
|
}, |
|
|
empty: null, |
|
|
Key: { |
|
|
48: "0", |
|
|
49: "1", |
|
|
50: "2", |
|
|
51: "3", |
|
|
52: "4", |
|
|
53: "5", |
|
|
54: "6", |
|
|
55: "7", |
|
|
56: "8", |
|
|
57: "9", |
|
|
65: "a", |
|
|
66: "b", |
|
|
67: "c", |
|
|
68: "d", |
|
|
69: "e", |
|
|
70: "f", |
|
|
71: "g", |
|
|
72: "h", |
|
|
73: "i", |
|
|
74: "j", |
|
|
75: "k", |
|
|
76: "l", |
|
|
77: "m", |
|
|
78: "n", |
|
|
79: "o", |
|
|
80: "p", |
|
|
81: "q", |
|
|
82: "r", |
|
|
83: "s", |
|
|
84: "t", |
|
|
85: "u", |
|
|
86: "v", |
|
|
87: "w", |
|
|
88: "x", |
|
|
89: "y", |
|
|
90: "z", |
|
|
96: "0", |
|
|
97: "1", |
|
|
98: "2", |
|
|
99: "3", |
|
|
100: "4", |
|
|
101: "5", |
|
|
102: "6", |
|
|
103: "7", |
|
|
104: "8", |
|
|
105: "9", |
|
|
106: "*", |
|
|
107: "+", |
|
|
109: "-", |
|
|
110: ".", |
|
|
111: "/" |
|
|
}, |
|
|
KeyCode: { |
|
|
BACKSPACE: 8, |
|
|
COMMA: 188, |
|
|
DELETE: 46, |
|
|
DOWN: 40, |
|
|
END: 35, |
|
|
ENTER: 13, |
|
|
ESCAPE: 27, |
|
|
HOME: 36, |
|
|
LEFT: 37, |
|
|
NUMPAD_ADD: 107, |
|
|
NUMPAD_DECIMAL: 110, |
|
|
NUMPAD_DIVIDE: 111, |
|
|
NUMPAD_ENTER: 108, |
|
|
NUMPAD_MULTIPLY: 106, |
|
|
NUMPAD_SUBTRACT: 109, |
|
|
PAGE_DOWN: 34, |
|
|
PAGE_UP: 33, |
|
|
PERIOD: 190, |
|
|
RIGHT: 39, |
|
|
SPACE: 32, |
|
|
TAB: 9, |
|
|
UP: 38 |
|
|
}, |
|
|
Status: { |
|
|
SUCCESS: 1, |
|
|
WRONG: 2, |
|
|
START: 3, |
|
|
END: 4, |
|
|
WAITING: 5, |
|
|
READY: 6, |
|
|
RUNNING: 7, |
|
|
OUTOFBOUNDS: 8, |
|
|
NULL: -1 |
|
|
}, |
|
|
Direction: { |
|
|
Top: "top", |
|
|
Bottom: "bottom", |
|
|
Left: "left", |
|
|
Right: "right", |
|
|
Custom: "custom" |
|
|
}, |
|
|
Axis: { |
|
|
Vertical: "vertical", |
|
|
Horizontal: "horizontal" |
|
|
}, |
|
|
Selection: { |
|
|
Default: -2, |
|
|
None: -1, |
|
|
Single: 0, |
|
|
Multi: 1, |
|
|
All: 2 |
|
|
}, |
|
|
HorizontalAlign: { |
|
|
Left: "left", |
|
|
Right: "right", |
|
|
Center: "center", |
|
|
Stretch: "stretch" |
|
|
}, |
|
|
VerticalAlign: { |
|
|
Middle: "middle", |
|
|
Top: "top", |
|
|
Bottom: "bottom", |
|
|
Stretch: "stretch" |
|
|
} |
|
|
});BI.version = "2.0";/** |
|
|
* absolute实现的居中布局 |
|
|
* @class BI.AbsoluteCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.AbsoluteCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.AbsoluteCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-absolute-center-layout", |
|
|
hgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
BI.AbsoluteCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.AbsoluteCenterLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0), |
|
|
right: o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0), |
|
|
top: o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0), |
|
|
bottom: o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0), |
|
|
margin: "auto" |
|
|
}); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("absolute_center_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.AbsoluteCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.absolute_center_adapt", BI.AbsoluteCenterLayout);/** |
|
|
* absolute实现的居中布局 |
|
|
* @class BI.AbsoluteHorizontalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.AbsoluteHorizontalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.AbsoluteHorizontalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-absolute-horizontal-layout", |
|
|
hgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
BI.AbsoluteHorizontalLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.AbsoluteHorizontalLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0), |
|
|
right: o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0), |
|
|
margin: "auto" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.vgap || 0) + (item.tgap || 0) !== 0) { |
|
|
w.element.css("top", o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0)); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.vgap || 0) + (item.bgap || 0) !== 0) { |
|
|
w.element.css("bottom", o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0)); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("absolute_horizontal_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.AbsoluteHorizontalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.absolute_horizontal_adapt", BI.AbsoluteHorizontalLayout);/** |
|
|
* absolute实现的居中布局 |
|
|
* @class BI.AbsoluteVerticalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.AbsoluteVerticalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.AbsoluteVerticalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-absolute-vertical-layout", |
|
|
hgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
BI.AbsoluteVerticalLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.AbsoluteVerticalLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: item.lgap, |
|
|
right: item.rgap, |
|
|
top: o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0), |
|
|
bottom: o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0), |
|
|
margin: "auto" |
|
|
}); |
|
|
if (o.hgap + o.lgap + (item.hgap || 0) + (item.lgap || 0) !== 0) { |
|
|
w.element.css("left", o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0)); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.hgap || 0) + (item.rgap || 0) !== 0) { |
|
|
w.element.css("right", o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0)); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("absolute_vertical_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.AbsoluteVerticalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.absolute_vertical_adapt", BI.AbsoluteVerticalLayout);/** |
|
|
* 自适应水平和垂直方向都居中容器 |
|
|
* @class BI.CenterAdaptLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.CenterAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.CenterAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-center-adapt-layout", |
|
|
columnSize: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.CenterAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({ |
|
|
position: "relative", |
|
|
width: "100%", |
|
|
height: "100%", |
|
|
"white-space": "nowrap", |
|
|
"border-spacing": "0px", |
|
|
border: "none", |
|
|
"border-collapse": "separate" |
|
|
}); |
|
|
this.$tr = $("<tr>"); |
|
|
this.$tr.appendTo(this.$table); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var td; |
|
|
var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i]; |
|
|
if (!this.hasWidget(this._getChildName(i))) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"}); |
|
|
td = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
tagName: "td", |
|
|
attributes: { |
|
|
width: width |
|
|
}, |
|
|
items: [w] |
|
|
}); |
|
|
this.addWidget(this._getChildName(i), td); |
|
|
} else { |
|
|
td = this.getWidgetByName(this._getChildName(i)); |
|
|
td.element.attr("width", width); |
|
|
} |
|
|
td.element.css({"max-width": o.columnSize[i]}); |
|
|
if (i === 0) { |
|
|
td.element.addClass("first-element"); |
|
|
} |
|
|
td.element.css({ |
|
|
position: "relative", |
|
|
height: "100%", |
|
|
"vertical-align": "middle", |
|
|
margin: "0", |
|
|
padding: "0", |
|
|
border: "none" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return td; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$tr.append(frag); |
|
|
this.element.append(this.$table); |
|
|
} |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("center_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$tr; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.CenterAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.center_adapt", BI.CenterAdaptLayout);/** |
|
|
* 水平方向居中容器 |
|
|
* @class BI.HorizontalAdaptLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HorizontalAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HorizontalAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-horizontal-adapt-layout", |
|
|
verticalAlign: BI.VerticalAlign.Top, |
|
|
columnSize: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.HorizontalAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({ |
|
|
position: "relative", |
|
|
width: "100%", |
|
|
"white-space": "nowrap", |
|
|
"border-spacing": "0px", |
|
|
border: "none", |
|
|
"border-collapse": "separate" |
|
|
}); |
|
|
this.$tr = $("<tr>"); |
|
|
this.$tr.appendTo(this.$table); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var td; |
|
|
var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i]; |
|
|
if (!this.hasWidget(this._getChildName(i))) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"}); |
|
|
td = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
tagName: "td", |
|
|
attributes: { |
|
|
width: width |
|
|
}, |
|
|
items: [w] |
|
|
}); |
|
|
this.addWidget(this._getChildName(i), td); |
|
|
} else { |
|
|
td = this.getWidgetByName(this._getChildName(i)); |
|
|
td.element.attr("width", width); |
|
|
} |
|
|
td.element.css({"max-width": o.columnSize[i] + "px"}); |
|
|
if (i === 0) { |
|
|
td.element.addClass("first-element"); |
|
|
} |
|
|
td.element.css({ |
|
|
position: "relative", |
|
|
"vertical-align": o.verticalAlign, |
|
|
margin: "0", |
|
|
padding: "0", |
|
|
border: "none" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return td; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$tr.append(frag); |
|
|
this.element.append(this.$table); |
|
|
} |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("horizontal_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$tr; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal_adapt", BI.HorizontalAdaptLayout);/** |
|
|
* 左右分离,垂直方向居中容器 |
|
|
* items:{ |
|
|
left: [{el:{type:"bi.button"}}], |
|
|
right:[{el:{type:"bi.button"}}] |
|
|
} |
|
|
* @class BI.LeftRightVerticalAdaptLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.LeftRightVerticalAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.LeftRightVerticalAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-left-right-vertical-adapt-layout", |
|
|
items: {}, |
|
|
llgap: 0, |
|
|
lrgap: 0, |
|
|
lhgap: 0, |
|
|
rlgap: 0, |
|
|
rrgap: 0, |
|
|
rhgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.LeftRightVerticalAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("left_right_vertical_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function () { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var o = this.options; |
|
|
if ("left" in items) { |
|
|
var left = BI.createWidget({ |
|
|
type: "bi.vertical_adapt", |
|
|
items: items.left, |
|
|
hgap: o.lhgap, |
|
|
lgap: o.llgap, |
|
|
rgap: o.lrgap |
|
|
}); |
|
|
left.element.css("height", "100%"); |
|
|
BI.createWidget({ |
|
|
type: "bi.left", |
|
|
element: this, |
|
|
items: [left] |
|
|
}); |
|
|
} |
|
|
if ("right" in items) { |
|
|
var right = BI.createWidget({ |
|
|
type: "bi.vertical_adapt", |
|
|
items: items.right, |
|
|
hgap: o.rhgap, |
|
|
lgap: o.rlgap, |
|
|
rgap: o.rrgap |
|
|
}); |
|
|
right.element.css("height", "100%"); |
|
|
BI.createWidget({ |
|
|
type: "bi.right", |
|
|
element: this, |
|
|
items: [right] |
|
|
}); |
|
|
} |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.LeftRightVerticalAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.left_right_vertical_adapt", BI.LeftRightVerticalAdaptLayout); |
|
|
|
|
|
|
|
|
BI.LeftVerticalAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.LeftRightVerticalAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-left-vertical-adapt-layout", |
|
|
items: [], |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
hgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.LeftVerticalAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("left_vertical_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function () { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var o = this.options; |
|
|
var left = BI.createWidget({ |
|
|
type: "bi.vertical_adapt", |
|
|
items: items, |
|
|
lgap: o.lgap, |
|
|
hgap: o.hgap, |
|
|
rgap: o.rgap |
|
|
}); |
|
|
left.element.css("height", "100%"); |
|
|
BI.createWidget({ |
|
|
type: "bi.left", |
|
|
element: this, |
|
|
items: [left] |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.LeftVerticalAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.left_vertical_adapt", BI.LeftVerticalAdaptLayout); |
|
|
|
|
|
BI.RightVerticalAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.RightVerticalAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-right-vertical-adapt-layout", |
|
|
items: [], |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
hgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.RightVerticalAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
|
|
|
}, |
|
|
|
|
|
addItem: function () { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var o = this.options; |
|
|
var right = BI.createWidget({ |
|
|
type: "bi.vertical_adapt", |
|
|
items: items, |
|
|
lgap: o.lgap, |
|
|
hgap: o.hgap, |
|
|
rgap: o.rgap |
|
|
}); |
|
|
right.element.css("height", "100%"); |
|
|
BI.createWidget({ |
|
|
type: "bi.right", |
|
|
element: this, |
|
|
items: [right] |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.RightVerticalAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.right_vertical_adapt", BI.RightVerticalAdaptLayout);/** |
|
|
* 垂直方向居中容器 |
|
|
* @class BI.VerticalAdaptLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.VerticalAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: { |
|
|
baseCls: "bi-vertical-adapt-layout", |
|
|
columnSize: [], |
|
|
horizontalAlign: BI.HorizontalAlign.Left, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}, |
|
|
render: function () { |
|
|
BI.VerticalAdaptLayout.superclass.render.apply(this, arguments); |
|
|
var o = this.options; |
|
|
this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({ |
|
|
position: "relative", |
|
|
width: o.horizontalAlign === BI.HorizontalAlign.Stretch ? "100%" : "auto", |
|
|
height: "100%", |
|
|
"white-space": "nowrap", |
|
|
"border-spacing": "0px", |
|
|
border: "none", |
|
|
"border-collapse": "separate" |
|
|
}); |
|
|
this.$tr = $("<tr>"); |
|
|
this.$tr.appendTo(this.$table); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var td; |
|
|
var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i]; |
|
|
if (!this.hasWidget(this._getChildName(i))) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"}); |
|
|
td = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
tagName: "td", |
|
|
attributes: { |
|
|
width: width |
|
|
}, |
|
|
items: [w] |
|
|
}); |
|
|
this.addWidget(this._getChildName(i), td); |
|
|
} else { |
|
|
td = this.getWidgetByName(this._getChildName(i)); |
|
|
td.element.attr("width", width); |
|
|
} |
|
|
|
|
|
if (i === 0) { |
|
|
td.element.addClass("first-element"); |
|
|
} |
|
|
td.element.css({ |
|
|
position: "relative", |
|
|
height: "100%", |
|
|
"vertical-align": "middle", |
|
|
margin: "0", |
|
|
padding: "0", |
|
|
border: "none" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return td; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$tr.append(frag); |
|
|
this.element.append(this.$table); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$tr; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("vertical_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.VerticalAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.vertical_adapt", BI.VerticalAdaptLayout);/** |
|
|
* 水平方向居中自适应容器 |
|
|
* @class BI.HorizontalAutoLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HorizontalAutoLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HorizontalAutoLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-horizon-auto-layout", |
|
|
hgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
BI.HorizontalAutoLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.HorizontalAutoLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({ |
|
|
position: "relative", |
|
|
margin: "0px auto" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": (i === 0 ? o.vgap : 0) + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("horizontal_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalAutoLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal_auto", BI.HorizontalAutoLayout);/** |
|
|
* 浮动的居中布局 |
|
|
*/ |
|
|
BI.FloatCenterAdaptLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FloatCenterAdaptLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-float-center-adapt-layout", |
|
|
items: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FloatCenterAdaptLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("float_center_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function () { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
mounted: function () { |
|
|
var self = this; |
|
|
var width = this.left.element.outerWidth(), |
|
|
height = this.left.element.outerHeight(); |
|
|
this.left.element.width(width).height(height).css("float", "none"); |
|
|
BI.remove(this._children, function (i, wi) { |
|
|
if (wi === self.container) { |
|
|
delete self._children[i]; |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.center_adapt", |
|
|
element: this, |
|
|
items: [this.left] |
|
|
}); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
this.left = BI.createWidget({ |
|
|
type: "bi.vertical", |
|
|
items: items, |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
tgap: o.tgap, |
|
|
bgap: o.bgap, |
|
|
lgap: o.lgap, |
|
|
rgap: o.rgap |
|
|
}); |
|
|
|
|
|
this.container = BI.createWidget({ |
|
|
type: "bi.left", |
|
|
element: this, |
|
|
items: [this.left] |
|
|
}); |
|
|
|
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FloatCenterAdaptLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.float_center_adapt", BI.FloatCenterAdaptLayout);/** |
|
|
* 浮动的水平居中布局 |
|
|
*/ |
|
|
BI.FloatHorizontalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FloatHorizontalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-float-horizontal-adapt-layout", |
|
|
items: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FloatHorizontalLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("float_horizontal_adapt布局不需要resize"); |
|
|
}, |
|
|
|
|
|
mounted: function () { |
|
|
var self = this; |
|
|
var width = this.left.element.width(), |
|
|
height = this.left.element.height(); |
|
|
this.left.element.width(width).height(height).css("float", "none"); |
|
|
BI.remove(this._children, function (i, wi) { |
|
|
if (wi === self.container) { |
|
|
delete self._children[i]; |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.horizontal_auto", |
|
|
element: this, |
|
|
items: [this.left] |
|
|
}); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var self = this, o = this.options; |
|
|
this.left = BI.createWidget({ |
|
|
type: "bi.vertical", |
|
|
items: [item], |
|
|
hgap: o.hgap, |
|
|
vgap: o.vgap, |
|
|
tgap: o.tgap, |
|
|
bgap: o.bgap, |
|
|
lgap: o.lgap, |
|
|
rgap: o.rgap |
|
|
}); |
|
|
|
|
|
this.container = BI.createWidget({ |
|
|
type: "bi.left", |
|
|
element: this, |
|
|
items: [this.left] |
|
|
}); |
|
|
|
|
|
return this.left; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalAutoLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal_float", BI.FloatHorizontalLayout);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-center-layout" |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexCenterLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", "flex-shrink": "0"}); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_center", BI.FlexCenterLayout);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexHorizontalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexHorizontalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexHorizontalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-horizontal-layout", |
|
|
verticalAlign: BI.VerticalAlign.Top, |
|
|
columnSize: [], |
|
|
scrollx: true, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexHorizontalLayout.superclass.render.apply(this, arguments); |
|
|
var o = this.options; |
|
|
this.element.addClass(o.verticalAlign); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexHorizontalLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", "flex-shrink": "0"}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_horizontal布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexHorizontalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_horizontal", BI.FlexHorizontalLayout);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexVerticalCenter |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexVerticalCenter = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexVerticalCenter.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-vertical-center", |
|
|
horizontalAlign: BI.HorizontalAlign.Left, |
|
|
columnSize: [], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexVerticalCenter.superclass.render.apply(this, arguments); |
|
|
var o = this.options; |
|
|
this.element.addClass(o.horizontalAlign); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexVerticalCenter.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", "flex-shrink": "0"}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_vertical_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexVerticalCenter.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_vertical_center", BI.FlexVerticalCenter);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-wrapper-center-layout clearfix" |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.$wrapper = $("<div>").addClass("flex-wrapper-center-layout-wrapper"); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexCenterLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative"}); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$wrapper.append(frag); |
|
|
this.element.append(this.$wrapper); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$wrapper; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_wrapper_center", BI.FlexCenterLayout);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexHorizontalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexHorizontalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexHorizontalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-wrapper-horizontal-layout clearfix", |
|
|
verticalAlign: BI.VerticalAlign.Middle, |
|
|
columnSize: [], |
|
|
// scrollable: true, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexHorizontalLayout.superclass.render.apply(this, arguments); |
|
|
var o = this.options; |
|
|
this.$wrapper = $("<div>").addClass("flex-wrapper-horizontal-layout-wrapper " + o.verticalAlign); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexHorizontalLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative"}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$wrapper.append(frag); |
|
|
this.element.append(this.$wrapper); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$wrapper; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_horizontal布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexHorizontalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_wrapper_horizontal", BI.FlexHorizontalLayout);/** |
|
|
*自适应水平和垂直方向都居中容器 |
|
|
* Created by GUY on 2016/12/2. |
|
|
* |
|
|
* @class BI.FlexVerticalCenter |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FlexVerticalCenter = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FlexVerticalCenter.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-flex-wrapper-vertical-center clearfix", |
|
|
horizontalAlign: BI.HorizontalAlign.Middle, |
|
|
columnSize: [], |
|
|
// scrollable: true, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FlexVerticalCenter.superclass.render.apply(this, arguments); |
|
|
var o = this.options; |
|
|
this.$wrapper = $("<div>").addClass("flex-wrapper-vertical-center-wrapper " + o.horizontalAlign); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FlexVerticalCenter.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative"}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$wrapper.append(frag); |
|
|
this.element.append(this.$wrapper); |
|
|
} |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$wrapper; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("flex_vertical_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FlexVerticalCenter.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.flex_wrapper_vertical_center", BI.FlexVerticalCenter);/** |
|
|
* 固定子组件上下左右的布局容器 |
|
|
* @class BI.AbsoluteLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.AbsoluteLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.AbsoluteLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-absolute-layout", |
|
|
hgap: null, |
|
|
vgap: null, |
|
|
lgap: null, |
|
|
rgap: null, |
|
|
tgap: null, |
|
|
bgap: null |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.AbsoluteLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.AbsoluteLayout.superclass._addElement.apply(this, arguments); |
|
|
var left = 0, right = 0, top = 0, bottom = 0; |
|
|
if (BI.isNotNull(item.left)) { |
|
|
w.element.css({left: item.left}); |
|
|
left += item.left; |
|
|
} |
|
|
if (BI.isNotNull(item.right)) { |
|
|
w.element.css({right: item.right}); |
|
|
right += item.right; |
|
|
} |
|
|
if (BI.isNotNull(item.top)) { |
|
|
w.element.css({top: item.top}); |
|
|
top += item.top; |
|
|
} |
|
|
if (BI.isNotNull(item.bottom)) { |
|
|
w.element.css({bottom: item.bottom}); |
|
|
bottom += item.bottom; |
|
|
} |
|
|
|
|
|
if (BI.isNotNull(o.hgap)) { |
|
|
left += o.hgap; |
|
|
w.element.css({left: left}); |
|
|
right += o.hgap; |
|
|
w.element.css({right: right}); |
|
|
} |
|
|
if (BI.isNotNull(o.vgap)) { |
|
|
top += o.vgap; |
|
|
w.element.css({top: top}); |
|
|
bottom += o.vgap; |
|
|
w.element.css({bottom: bottom}); |
|
|
} |
|
|
|
|
|
if (BI.isNotNull(o.lgap)) { |
|
|
left += o.lgap; |
|
|
w.element.css({left: left}); |
|
|
} |
|
|
if (BI.isNotNull(o.rgap)) { |
|
|
right += o.rgap; |
|
|
w.element.css({right: right}); |
|
|
} |
|
|
if (BI.isNotNull(o.tgap)) { |
|
|
top += o.tgap; |
|
|
w.element.css({top: top}); |
|
|
} |
|
|
if (BI.isNotNull(o.bgap)) { |
|
|
bottom += o.bgap; |
|
|
w.element.css({bottom: bottom}); |
|
|
} |
|
|
|
|
|
|
|
|
if (BI.isNotNull(item.width)) { |
|
|
w.element.css({width: item.width}); |
|
|
} |
|
|
if (BI.isNotNull(item.height)) { |
|
|
w.element.css({height: item.height}); |
|
|
} |
|
|
w.element.css({position: "absolute"}); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
this.options.items = items || []; |
|
|
var self = this; |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
if (!BI.isWidget(item) && !item.el) { |
|
|
throw new Error("el must be exist"); |
|
|
} |
|
|
self._addElement(i, item); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.AbsoluteLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.absolute", BI.AbsoluteLayout);BI.AdaptiveLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.AdaptiveLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-adaptive-layout", |
|
|
hgap: null, |
|
|
vgap: null, |
|
|
lgap: null, |
|
|
rgap: null, |
|
|
tgap: null, |
|
|
bgap: null |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.AdaptiveLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.AdaptiveLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative"}); |
|
|
var left = 0, right = 0, top = 0, bottom = 0; |
|
|
if (BI.isNotNull(item.left)) { |
|
|
w.element.css({ |
|
|
"margin-left": item.left |
|
|
}); |
|
|
} |
|
|
if (BI.isNotNull(item.right)) { |
|
|
w.element.css({ |
|
|
"margin-right": item.right |
|
|
}); |
|
|
} |
|
|
if (BI.isNotNull(item.top)) { |
|
|
w.element.css({ |
|
|
"margin-top": item.top |
|
|
}); |
|
|
} |
|
|
if (BI.isNotNull(item.bottom)) { |
|
|
w.element.css({ |
|
|
"margin-bottom": item.bottom |
|
|
}); |
|
|
} |
|
|
|
|
|
if (BI.isNotNull(o.hgap)) { |
|
|
left += o.hgap; |
|
|
w.element.css({left: left}); |
|
|
right += o.hgap; |
|
|
w.element.css({right: right}); |
|
|
} |
|
|
if (BI.isNotNull(o.vgap)) { |
|
|
top += o.vgap; |
|
|
w.element.css({top: top}); |
|
|
bottom += o.vgap; |
|
|
w.element.css({bottom: bottom}); |
|
|
} |
|
|
|
|
|
if (BI.isNotNull(o.lgap)) { |
|
|
left += o.lgap; |
|
|
w.element.css({left: left}); |
|
|
} |
|
|
if (BI.isNotNull(o.rgap)) { |
|
|
right += o.rgap; |
|
|
w.element.css({right: right}); |
|
|
} |
|
|
if (BI.isNotNull(o.tgap)) { |
|
|
top += o.tgap; |
|
|
w.element.css({top: top}); |
|
|
} |
|
|
if (BI.isNotNull(o.bgap)) { |
|
|
bottom += o.bgap; |
|
|
w.element.css({bottom: bottom}); |
|
|
} |
|
|
|
|
|
if (BI.isNotNull(item.width)) { |
|
|
w.element.css({width: item.width}); |
|
|
} |
|
|
if (BI.isNotNull(item.height)) { |
|
|
w.element.css({height: item.height}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.AbsoluteLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.adaptive", BI.AdaptiveLayout);/** |
|
|
* 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应 |
|
|
* |
|
|
* @class BI.BorderLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.BorderLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.BorderLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-border-layout", |
|
|
items: {} |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.BorderLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (regions) { |
|
|
var item; |
|
|
var top = 0; |
|
|
var bottom = 0; |
|
|
var left = 0; |
|
|
var right = 0; |
|
|
if ("north" in regions) { |
|
|
item = regions["north"]; |
|
|
if (item != null) { |
|
|
if (item.el) { |
|
|
if (!this.hasWidget(this.getName() + "north")) { |
|
|
var w = BI.createWidget(item); |
|
|
this.addWidget(this.getName() + "north", w); |
|
|
} |
|
|
this.getWidgetByName(this.getName() + "north").element.height(item.height) |
|
|
.css({ |
|
|
position: "absolute", |
|
|
top: (item.top || 0), |
|
|
left: (item.left || 0), |
|
|
right: (item.right || 0), |
|
|
bottom: "initial" |
|
|
}); |
|
|
} |
|
|
top = (item.height || 0) + (item.top || 0) + (item.bottom || 0); |
|
|
} |
|
|
} |
|
|
if ("south" in regions) { |
|
|
item = regions["south"]; |
|
|
if (item != null) { |
|
|
if (item.el) { |
|
|
if (!this.hasWidget(this.getName() + "south")) { |
|
|
var w = BI.createWidget(item); |
|
|
this.addWidget(this.getName() + "south", w); |
|
|
} |
|
|
this.getWidgetByName(this.getName() + "south").element.height(item.height) |
|
|
.css({ |
|
|
position: "absolute", |
|
|
bottom: (item.bottom || 0), |
|
|
left: (item.left || 0), |
|
|
right: (item.right || 0), |
|
|
top: "initial" |
|
|
}); |
|
|
} |
|
|
bottom = (item.height || 0) + (item.top || 0) + (item.bottom || 0); |
|
|
} |
|
|
} |
|
|
if ("west" in regions) { |
|
|
item = regions["west"]; |
|
|
if (item != null) { |
|
|
if (item.el) { |
|
|
if (!this.hasWidget(this.getName() + "west")) { |
|
|
var w = BI.createWidget(item); |
|
|
this.addWidget(this.getName() + "west", w); |
|
|
} |
|
|
this.getWidgetByName(this.getName() + "west").element.width(item.width) |
|
|
.css({ |
|
|
position: "absolute", |
|
|
left: (item.left || 0), |
|
|
top: top, |
|
|
bottom: bottom, |
|
|
right: "initial" |
|
|
}); |
|
|
} |
|
|
left = (item.width || 0) + (item.left || 0) + (item.right || 0); |
|
|
} |
|
|
} |
|
|
if ("east" in regions) { |
|
|
item = regions["east"]; |
|
|
if (item != null) { |
|
|
if (item.el) { |
|
|
if (!this.hasWidget(this.getName() + "east")) { |
|
|
var w = BI.createWidget(item); |
|
|
this.addWidget(this.getName() + "east", w); |
|
|
} |
|
|
this.getWidgetByName(this.getName() + "east").element.width(item.width) |
|
|
.css({ |
|
|
position: "absolute", |
|
|
right: (item.right || 0), |
|
|
top: top, |
|
|
bottom: bottom, |
|
|
left: "initial" |
|
|
}); |
|
|
} |
|
|
right = (item.width || 0) + (item.left || 0) + (item.right || 0); |
|
|
} |
|
|
} |
|
|
if ("center" in regions) { |
|
|
item = regions["center"]; |
|
|
if (item != null) { |
|
|
if (!this.hasWidget(this.getName() + "center")) { |
|
|
var w = BI.createWidget(item); |
|
|
this.addWidget(this.getName() + "center", w); |
|
|
} |
|
|
this.getWidgetByName(this.getName() + "center").element |
|
|
.css({position: "absolute", top: top, bottom: bottom, left: left, right: right}); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.BorderLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.border", BI.BorderLayout);/** |
|
|
* 卡片布局,可以做到当前只显示一个组件,其他的都隐藏 |
|
|
* @class BI.CardLayout |
|
|
* @extends BI.Layout |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
* @cfg {String} options.defaultShowName 默认展示的子组件名 |
|
|
*/ |
|
|
BI.CardLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.CardLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-card-layout", |
|
|
items: [] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.CardLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("default布局不需要resize"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
this.showIndex = void 0; |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
if (!self.hasWidget(item.cardName)) { |
|
|
var w = BI.createWidget(item); |
|
|
w.on(BI.Events.DESTROY, function () { |
|
|
var index = BI.findIndex(o.items, function (i, tItem) { |
|
|
return tItem.cardName == item.cardName; |
|
|
}); |
|
|
if (index > -1) { |
|
|
o.items.splice(index, 1); |
|
|
} |
|
|
}); |
|
|
self.addWidget(item.cardName, w); |
|
|
} else { |
|
|
var w = self.getWidgetByName(item.cardName); |
|
|
} |
|
|
w.element.css({position: "absolute", top: "0", right: "0", bottom: "0", left: "0"}); |
|
|
w.setVisible(false); |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
update: function () { |
|
|
}, |
|
|
|
|
|
empty: function () { |
|
|
BI.CardLayout.superclass.empty.apply(this, arguments); |
|
|
this.options.items = []; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.CardLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
this.options.defaultShowName && this.showCardByName(this.options.defaultShowName); |
|
|
}, |
|
|
|
|
|
isCardExisted: function (cardName) { |
|
|
return BI.some(this.options.items, function (i, item) { |
|
|
return item.cardName == cardName && item.el; |
|
|
}); |
|
|
}, |
|
|
|
|
|
getCardByName: function (cardName) { |
|
|
if (!this.isCardExisted(cardName)) { |
|
|
throw new Error("cardName is not exist"); |
|
|
} |
|
|
return this._children[cardName]; |
|
|
}, |
|
|
|
|
|
_deleteCardByName: function (cardName) { |
|
|
delete this._children[cardName]; |
|
|
var index = BI.findIndex(this.options.items, function (i, item) { |
|
|
return item.cardName == cardName; |
|
|
}); |
|
|
if (index > -1) { |
|
|
this.options.items.splice(index, 1); |
|
|
} |
|
|
}, |
|
|
|
|
|
deleteCardByName: function (cardName) { |
|
|
if (!this.isCardExisted(cardName)) { |
|
|
throw new Error("cardName is not exist"); |
|
|
} |
|
|
|
|
|
var child = this._children[cardName]; |
|
|
this._deleteCardByName(cardName); |
|
|
child && child._destroy(); |
|
|
}, |
|
|
|
|
|
addCardByName: function (cardName, cardItem) { |
|
|
if (this.isCardExisted(cardName)) { |
|
|
throw new Error("cardName is already exist"); |
|
|
} |
|
|
var widget = BI.createWidget(cardItem, this); |
|
|
widget.element.css({ |
|
|
position: "relative", |
|
|
top: "0", |
|
|
left: "0", |
|
|
width: "100%", |
|
|
height: "100%" |
|
|
}).appendTo(this.element); |
|
|
widget.invisible(); |
|
|
this.addWidget(cardName, widget); |
|
|
this.options.items.push({el: cardItem, cardName: cardName}); |
|
|
return widget; |
|
|
}, |
|
|
|
|
|
showCardByName: function (name, action, callback) { |
|
|
var self = this; |
|
|
// name不存在的时候全部隐藏 |
|
|
var exist = this.isCardExisted(name); |
|
|
if (this.showIndex != null) { |
|
|
this.lastShowIndex = this.showIndex; |
|
|
} |
|
|
this.showIndex = name; |
|
|
var flag = false; |
|
|
BI.each(this.options.items, function (i, item) { |
|
|
var el = self._children[item.cardName]; |
|
|
if (el) { |
|
|
if (name != item.cardName) { |
|
|
// 动画效果只有在全部都隐藏的时候才有意义,且只要执行一次动画操作就够了 |
|
|
!flag && !exist && (BI.Action && action instanceof BI.Action) ? (action.actionBack(el), flag = true) : el.invisible(); |
|
|
} else { |
|
|
(BI.Action && action instanceof BI.Action) ? action.actionPerformed(void 0, el, callback) : (el.visible(), callback && callback()); |
|
|
} |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
showLastCard: function () { |
|
|
var self = this; |
|
|
this.showIndex = this.lastShowIndex; |
|
|
BI.each(this.options.items, function (i, item) { |
|
|
self._children[item.cardName].setVisible(self.showIndex == i); |
|
|
}); |
|
|
}, |
|
|
|
|
|
setDefaultShowName: function (name) { |
|
|
this.options.defaultShowName = name; |
|
|
return this; |
|
|
}, |
|
|
|
|
|
getDefaultShowName: function () { |
|
|
return this.options.defaultShowName; |
|
|
}, |
|
|
|
|
|
getAllCardNames: function () { |
|
|
return BI.map(this.options.items, function (i, item) { |
|
|
return item.cardName; |
|
|
}); |
|
|
}, |
|
|
|
|
|
getShowingCard: function () { |
|
|
if (!BI.isKey(this.showIndex)) { |
|
|
return void 0; |
|
|
} |
|
|
return this.getWidgetByName(this.showIndex); |
|
|
}, |
|
|
|
|
|
deleteAllCard: function () { |
|
|
var self = this; |
|
|
BI.each(this.getAllCardNames(), function (i, name) { |
|
|
self.deleteCardByName(name); |
|
|
}); |
|
|
}, |
|
|
|
|
|
hideAllCard: function () { |
|
|
var self = this; |
|
|
BI.each(this.options.items, function (i, item) { |
|
|
self._children[item.cardName].invisible(); |
|
|
}); |
|
|
}, |
|
|
|
|
|
isAllCardHide: function () { |
|
|
var self = this; |
|
|
var flag = true; |
|
|
BI.some(this.options.items, function (i, item) { |
|
|
if (self._children[item.cardName].isVisible()) { |
|
|
flag = false; |
|
|
return false; |
|
|
} |
|
|
}); |
|
|
return flag; |
|
|
}, |
|
|
|
|
|
removeWidget: function (nameOrWidget) { |
|
|
var removeName; |
|
|
if (BI.isWidget(nameOrWidget)) { |
|
|
BI.each(this._children, function (name, child) { |
|
|
if (child === nameOrWidget) { |
|
|
removeName = name; |
|
|
} |
|
|
}); |
|
|
} else { |
|
|
removeName = nameOrWidget; |
|
|
} |
|
|
if (removeName) { |
|
|
this._deleteCardByName(removeName); |
|
|
} |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.card", BI.CardLayout);/** |
|
|
* 默认的布局方式 |
|
|
* |
|
|
* @class BI.DefaultLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.DefaultLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.DefaultLayout.superclass.props.apply(this, arguments), { |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
items: [] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.DefaultLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.DefaultLayout.superclass._addElement.apply(this, arguments); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": o.hgap + o.lgap + (item.lgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("default布局不需要resize") |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.DefaultLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.default", BI.DefaultLayout);/** |
|
|
* 分隔容器的控件,按照宽度和高度所占比平分整个容器 |
|
|
* |
|
|
* @class BI.DivisionLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.DivisionLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.DivisionLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-division-layout", |
|
|
columns: null, |
|
|
rows: null, |
|
|
items: [] |
|
|
// [ |
|
|
// { |
|
|
// column: 0, |
|
|
// row: 0, |
|
|
// width: 0.25, |
|
|
// height: 0.33, |
|
|
// el: {type: 'bi.button', text: 'button1'} |
|
|
// }, |
|
|
// { |
|
|
// column: 1, |
|
|
// row: 1, |
|
|
// width: 0.25, |
|
|
// height: 0.33, |
|
|
// el: {type: 'bi.button', text: 'button2'} |
|
|
// }, |
|
|
// { |
|
|
// column: 3, |
|
|
// row: 2, |
|
|
// width: 0.25, |
|
|
// height: 0.33, |
|
|
// el: {type: 'bi.button', text: 'button3'} |
|
|
// } |
|
|
// ] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.DivisionLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.opitons.items); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var o = this.options; |
|
|
var rows = o.rows || o.items.length, columns = o.columns || ((o.items[0] && o.items[0].length) | 0); |
|
|
var map = BI.makeArray(rows), widths = {}, heights = {}; |
|
|
function firstElement (item, row, col) { |
|
|
if (row === 0) { |
|
|
item.addClass("first-row"); |
|
|
} |
|
|
if (col === 0) { |
|
|
item.addClass("first-col"); |
|
|
} |
|
|
item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row"); |
|
|
item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col"); |
|
|
item.addClass("center-element"); |
|
|
} |
|
|
|
|
|
function firstObject (item, row, col) { |
|
|
var cls = ""; |
|
|
if (row === 0) { |
|
|
cls += " first-row"; |
|
|
} |
|
|
if (col === 0) { |
|
|
cls += " first-col"; |
|
|
} |
|
|
BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row"); |
|
|
BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col"); |
|
|
item.cls = (item.cls || "") + cls + " center-element"; |
|
|
} |
|
|
|
|
|
function first (item, row, col) { |
|
|
if (item instanceof BI.Widget) { |
|
|
firstElement(item.element, row, col); |
|
|
} else if (item.el instanceof BI.Widget) { |
|
|
firstElement(item.el.element, row, col); |
|
|
} else if (item.el) { |
|
|
firstObject(item.el, row, col); |
|
|
} else { |
|
|
firstObject(item, row, col); |
|
|
} |
|
|
} |
|
|
BI.each(map, function (i) { |
|
|
map[i] = BI.makeArray(columns); |
|
|
}); |
|
|
BI.each(items, function (i, item) { |
|
|
if (BI.isArray(item)) { |
|
|
BI.each(item, function (j, el) { |
|
|
widths[i] = (widths[i] || 0) + item.width; |
|
|
heights[j] = (heights[j] || 0) + item.height; |
|
|
map[i][j] = el; |
|
|
}); |
|
|
return; |
|
|
} |
|
|
widths[item.row] = (widths[item.row] || 0) + item.width; |
|
|
heights[item.column] = (heights[item.column] || 0) + item.height; |
|
|
map[item.row][item.column] = item; |
|
|
}); |
|
|
for (var i = 0; i < rows; i++) { |
|
|
var totalW = 0; |
|
|
for (var j = 0; j < columns; j++) { |
|
|
if (!map[i][j]) { |
|
|
throw new Error("item be required"); |
|
|
} |
|
|
if(!this.hasWidget(this.getName() + i + "_" + j)) { |
|
|
var w = BI.createWidget(map[i][j]); |
|
|
this.addWidget(this.getName() + i + "_" + j, w); |
|
|
} else { |
|
|
w = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
} |
|
|
var left = totalW * 100 / widths[i]; |
|
|
w.element.css({position: "absolute", left: left + "%"}); |
|
|
if (j > 0) { |
|
|
var lastW = this.getWidgetByName(this.getName() + i + "_" + (j - 1)); |
|
|
lastW.element.css({right: (100 - left) + "%"}); |
|
|
} |
|
|
if (j == o.columns - 1) { |
|
|
w.element.css({right: "0%"}); |
|
|
} |
|
|
first(w, i, j); |
|
|
totalW += map[i][j].width; |
|
|
} |
|
|
} |
|
|
for (var j = 0; j < o.columns; j++) { |
|
|
var totalH = 0; |
|
|
for (var i = 0; i < o.rows; i++) { |
|
|
var w = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
var top = totalH * 100 / heights[j]; |
|
|
w.element.css({top: top + "%"}); |
|
|
if (i > 0) { |
|
|
var lastW = this.getWidgetByName(this.getName() + (i - 1) + "_" + j); |
|
|
lastW.element.css({bottom: (100 - top) + "%"}); |
|
|
} |
|
|
if (i == o.rows - 1) { |
|
|
w.element.css({bottom: "0%"}); |
|
|
} |
|
|
totalH += map[i][j].height; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.DivisionLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.division", BI.DivisionLayout);/** |
|
|
* 靠左对齐的自由浮动布局 |
|
|
* @class BI.FloatLeftLayout |
|
|
* @extends BI.Layout |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
* @cfg {Number} [hgap=0] 水平间隙 |
|
|
* @cfg {Number} [vgap=0] 垂直间隙 |
|
|
*/ |
|
|
BI.FloatLeftLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FloatLeftLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-float-left-layout clearfix", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FloatLeftLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FloatLeftLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", float: "left"}); |
|
|
if (BI.isNotNull(item.left)) { |
|
|
w.element.css({left: item.left}); |
|
|
} |
|
|
if (BI.isNotNull(item.right)) { |
|
|
w.element.css({right: item.right}); |
|
|
} |
|
|
if (BI.isNotNull(item.top)) { |
|
|
w.element.css({top: item.top}); |
|
|
} |
|
|
if (BI.isNotNull(item.bottom)) { |
|
|
w.element.css({bottom: item.bottom}); |
|
|
} |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FloatLeftLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.left", BI.FloatLeftLayout); |
|
|
|
|
|
/** |
|
|
* 靠右对齐的自由浮动布局 |
|
|
* @class BI.FloatRightLayout |
|
|
* @extends BI.Layout |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
* @cfg {Number} [hgap=0] 水平间隙 |
|
|
* @cfg {Number} [vgap=0] 垂直间隙 |
|
|
*/ |
|
|
BI.FloatRightLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FloatRightLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-float-right-layout clearfix", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FloatRightLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.FloatRightLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", float: "right"}); |
|
|
if (BI.isNotNull(item.left)) { |
|
|
w.element.css({left: item.left}); |
|
|
} |
|
|
if (BI.isNotNull(item.right)) { |
|
|
w.element.css({right: item.right}); |
|
|
} |
|
|
if (BI.isNotNull(item.top)) { |
|
|
w.element.css({top: item.top}); |
|
|
} |
|
|
if (BI.isNotNull(item.bottom)) { |
|
|
w.element.css({bottom: item.bottom}); |
|
|
} |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": (i === 0 ? o.hgap : 0) + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FloatRightLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.right", BI.FloatRightLayout);/** |
|
|
* 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应 |
|
|
* |
|
|
* @class BI.BorderLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.GridLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.GridLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-grid-layout", |
|
|
columns: null, |
|
|
rows: null, |
|
|
items: [] |
|
|
/* [ |
|
|
{ |
|
|
column: 0, |
|
|
row: 0, |
|
|
el: {type: 'bi.button', text: 'button1'} |
|
|
}, |
|
|
{ |
|
|
column: 1, |
|
|
row: 1, |
|
|
el: {type: 'bi.button', text: 'button2'} |
|
|
}, |
|
|
{ |
|
|
column: 3, |
|
|
row: 2, |
|
|
el: {type: 'bi.button', text: 'button3'} |
|
|
} |
|
|
]*/ |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.GridLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("grid布局不需要resize") |
|
|
}, |
|
|
|
|
|
addItem: function () { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var rows = o.rows || o.items.length, columns = o.columns || ((o.items[0] && o.items[0].length) | 0); |
|
|
var width = 100 / columns, height = 100 / rows; |
|
|
var els = []; |
|
|
for (var i = 0; i < rows; i++) { |
|
|
els[i] = []; |
|
|
} |
|
|
function firstElement (item, row, col) { |
|
|
if (row === 0) { |
|
|
item.addClass("first-row"); |
|
|
} |
|
|
if (col === 0) { |
|
|
item.addClass("first-col"); |
|
|
} |
|
|
item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row"); |
|
|
item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col"); |
|
|
item.addClass("center-element"); |
|
|
} |
|
|
|
|
|
function firstObject (item, row, col) { |
|
|
var cls = ""; |
|
|
if (row === 0) { |
|
|
cls += " first-row"; |
|
|
} |
|
|
if (col === 0) { |
|
|
cls += " first-col"; |
|
|
} |
|
|
BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row"); |
|
|
BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col"); |
|
|
item.cls = (item.cls || "") + cls + " center-element"; |
|
|
} |
|
|
|
|
|
function first (item, row, col) { |
|
|
if (item instanceof BI.Widget) { |
|
|
firstElement(item.element, row, col); |
|
|
} else if (item.el instanceof BI.Widget) { |
|
|
firstElement(item.el.element, row, col); |
|
|
} else if (item.el) { |
|
|
firstObject(item.el, row, col); |
|
|
} else { |
|
|
firstObject(item, row, col); |
|
|
} |
|
|
} |
|
|
|
|
|
BI.each(items, function (i, item) { |
|
|
if (BI.isArray(item)) { |
|
|
BI.each(item, function (j, el) { |
|
|
els[i][j] = BI.createWidget(el); |
|
|
}); |
|
|
return; |
|
|
} |
|
|
els[item.row][item.column] = BI.createWidget(item); |
|
|
}); |
|
|
for (var i = 0; i < rows; i++) { |
|
|
for (var j = 0; j < columns; j++) { |
|
|
if (!els[i][j]) { |
|
|
els[i][j] = BI.createWidget({ |
|
|
type: "bi.layout" |
|
|
}); |
|
|
} |
|
|
first(els[i][j], i, j); |
|
|
els[i][j].element.css({ |
|
|
position: "absolute", |
|
|
top: height * i + "%", |
|
|
left: width * j + "%", |
|
|
right: (100 - (width * (j + 1))) + "%", |
|
|
bottom: (100 - (height * (i + 1))) + "%" |
|
|
}); |
|
|
this.addWidget(els[i][j]); |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.GridLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.grid", BI.GridLayout);/** |
|
|
* 水平布局 |
|
|
* @class BI.HorizontalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HorizontalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HorizontalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-horizontal-layout", |
|
|
verticalAlign: BI.VerticalAlign.Top, |
|
|
columnSize: [], |
|
|
scrollx: true, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.HorizontalLayout.superclass.render.apply(this, arguments); |
|
|
this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({ |
|
|
position: "relative", |
|
|
"white-space": "nowrap", |
|
|
"border-spacing": "0px", |
|
|
border: "none", |
|
|
"border-collapse": "separate" |
|
|
}); |
|
|
this.$tr = $("<tr>"); |
|
|
this.$tr.appendTo(this.$table); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var td; |
|
|
var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i]; |
|
|
if (!this.hasWidget(this._getChildName(i))) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({position: "relative", margin: "0px auto"}); |
|
|
td = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
tagName: "td", |
|
|
attributes: { |
|
|
width: width |
|
|
}, |
|
|
items: [w] |
|
|
}); |
|
|
this.addWidget(this._getChildName(i), td); |
|
|
} else { |
|
|
td = this.getWidgetByName(this._getChildName(i)); |
|
|
td.element.attr("width", width); |
|
|
} |
|
|
|
|
|
if (i === 0) { |
|
|
td.element.addClass("first-element"); |
|
|
} |
|
|
td.element.css({ |
|
|
position: "relative", |
|
|
"vertical-align": o.verticalAlign, |
|
|
margin: "0", |
|
|
padding: "0", |
|
|
border: "none" |
|
|
}); |
|
|
|
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return td; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$tr.append(frag); |
|
|
this.element.append(this.$table); |
|
|
} |
|
|
}, |
|
|
|
|
|
|
|
|
resize: function () { |
|
|
// console.log("horizontal layout do not need to resize"); |
|
|
}, |
|
|
|
|
|
_getWrapper: function () { |
|
|
return this.$tr; |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal", BI.HorizontalLayout); |
|
|
|
|
|
/** |
|
|
* 水平布局 |
|
|
* @class BI.HorizontalCellLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HorizontalCellLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HorizontalCellLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-horizontal-cell-layout", |
|
|
scrollable: true, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.HorizontalCellLayout.superclass.render.apply(this, arguments); |
|
|
this.element.css({display: "table", "vertical-align": "top"}); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.HorizontalCellLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({position: "relative", display: "table-cell", "vertical-align": "middle"}); |
|
|
if (o.hgap + o.lgap > 0) { |
|
|
w.element.css({ |
|
|
"margin-left": o.hgap + o.lgap + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap > 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.tgap > 0) { |
|
|
w.element.css({ |
|
|
"margin-top": o.vgap + o.tgap + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap > 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("horizontal do not need to resize"); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalCellLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal_cell", BI.HorizontalCellLayout);/** |
|
|
* 靠左对齐的自由浮动布局 |
|
|
* @class BI.LatticeLayout |
|
|
* @extends BI.Layout |
|
|
* |
|
|
* @cfg {JSON} options 配置属性 |
|
|
* @cfg {Number} [hgap=0] 水平间隙 |
|
|
* @cfg {Number} [vgap=0] 垂直间隙 |
|
|
*/ |
|
|
BI.LatticeLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.LatticeLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-lattice-layout clearfix" |
|
|
// columnSize: [0.2, 0.2, 0.6], |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.LatticeLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.LatticeLayout.superclass._addElement.apply(this, arguments); |
|
|
if (o.columnSize && o.columnSize[i]) { |
|
|
var width = o.columnSize[i] / BI.sum(o.columnSize) * 100 + "%"; |
|
|
} else { |
|
|
var width = 1 / this.options.items.length * 100 + "%"; |
|
|
} |
|
|
w.element.css({position: "relative", float: "left", width: width}); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
var w = BI.LatticeLayout.superclass.addItem.apply(this, arguments); |
|
|
this.resize(); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
addItemAt: function (item) { |
|
|
var w = BI.LatticeLayout.superclass.addItemAt.apply(this, arguments); |
|
|
this.resize(); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.LatticeLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.lattice", BI.LatticeLayout);/** |
|
|
* 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应 |
|
|
* |
|
|
* @class BI.TableLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.TableLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.TableLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-table-layout", |
|
|
scrolly: true, |
|
|
columnSize: [200, 200, "fill"], |
|
|
rowSize: 30, // or [30,30,30] |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
items: [[ |
|
|
{ |
|
|
el: {text: "label1"} |
|
|
}, |
|
|
{ |
|
|
el: {text: "label2"} |
|
|
}, |
|
|
{ |
|
|
el: {text: "label3"} |
|
|
} |
|
|
]] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.TableLayout.superclass.render.apply(this, arguments); |
|
|
this.rows = 0; |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (idx, arr) { |
|
|
var o = this.options; |
|
|
var abs = [], left = 0, right = 0, i, j; |
|
|
|
|
|
function firstElement (item, row, col) { |
|
|
if (row === 0) { |
|
|
item.addClass("first-row"); |
|
|
} |
|
|
if (col === 0) { |
|
|
item.addClass("first-col"); |
|
|
} |
|
|
item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row"); |
|
|
item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col"); |
|
|
item.addClass("center-element"); |
|
|
} |
|
|
|
|
|
function firstObject (item, row, col) { |
|
|
var cls = ""; |
|
|
if (row === 0) { |
|
|
cls += " first-row"; |
|
|
} |
|
|
if (col === 0) { |
|
|
cls += " first-col"; |
|
|
} |
|
|
BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row"); |
|
|
BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col"); |
|
|
item.cls = (item.cls || "") + cls + " center-element"; |
|
|
} |
|
|
|
|
|
function first (item, row, col) { |
|
|
if (item instanceof BI.Widget) { |
|
|
firstElement(item.element, row, col); |
|
|
} else if (item.el instanceof BI.Widget) { |
|
|
firstElement(item.el.element, row, col); |
|
|
} else if (item.el) { |
|
|
firstObject(item.el, row, col); |
|
|
} else { |
|
|
firstObject(item, row, col); |
|
|
} |
|
|
} |
|
|
|
|
|
for (i = 0; i < arr.length; i++) { |
|
|
if (BI.isNumber(o.columnSize[i])) { |
|
|
first(arr[i], this.rows, i); |
|
|
abs.push(BI.extend({ |
|
|
top: 0, |
|
|
bottom: 0, |
|
|
left: o.columnSize[i] <= 1 ? left * 100 + "%" : left, |
|
|
width: o.columnSize[i] <= 1 ? o.columnSize[i] * 100 + "%" : o.columnSize[i] |
|
|
}, arr[i])); |
|
|
left += o.columnSize[i] + (o.columnSize[i] < 1 ? 0 : o.hgap); |
|
|
} else { |
|
|
break; |
|
|
} |
|
|
} |
|
|
for (j = arr.length - 1; j > i; j--) { |
|
|
if (BI.isNumber(o.columnSize[j])) { |
|
|
first(arr[j], this.rows, j); |
|
|
abs.push(BI.extend({ |
|
|
top: 0, |
|
|
bottom: 0, |
|
|
right: o.columnSize[j] <= 1 ? right * 100 + "%" : right, |
|
|
width: o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j] |
|
|
}, arr[j])); |
|
|
right += o.columnSize[j] + (o.columnSize[j] < 1 ? 0 : o.hgap); |
|
|
} else { |
|
|
throw new Error("item with fill can only be one"); |
|
|
} |
|
|
} |
|
|
if (i >= 0 && i < arr.length) { |
|
|
first(arr[i], this.rows, i); |
|
|
abs.push(BI.extend({ |
|
|
top: 0, |
|
|
bottom: 0, |
|
|
left: left <= 1 ? left * 100 + "%" : left, |
|
|
right: right <= 1 ? right * 100 + "%" : right |
|
|
}, arr[i])); |
|
|
} |
|
|
var w = BI.createWidget({ |
|
|
type: "bi.absolute", |
|
|
height: BI.isArray(o.rowSize) ? o.rowSize[this.rows] : o.rowSize, |
|
|
items: abs |
|
|
}); |
|
|
if (this.rows > 0) { |
|
|
this.getWidgetByName(this.getName() + (this.rows - 1)).element.css({ |
|
|
"margin-bottom": o.vgap |
|
|
}); |
|
|
} |
|
|
w.element.css({ |
|
|
position: "relative" |
|
|
}); |
|
|
this.addWidget(this.getName() + (this.rows++), w); |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("table布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (arr) { |
|
|
if (!BI.isArray(arr)) { |
|
|
throw new Error("item must be array"); |
|
|
} |
|
|
return BI.TableLayout.superclass.addItem.apply(this, arguments); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.TableLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.table", BI.TableLayout);/** |
|
|
* 水平tape布局 |
|
|
* @class BI.HTapeLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HTapeLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HTapeLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-h-tape-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
items: [ |
|
|
{ |
|
|
width: 100, |
|
|
el: {type: "bi.button", text: "button1"} |
|
|
}, |
|
|
{ |
|
|
width: "fill", |
|
|
el: {type: "bi.button", text: "button2"} |
|
|
}, |
|
|
{ |
|
|
width: 200, |
|
|
el: {type: "bi.button", text: "button3"} |
|
|
} |
|
|
] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.HTapeLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
items = BI.compact(items); |
|
|
BI.each(items, function (i, item) { |
|
|
if (!self.hasWidget(self.getName() + i + "")) { |
|
|
var w = BI.createWidget(item); |
|
|
self.addWidget(self.getName() + i + "", w); |
|
|
} else { |
|
|
w = self.getWidgetByName(self.getName() + i + ""); |
|
|
} |
|
|
w.element.css({position: "absolute", top: (item.vgap || 0) + (item.tgap || 0) + o.vgap + o.tgap + "px", bottom: (item.bgap || 0) + (item.vgap || 0) + o.vgap + o.bgap + "px"}); |
|
|
}); |
|
|
|
|
|
var left = {}, right = {}; |
|
|
left[0] = 0; |
|
|
right[items.length - 1] = 0; |
|
|
|
|
|
BI.any(items, function (i, item) { |
|
|
var w = self.getWidgetByName(self.getName() + i + ""); |
|
|
if (BI.isNull(left[i])) { |
|
|
left[i] = left[i - 1] + items[i - 1].width + (items[i - 1].lgap || 0) + 2 * (items[i - 1].hgap || 0) + o.hgap + o.lgap + o.rgap; |
|
|
} |
|
|
if (item.width < 1 && item.width >= 0) { |
|
|
w.element.css({left: left[i] * 100 + "%", width: item.width * 100 + "%"}); |
|
|
} else { |
|
|
w.element.css({ |
|
|
left: left[i] + (item.lgap || 0) + (item.hgap || 0) + o.hgap + o.lgap + "px", |
|
|
width: BI.isNumber(item.width) ? item.width : "" |
|
|
}); |
|
|
} |
|
|
if (!BI.isNumber(item.width)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
BI.backAny(items, function (i, item) { |
|
|
var w = self.getWidgetByName(self.getName() + i + ""); |
|
|
if (BI.isNull(right[i])) { |
|
|
right[i] = right[i + 1] + items[i + 1].width + (items[i + 1].rgap || 0) + 2 * (items[i + 1].hgap || 0) + o.hgap + o.lgap + o.rgap; |
|
|
} |
|
|
if (item.width < 1 && item.width >= 0) { |
|
|
w.element.css({right: right[i] * 100 + "%", width: item.width * 100 + "%"}); |
|
|
} else { |
|
|
w.element.css({ |
|
|
right: right[i] + (item.rgap || 0) + (item.hgap || 0) + o.hgap + o.rgap + "px", |
|
|
width: BI.isNumber(item.width) ? item.width : "" |
|
|
}); |
|
|
} |
|
|
if (!BI.isNumber(item.width)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HTapeLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.htape", BI.HTapeLayout); |
|
|
|
|
|
/** |
|
|
* 垂直tape布局 |
|
|
* @class BI.VTapeLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.VTapeLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.VTapeLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-v-tape-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
items: [ |
|
|
{ |
|
|
height: 100, |
|
|
el: {type: "bi.button", text: "button1"} |
|
|
}, |
|
|
{ |
|
|
height: "fill", |
|
|
el: {type: "bi.button", text: "button2"} |
|
|
}, |
|
|
{ |
|
|
height: 200, |
|
|
el: {type: "bi.button", text: "button3"} |
|
|
} |
|
|
] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.VTapeLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
items = BI.compact(items); |
|
|
BI.each(items, function (i, item) { |
|
|
if (!self.hasWidget(self.getName() + i + "")) { |
|
|
var w = BI.createWidget(item); |
|
|
self.addWidget(self.getName() + i + "", w); |
|
|
} else { |
|
|
w = self.getWidgetByName(self.getName() + i + ""); |
|
|
} |
|
|
w.element.css({position: "absolute", left: (item.lgap || 0) + (item.hgap || 0) + o.hgap + o.lgap + "px", right: + (item.hgap || 0) + (item.rgap || 0) + o.hgap + o.rgap + "px"}); |
|
|
}); |
|
|
|
|
|
var top = {}, bottom = {}; |
|
|
top[0] = 0; |
|
|
bottom[items.length - 1] = 0; |
|
|
|
|
|
BI.any(items, function (i, item) { |
|
|
var w = self.getWidgetByName(self.getName() + i + ""); |
|
|
if (BI.isNull(top[i])) { |
|
|
top[i] = top[i - 1] + items[i - 1].height + (items[i - 1].tgap || 0) + 2 * (items[i - 1].vgap || 0) + o.vgap + o.tgap + o.bgap; |
|
|
} |
|
|
if (item.height < 1 && item.height >= 0) { |
|
|
w.element.css({top: top[i] * 100 + "%", height: item.height * 100 + "%"}); |
|
|
} else { |
|
|
w.element.css({ |
|
|
top: top[i] + (item.vgap || 0) + (item.tgap || 0) + o.vgap + o.tgap + "px", |
|
|
height: BI.isNumber(item.height) ? item.height : "" |
|
|
}); |
|
|
} |
|
|
if (!BI.isNumber(item.height)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
BI.backAny(items, function (i, item) { |
|
|
var w = self.getWidgetByName(self.getName() + i + ""); |
|
|
if (BI.isNull(bottom[i])) { |
|
|
bottom[i] = bottom[i + 1] + items[i + 1].height + (items[i + 1].bgap || 0) + 2 * (items[i + 1].vgap || 0) + o.vgap + o.tgap + o.bgap; |
|
|
} |
|
|
if (item.height < 1 && item.height >= 0) { |
|
|
w.element.css({bottom: bottom[i] * 100 + "%", height: item.height * 100 + "%"}); |
|
|
} else { |
|
|
w.element.css({ |
|
|
bottom: bottom[i] + (item.vgap || 0) + (item.bgap || 0) + o.vgap + o.bgap + "px", |
|
|
height: BI.isNumber(item.height) ? item.height : "" |
|
|
}); |
|
|
} |
|
|
if (!BI.isNumber(item.height)) { |
|
|
return true; |
|
|
} |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.VTapeLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.vtape", BI.VTapeLayout);/** |
|
|
* td布局 |
|
|
* @class BI.TdLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.TdLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.TdLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-td-layout", |
|
|
columnSize: [200, 200, 200], |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
items: [[ |
|
|
{ |
|
|
el: {text: "label1"} |
|
|
}, |
|
|
{ |
|
|
el: {text: "label2"} |
|
|
}, |
|
|
{ |
|
|
el: {text: "label3"} |
|
|
} |
|
|
]] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.TdLayout.superclass.render.apply(this, arguments); |
|
|
this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({ |
|
|
position: "relative", |
|
|
width: "100%", |
|
|
height: "100%", |
|
|
"border-spacing": "0px", |
|
|
border: "none", |
|
|
"border-collapse": "separate" |
|
|
}); |
|
|
this.rows = 0; |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (idx, arr) { |
|
|
var o = this.options; |
|
|
|
|
|
function firstElement (item, row, col) { |
|
|
if (row === 0) { |
|
|
item.addClass("first-row"); |
|
|
} |
|
|
if (col === 0) { |
|
|
item.addClass("first-col"); |
|
|
} |
|
|
item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row"); |
|
|
item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col"); |
|
|
item.addClass("center-element"); |
|
|
} |
|
|
|
|
|
function firstObject (item, row, col) { |
|
|
var cls = ""; |
|
|
if (row === 0) { |
|
|
cls += " first-row"; |
|
|
} |
|
|
if (col === 0) { |
|
|
cls += " first-col"; |
|
|
} |
|
|
BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row"); |
|
|
BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col"); |
|
|
item.cls = (item.cls || "") + cls + " center-element"; |
|
|
} |
|
|
|
|
|
function first (item, row, col) { |
|
|
if (item instanceof BI.Widget) { |
|
|
firstElement(item.element, row, col); |
|
|
} else if (item.el instanceof BI.Widget) { |
|
|
firstElement(item.el.element, row, col); |
|
|
} else if (item.el) { |
|
|
firstObject(item.el, row, col); |
|
|
} else { |
|
|
firstObject(item, row, col); |
|
|
} |
|
|
} |
|
|
|
|
|
var tr = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
tagName: "tr" |
|
|
}); |
|
|
|
|
|
for (var i = 0; i < arr.length; i++) { |
|
|
var w = BI.createWidget(arr[i]); |
|
|
w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"}); |
|
|
if (arr[i].lgap) { |
|
|
w.element.css({"margin-left": arr[i].lgap + "px"}); |
|
|
} |
|
|
if (arr[i].rgap) { |
|
|
w.element.css({"margin-right": arr[i].rgap + "px"}); |
|
|
} |
|
|
if (arr[i].tgap) { |
|
|
w.element.css({"margin-top": arr[i].tgap + "px"}); |
|
|
} |
|
|
if (arr[i].bgap) { |
|
|
w.element.css({"margin-bottom": arr[i].bgap + "px"}); |
|
|
} |
|
|
first(w, this.rows++, i); |
|
|
var td = BI.createWidget({ |
|
|
type: "bi.default", |
|
|
attributes: { |
|
|
width: o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i] |
|
|
}, |
|
|
tagName: "td", |
|
|
items: [w] |
|
|
}); |
|
|
td.element.css({ |
|
|
position: "relative", |
|
|
"vertical-align": "middle", |
|
|
margin: "0", |
|
|
padding: "0", |
|
|
border: "none" |
|
|
}); |
|
|
tr.addItem(td); |
|
|
} |
|
|
this.addWidget(this.getName() + idx, tr); |
|
|
return tr; |
|
|
}, |
|
|
|
|
|
_mountChildren: function () { |
|
|
var self = this; |
|
|
var frag = document.createDocumentFragment(); |
|
|
var hasChild = false; |
|
|
BI.each(this._children, function (i, widget) { |
|
|
if (widget.element !== self.element) { |
|
|
frag.appendChild(widget.element[0]); |
|
|
hasChild = true; |
|
|
} |
|
|
}); |
|
|
if (hasChild === true) { |
|
|
this.$table.append(frag); |
|
|
this.element.append(this.$table); |
|
|
} |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("td布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (arr) { |
|
|
if (!BI.isArray(arr)) { |
|
|
throw new Error("item must be array"); |
|
|
} |
|
|
return BI.TdLayout.superclass.addItem.apply(this, arguments); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.TdLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.td", BI.TdLayout);/** |
|
|
* 垂直布局 |
|
|
* @class BI.VerticalLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.VerticalLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.VerticalLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-vertical-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
scrolly: true |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.VerticalLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
_addElement: function (i, item) { |
|
|
var o = this.options; |
|
|
var w = BI.VerticalLayout.superclass._addElement.apply(this, arguments); |
|
|
w.element.css({ |
|
|
position: "relative" |
|
|
}); |
|
|
if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-top": (i === 0 ? o.vgap : 0) + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px" |
|
|
}); |
|
|
} |
|
|
if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) { |
|
|
w.element.css({ |
|
|
"margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px" |
|
|
}); |
|
|
} |
|
|
return w; |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.VerticalLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.vertical", BI.VerticalLayout);/** |
|
|
* |
|
|
* @class BI.WindowLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.WindowLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.WindowLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-window-layout", |
|
|
columns: 3, |
|
|
rows: 2, |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0, |
|
|
columnSize: [100, "fill", 200], |
|
|
rowSize: [100, "fill"], |
|
|
items: [[ |
|
|
{ |
|
|
el: {type: "bi.button", text: "button1"} |
|
|
}, |
|
|
{ |
|
|
el: {type: "bi.button", text: "button2"} |
|
|
}, |
|
|
{ |
|
|
el: {type: "bi.button", text: "button3"} |
|
|
} |
|
|
]] |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.WindowLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
this.stroke(this.options.items); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var o = this.options; |
|
|
if (BI.isNumber(o.rowSize)) { |
|
|
o.rowSize = BI.makeArray(o.items.length, 1 / o.items.length); |
|
|
} |
|
|
if (BI.isNumber(o.columnSize)) { |
|
|
o.columnSize = BI.makeArray(o.items[0].length, 1 / o.items[0].length); |
|
|
} |
|
|
function firstElement (item, row, col) { |
|
|
if (row === 0) { |
|
|
item.addClass("first-row"); |
|
|
} |
|
|
if (col === 0) { |
|
|
item.addClass("first-col"); |
|
|
} |
|
|
item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row"); |
|
|
item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col"); |
|
|
item.addClass("center-element"); |
|
|
} |
|
|
|
|
|
function firstObject (item, row, col) { |
|
|
var cls = ""; |
|
|
if (row === 0) { |
|
|
cls += " first-row"; |
|
|
} |
|
|
if (col === 0) { |
|
|
cls += " first-col"; |
|
|
} |
|
|
BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row"); |
|
|
BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col"); |
|
|
item.cls = (item.cls || "") + cls + " center-element"; |
|
|
} |
|
|
|
|
|
function first (item, row, col) { |
|
|
if (item instanceof BI.Widget) { |
|
|
firstElement(item.element, row, col); |
|
|
} else if (item.el instanceof BI.Widget) { |
|
|
firstElement(item.el.element, row, col); |
|
|
} else if (item.el) { |
|
|
firstObject(item.el, row, col); |
|
|
} else { |
|
|
firstObject(item, row, col); |
|
|
} |
|
|
} |
|
|
|
|
|
for (var i = 0; i < o.rows; i++) { |
|
|
for (var j = 0; j < o.columns; j++) { |
|
|
if (!o.items[i][j]) { |
|
|
throw new Error("item be required"); |
|
|
} |
|
|
if (!this.hasWidget(this.getName() + i + "_" + j)) { |
|
|
var w = BI.createWidget(o.items[i][j]); |
|
|
w.element.css({position: "absolute"}); |
|
|
this.addWidget(this.getName() + i + "_" + j, w); |
|
|
} |
|
|
} |
|
|
} |
|
|
var left = {}, right = {}, top = {}, bottom = {}; |
|
|
left[0] = 0; |
|
|
top[0] = 0; |
|
|
right[o.columns - 1] = 0; |
|
|
bottom[o.rows - 1] = 0; |
|
|
// 从上到下 |
|
|
for (var i = 0; i < o.rows; i++) { |
|
|
for (var j = 0; j < o.columns; j++) { |
|
|
var wi = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
if (BI.isNull(top[i])) { |
|
|
top[i] = top[i - 1] + (o.rowSize[i - 1] < 1 ? o.rowSize[i - 1] : o.rowSize[i - 1] + o.vgap + o.bgap); |
|
|
} |
|
|
var t = top[i] <= 1 ? top[i] * 100 + "%" : top[i] + o.vgap + o.tgap + "px", h = ""; |
|
|
if (BI.isNumber(o.rowSize[i])) { |
|
|
h = o.rowSize[i] <= 1 ? o.rowSize[i] * 100 + "%" : o.rowSize[i] + "px"; |
|
|
} |
|
|
wi.element.css({top: t, height: h}); |
|
|
first(wi, i, j); |
|
|
} |
|
|
if (!BI.isNumber(o.rowSize[i])) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
// 从下到上 |
|
|
for (var i = o.rows - 1; i >= 0; i--) { |
|
|
for (var j = 0; j < o.columns; j++) { |
|
|
var wi = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
if (BI.isNull(bottom[i])) { |
|
|
bottom[i] = bottom[i + 1] + (o.rowSize[i + 1] < 1 ? o.rowSize[i + 1] : o.rowSize[i + 1] + o.vgap + o.tgap); |
|
|
} |
|
|
var b = bottom[i] <= 1 ? bottom[i] * 100 + "%" : bottom[i] + o.vgap + o.bgap + "px", h = ""; |
|
|
if (BI.isNumber(o.rowSize[i])) { |
|
|
h = o.rowSize[i] <= 1 ? o.rowSize[i] * 100 + "%" : o.rowSize[i] + "px"; |
|
|
} |
|
|
wi.element.css({bottom: b, height: h}); |
|
|
first(wi, i, j); |
|
|
} |
|
|
if (!BI.isNumber(o.rowSize[i])) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
// 从左到右 |
|
|
for (var j = 0; j < o.columns; j++) { |
|
|
for (var i = 0; i < o.rows; i++) { |
|
|
var wi = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
if (BI.isNull(left[j])) { |
|
|
left[j] = left[j - 1] + (o.columnSize[j - 1] < 1 ? o.columnSize[j - 1] : o.columnSize[j - 1] + o.hgap + o.rgap); |
|
|
} |
|
|
var l = left[j] <= 1 ? left[j] * 100 + "%" : left[j] + o.hgap + o.lgap + "px", w = ""; |
|
|
if (BI.isNumber(o.columnSize[j])) { |
|
|
w = o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j] + "px"; |
|
|
} |
|
|
wi.element.css({left: l, width: w}); |
|
|
first(wi, i, j); |
|
|
} |
|
|
if (!BI.isNumber(o.columnSize[j])) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
// 从右到左 |
|
|
for (var j = o.columns - 1; j >= 0; j--) { |
|
|
for (var i = 0; i < o.rows; i++) { |
|
|
var wi = this.getWidgetByName(this.getName() + i + "_" + j); |
|
|
if (BI.isNull(right[j])) { |
|
|
right[j] = right[j + 1] + (o.columnSize[j + 1] < 1 ? o.columnSize[j + 1] : o.columnSize[j + 1] + o.hgap + o.lgap); |
|
|
} |
|
|
var r = right[j] <= 1 ? right[j] * 100 + "%" : right[j] + o.hgap + o.rgap + "px", w = ""; |
|
|
if (BI.isNumber(o.columnSize[j])) { |
|
|
w = o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j] + "px"; |
|
|
} |
|
|
wi.element.css({right: r, width: w}); |
|
|
first(wi, i, j); |
|
|
} |
|
|
if (!BI.isNumber(o.columnSize[j])) { |
|
|
break; |
|
|
} |
|
|
} |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.WindowLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.window", BI.WindowLayout);/** |
|
|
* 水平和垂直方向都居中容器, 非自适应,用于宽度高度固定的面板 |
|
|
* @class BI.CenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.CenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.CenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-center-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
|
|
|
render: function () { |
|
|
BI.CenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var list = []; |
|
|
BI.each(items, function (i) { |
|
|
list.push({ |
|
|
column: i, |
|
|
row: 0, |
|
|
el: BI.createWidget({ |
|
|
type: "bi.default", |
|
|
cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "") |
|
|
}) |
|
|
}); |
|
|
}); |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap, |
|
|
right: o.hgap + o.rgap, |
|
|
top: o.vgap + o.tgap, |
|
|
bottom: o.vgap + o.bgap, |
|
|
width: "auto", |
|
|
height: "auto" |
|
|
}); |
|
|
list[i].el.addItem(w); |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.grid", |
|
|
element: this, |
|
|
columns: list.length, |
|
|
rows: 1, |
|
|
items: list |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.CenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.center", BI.CenterLayout);/** |
|
|
* 浮动布局实现的居中容器 |
|
|
* @class BI.FloatCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.FloatCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.FloatCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-float-center-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.FloatCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("floatcenter布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var list = [], width = 100 / items.length; |
|
|
BI.each(items, function (i) { |
|
|
var widget = BI.createWidget({ |
|
|
type: "bi.default" |
|
|
}); |
|
|
widget.element.addClass("center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "")).css({ |
|
|
width: width + "%", |
|
|
height: "100%" |
|
|
}); |
|
|
list.push({ |
|
|
el: widget |
|
|
}); |
|
|
}); |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap, |
|
|
right: o.hgap + o.rgap, |
|
|
top: o.vgap + o.tgap, |
|
|
bottom: o.vgap + o.bgap, |
|
|
width: "auto", |
|
|
height: "auto" |
|
|
}); |
|
|
list[i].el.addItem(w); |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.left", |
|
|
element: this, |
|
|
items: list |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.FloatCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.float_center", BI.FloatCenterLayout);/** |
|
|
* 水平和垂直方向都居中容器, 非自适应,用于宽度高度固定的面板 |
|
|
* @class BI.HorizontalCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.HorizontalCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.HorizontalCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-horizontal-center-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.HorizontalCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("horizontal_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var list = []; |
|
|
BI.each(items, function (i) { |
|
|
list.push({ |
|
|
column: i, |
|
|
row: 0, |
|
|
el: BI.createWidget({ |
|
|
type: "bi.default", |
|
|
cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "") |
|
|
}) |
|
|
}); |
|
|
}); |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap, |
|
|
right: o.hgap + o.rgap, |
|
|
top: o.vgap + o.tgap, |
|
|
bottom: o.vgap + o.bgap, |
|
|
width: "auto" |
|
|
}); |
|
|
list[i].el.addItem(w); |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.grid", |
|
|
element: this, |
|
|
columns: list.length, |
|
|
rows: 1, |
|
|
items: list |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.HorizontalCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.horizontal_center", BI.HorizontalCenterLayout);/** |
|
|
* 垂直方向都居中容器, 非自适应,用于高度不固定的面板 |
|
|
* @class BI.VerticalCenterLayout |
|
|
* @extends BI.Layout |
|
|
*/ |
|
|
BI.VerticalCenterLayout = BI.inherit(BI.Layout, { |
|
|
props: function () { |
|
|
return BI.extend(BI.VerticalCenterLayout.superclass.props.apply(this, arguments), { |
|
|
baseCls: "bi-vertical-center-layout", |
|
|
hgap: 0, |
|
|
vgap: 0, |
|
|
lgap: 0, |
|
|
rgap: 0, |
|
|
tgap: 0, |
|
|
bgap: 0 |
|
|
}); |
|
|
}, |
|
|
render: function () { |
|
|
BI.VerticalCenterLayout.superclass.render.apply(this, arguments); |
|
|
this.populate(this.options.items); |
|
|
}, |
|
|
|
|
|
resize: function () { |
|
|
// console.log("vertical_center布局不需要resize"); |
|
|
}, |
|
|
|
|
|
addItem: function (item) { |
|
|
// do nothing |
|
|
throw new Error("cannot be added"); |
|
|
}, |
|
|
|
|
|
stroke: function (items) { |
|
|
var self = this, o = this.options; |
|
|
var list = []; |
|
|
BI.each(items, function (i) { |
|
|
list.push({ |
|
|
column: 0, |
|
|
row: i, |
|
|
el: BI.createWidget({ |
|
|
type: "bi.default", |
|
|
cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "") |
|
|
}) |
|
|
}); |
|
|
}); |
|
|
BI.each(items, function (i, item) { |
|
|
if (item) { |
|
|
var w = BI.createWidget(item); |
|
|
w.element.css({ |
|
|
position: "absolute", |
|
|
left: o.hgap + o.lgap, |
|
|
right: o.hgap + o.rgap, |
|
|
top: o.vgap + o.tgap, |
|
|
bottom: o.vgap + o.bgap, |
|
|
height: "auto" |
|
|
}); |
|
|
list[i].el.addItem(w); |
|
|
} |
|
|
}); |
|
|
BI.createWidget({ |
|
|
type: "bi.grid", |
|
|
element: this, |
|
|
columns: 1, |
|
|
rows: list.length, |
|
|
items: list |
|
|
}); |
|
|
}, |
|
|
|
|
|
populate: function (items) { |
|
|
BI.VerticalCenterLayout.superclass.populate.apply(this, arguments); |
|
|
this._mount(); |
|
|
} |
|
|
}); |
|
|
BI.shortcut("bi.vertical_center", BI.VerticalCenterLayout);/** |
|
|
* 缓冲池 |
|
|
* @type {{Buffer: {}}} |
|
|
*/ |
|
|
|
|
|
(function () { |
|
|
var Buffer = {}; |
|
|
var MODE = false;// 设置缓存模式为关闭 |
|
|
|
|
|
BI.BufferPool = { |
|
|
put: function (name, cache) { |
|
|
if (BI.isNotNull(Buffer[name])) { |
|
|
throw new Error("Buffer Pool has the key already!"); |
|
|
} |
|
|
Buffer[name] = cache; |
|
|
}, |
|
|
|
|
|
get: function (name) { |
|
|
return Buffer[name]; |
|
|
} |
|
|
}; |
|
|
})();/** |
|
|
* 共享池 |
|
|
* @type {{Shared: {}}} |
|
|
*/ |
|
|
|
|
|
(function () { |
|
|
var _Shared = {}; |
|
|
BI.SharingPool = { |
|
|
_Shared: _Shared, |
|
|
put: function (name, shared) { |
|
|
_Shared[name] = shared; |
|
|
}, |
|
|
|
|
|
cat: function () { |
|
|
var args = Array.prototype.slice.call(arguments, 0), |
|
|
copy = _Shared; |
|
|
for (var i = 0; i < args.length; i++) { |
|
|
copy = copy && copy[args[i]]; |
|
|
} |
|
|
return copy; |
|
|
}, |
|
|
|
|
|
get: function () { |
|
|
return BI.deepClone(this.cat.apply(this, arguments)); |
|
|
}, |
|
|
|
|
|
remove: function (key) { |
|
|
delete _Shared[key]; |
|
|
} |
|
|
}; |
|
|
})();BI.Req = { |
|
|
|
|
|
};
|