/**
 * @license
 * Lodash (Custom Build) <https://lodash.com/>
 * Build: `lodash core plus="debounce,throttle,get,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference,defaultsDeep"`
 * Copyright JS Foundation and other contributors <https://js.foundation/>
 * Released under MIT license <https://lodash.com/license>
 * Based on Underscore.js 1.8.3 <http://underscorejs.org/LICENSE>
 * Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors
 */
;(function() {

  /** Used as a safe reference for `undefined` in pre-ES5 environments. */
  var undefined;

  /** Used as the semantic version number. */
  var VERSION = '4.17.5';

  /** Used as the size to enable large array optimizations. */
  var LARGE_ARRAY_SIZE = 200;

  /** Error message constants. */
  var FUNC_ERROR_TEXT = 'Expected a function';

  /** Used to stand-in for `undefined` hash values. */
  var HASH_UNDEFINED = '__lodash_hash_undefined__';

  /** Used as the maximum memoize cache size. */
  var MAX_MEMOIZE_SIZE = 500;

  /** Used as the internal argument placeholder. */
  var PLACEHOLDER = '__lodash_placeholder__';

  /** Used to compose bitmasks for cloning. */
  var CLONE_DEEP_FLAG = 1,
      CLONE_FLAT_FLAG = 2,
      CLONE_SYMBOLS_FLAG = 4;

  /** Used to compose bitmasks for value comparisons. */
  var COMPARE_PARTIAL_FLAG = 1,
      COMPARE_UNORDERED_FLAG = 2;

  /** Used to compose bitmasks for function metadata. */
  var WRAP_BIND_FLAG = 1,
      WRAP_BIND_KEY_FLAG = 2,
      WRAP_CURRY_BOUND_FLAG = 4,
      WRAP_CURRY_FLAG = 8,
      WRAP_CURRY_RIGHT_FLAG = 16,
      WRAP_PARTIAL_FLAG = 32,
      WRAP_PARTIAL_RIGHT_FLAG = 64,
      WRAP_ARY_FLAG = 128,
      WRAP_REARG_FLAG = 256,
      WRAP_FLIP_FLAG = 512;

  /** Used to detect hot functions by number of calls within a span of milliseconds. */
  var HOT_COUNT = 800,
      HOT_SPAN = 16;

  /** Used to indicate the type of lazy iteratees. */
  var LAZY_FILTER_FLAG = 1,
      LAZY_MAP_FLAG = 2,
      LAZY_WHILE_FLAG = 3;

  /** Used as references for various `Number` constants. */
  var INFINITY = 1 / 0,
      MAX_SAFE_INTEGER = 9007199254740991,
      MAX_INTEGER = 1.7976931348623157e+308,
      NAN = 0 / 0;

  /** Used as references for the maximum length and index of an array. */
  var MAX_ARRAY_LENGTH = 4294967295;

  /** Used to associate wrap methods with their bit flags. */
  var wrapFlags = [
    ['ary', WRAP_ARY_FLAG],
    ['bind', WRAP_BIND_FLAG],
    ['bindKey', WRAP_BIND_KEY_FLAG],
    ['curry', WRAP_CURRY_FLAG],
    ['curryRight', WRAP_CURRY_RIGHT_FLAG],
    ['flip', WRAP_FLIP_FLAG],
    ['partial', WRAP_PARTIAL_FLAG],
    ['partialRight', WRAP_PARTIAL_RIGHT_FLAG],
    ['rearg', WRAP_REARG_FLAG]
  ];

  /** `Object#toString` result references. */
  var argsTag = '[object Arguments]',
      arrayTag = '[object Array]',
      asyncTag = '[object AsyncFunction]',
      boolTag = '[object Boolean]',
      dateTag = '[object Date]',
      errorTag = '[object Error]',
      funcTag = '[object Function]',
      genTag = '[object GeneratorFunction]',
      mapTag = '[object Map]',
      numberTag = '[object Number]',
      nullTag = '[object Null]',
      objectTag = '[object Object]',
      promiseTag = '[object Promise]',
      proxyTag = '[object Proxy]',
      regexpTag = '[object RegExp]',
      setTag = '[object Set]',
      stringTag = '[object String]',
      symbolTag = '[object Symbol]',
      undefinedTag = '[object Undefined]',
      weakMapTag = '[object WeakMap]';

  var arrayBufferTag = '[object ArrayBuffer]',
      dataViewTag = '[object DataView]',
      float32Tag = '[object Float32Array]',
      float64Tag = '[object Float64Array]',
      int8Tag = '[object Int8Array]',
      int16Tag = '[object Int16Array]',
      int32Tag = '[object Int32Array]',
      uint8Tag = '[object Uint8Array]',
      uint8ClampedTag = '[object Uint8ClampedArray]',
      uint16Tag = '[object Uint16Array]',
      uint32Tag = '[object Uint32Array]';

  /** Used to match HTML entities and HTML characters. */
  var reUnescapedHtml = /[&<>"']/g,
      reHasUnescapedHtml = RegExp(reUnescapedHtml.source);

  /** Used to match property names within property paths. */
  var reIsDeepProp = /\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/,
      reIsPlainProp = /^\w*$/,
      rePropName = /[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g;

  /**
   * Used to match `RegExp`
   * [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns).
   */
  var reRegExpChar = /[\\^$.*+?()[\]{}|]/g;

  /** Used to match leading and trailing whitespace. */
  var reTrim = /^\s+|\s+$/g;

  /** Used to match wrap detail comments. */
  var reWrapComment = /\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/,
      reWrapDetails = /\{\n\/\* \[wrapped with (.+)\] \*/,
      reSplitDetails = /,? & /;

  /** Used to match backslashes in property paths. */
  var reEscapeChar = /\\(\\)?/g;

  /** Used to match `RegExp` flags from their coerced string values. */
  var reFlags = /\w*$/;

  /** Used to detect bad signed hexadecimal string values. */
  var reIsBadHex = /^[-+]0x[0-9a-f]+$/i;

  /** Used to detect binary string values. */
  var reIsBinary = /^0b[01]+$/i;

  /** Used to detect host constructors (Safari). */
  var reIsHostCtor = /^\[object .+?Constructor\]$/;

  /** Used to detect octal string values. */
  var reIsOctal = /^0o[0-7]+$/i;

  /** Used to detect unsigned integer values. */
  var reIsUint = /^(?:0|[1-9]\d*)$/;

  /** Used to compose unicode character classes. */
  var rsAstralRange = '\\ud800-\\udfff',
      rsComboMarksRange = '\\u0300-\\u036f',
      reComboHalfMarksRange = '\\ufe20-\\ufe2f',
      rsComboSymbolsRange = '\\u20d0-\\u20ff',
      rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange,
      rsVarRange = '\\ufe0e\\ufe0f';

  /** Used to compose unicode capture groups. */
  var rsAstral = '[' + rsAstralRange + ']',
      rsCombo = '[' + rsComboRange + ']',
      rsFitz = '\\ud83c[\\udffb-\\udfff]',
      rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')',
      rsNonAstral = '[^' + rsAstralRange + ']',
      rsRegional = '(?:\\ud83c[\\udde6-\\uddff]){2}',
      rsSurrPair = '[\\ud800-\\udbff][\\udc00-\\udfff]',
      rsZWJ = '\\u200d';

  /** Used to compose unicode regexes. */
  var reOptMod = rsModifier + '?',
      rsOptVar = '[' + rsVarRange + ']?',
      rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*',
      rsSeq = rsOptVar + reOptMod + rsOptJoin,
      rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')';

  /** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */
  var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g');

  /** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */
  var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange  + rsComboRange + rsVarRange + ']');

  /** Used to identify `toStringTag` values of typed arrays. */
  var typedArrayTags = {};
  typedArrayTags[float32Tag] = typedArrayTags[float64Tag] =
  typedArrayTags[int8Tag] = typedArrayTags[int16Tag] =
  typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] =
  typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] =
  typedArrayTags[uint32Tag] = true;
  typedArrayTags[argsTag] = typedArrayTags[arrayTag] =
  typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] =
  typedArrayTags[dataViewTag] = typedArrayTags[dateTag] =
  typedArrayTags[errorTag] = typedArrayTags[funcTag] =
  typedArrayTags[mapTag] = typedArrayTags[numberTag] =
  typedArrayTags[objectTag] = typedArrayTags[regexpTag] =
  typedArrayTags[setTag] = typedArrayTags[stringTag] =
  typedArrayTags[weakMapTag] = false;

  /** Used to identify `toStringTag` values supported by `_.clone`. */
  var cloneableTags = {};
  cloneableTags[argsTag] = cloneableTags[arrayTag] =
  cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] =
  cloneableTags[boolTag] = cloneableTags[dateTag] =
  cloneableTags[float32Tag] = cloneableTags[float64Tag] =
  cloneableTags[int8Tag] = cloneableTags[int16Tag] =
  cloneableTags[int32Tag] = cloneableTags[mapTag] =
  cloneableTags[numberTag] = cloneableTags[objectTag] =
  cloneableTags[regexpTag] = cloneableTags[setTag] =
  cloneableTags[stringTag] = cloneableTags[symbolTag] =
  cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] =
  cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true;
  cloneableTags[errorTag] = cloneableTags[funcTag] =
  cloneableTags[weakMapTag] = false;

  /** Used to map characters to HTML entities. */
  var htmlEscapes = {
    '&': '&amp;',
    '<': '&lt;',
    '>': '&gt;',
    '"': '&quot;',
    "'": '&#39;'
  };

  /** Built-in method references without a dependency on `root`. */
  var freeParseFloat = parseFloat,
      freeParseInt = parseInt;

  /** Detect free variable `global` from Node.js. */
  var freeGlobal = typeof global == 'object' && global && global.Object === Object && global;

  /** Detect free variable `self`. */
  var freeSelf = typeof self == 'object' && self && self.Object === Object && self;

  /** Used as a reference to the global object. */
  var root = freeGlobal || freeSelf || Function('return this')();

  /** Detect free variable `exports`. */
  var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports;

  /** Detect free variable `module`. */
  var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module;

  /** Detect the popular CommonJS extension `module.exports`. */
  var moduleExports = freeModule && freeModule.exports === freeExports;

  /** Detect free variable `process` from Node.js. */
  var freeProcess = moduleExports && freeGlobal.process;

  /** Used to access faster Node.js helpers. */
  var nodeUtil = (function() {
    try {
      return freeProcess && freeProcess.binding && freeProcess.binding('util');
    } catch (e) {}
  }());

  /* Node.js helper references. */
  var nodeIsDate = nodeUtil && nodeUtil.isDate,
      nodeIsMap = nodeUtil && nodeUtil.isMap,
      nodeIsRegExp = nodeUtil && nodeUtil.isRegExp,
      nodeIsSet = nodeUtil && nodeUtil.isSet,
      nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray;

  /*--------------------------------------------------------------------------*/

  /**
   * A faster alternative to `Function#apply`, this function invokes `func`
   * with the `this` binding of `thisArg` and the arguments of `args`.
   *
   * @private
   * @param {Function} func The function to invoke.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {Array} args The arguments to invoke `func` with.
   * @returns {*} Returns the result of `func`.
   */
  function apply(func, thisArg, args) {
    switch (args.length) {
      case 0: return func.call(thisArg);
      case 1: return func.call(thisArg, args[0]);
      case 2: return func.call(thisArg, args[0], args[1]);
      case 3: return func.call(thisArg, args[0], args[1], args[2]);
    }
    return func.apply(thisArg, args);
  }

  /**
   * A specialized version of `baseAggregator` for arrays.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform keys.
   * @param {Object} accumulator The initial aggregated object.
   * @returns {Function} Returns `accumulator`.
   */
  function arrayAggregator(array, setter, iteratee, accumulator) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      var value = array[index];
      setter(accumulator, value, iteratee(value), array);
    }
    return accumulator;
  }

  /**
   * A specialized version of `_.forEach` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns `array`.
   */
  function arrayEach(array, iteratee) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (iteratee(array[index], index, array) === false) {
        break;
      }
    }
    return array;
  }

  /**
   * A specialized version of `_.every` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`.
   */
  function arrayEvery(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (!predicate(array[index], index, array)) {
        return false;
      }
    }
    return true;
  }

  /**
   * A specialized version of `_.filter` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   */
  function arrayFilter(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (predicate(value, index, array)) {
        result[resIndex++] = value;
      }
    }
    return result;
  }

  /**
   * A specialized version of `_.includes` for arrays without support for
   * specifying an index to search from.
   *
   * @private
   * @param {Array} [array] The array to inspect.
   * @param {*} target The value to search for.
   * @returns {boolean} Returns `true` if `target` is found, else `false`.
   */
  function arrayIncludes(array, value) {
    var length = array == null ? 0 : array.length;
    return !!length && baseIndexOf(array, value, 0) > -1;
  }

  /**
   * This function is like `arrayIncludes` except that it accepts a comparator.
   *
   * @private
   * @param {Array} [array] The array to inspect.
   * @param {*} target The value to search for.
   * @param {Function} comparator The comparator invoked per element.
   * @returns {boolean} Returns `true` if `target` is found, else `false`.
   */
  function arrayIncludesWith(array, value, comparator) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (comparator(value, array[index])) {
        return true;
      }
    }
    return false;
  }

  /**
   * A specialized version of `_.map` for arrays without support for iteratee
   * shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   */
  function arrayMap(array, iteratee) {
    var index = -1,
        length = array == null ? 0 : array.length,
        result = Array(length);

    while (++index < length) {
      result[index] = iteratee(array[index], index, array);
    }
    return result;
  }

  /**
   * Appends the elements of `values` to `array`.
   *
   * @private
   * @param {Array} array The array to modify.
   * @param {Array} values The values to append.
   * @returns {Array} Returns `array`.
   */
  function arrayPush(array, values) {
    var index = -1,
        length = values.length,
        offset = array.length;

    while (++index < length) {
      array[offset + index] = values[index];
    }
    return array;
  }

  /**
   * A specialized version of `_.reduce` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {*} [accumulator] The initial value.
   * @param {boolean} [initAccum] Specify using the first element of `array` as
   *  the initial value.
   * @returns {*} Returns the accumulated value.
   */
  function arrayReduce(array, iteratee, accumulator, initAccum) {
    var index = -1,
        length = array == null ? 0 : array.length;

    if (initAccum && length) {
      accumulator = array[++index];
    }
    while (++index < length) {
      accumulator = iteratee(accumulator, array[index], index, array);
    }
    return accumulator;
  }

  /**
   * A specialized version of `_.some` for arrays without support for iteratee
   * shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   */
  function arraySome(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (predicate(array[index], index, array)) {
        return true;
      }
    }
    return false;
  }

  /**
   * Gets the size of an ASCII `string`.
   *
   * @private
   * @param {string} string The string inspect.
   * @returns {number} Returns the string size.
   */
  var asciiSize = baseProperty('length');

  /**
   * Converts an ASCII `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function asciiToArray(string) {
    return string.split('');
  }

  /**
   * The base implementation of methods like `_.findKey` and `_.findLastKey`,
   * without support for iteratee shorthands, which iterates over `collection`
   * using `eachFunc`.
   *
   * @private
   * @param {Array|Object} collection The collection to inspect.
   * @param {Function} predicate The function invoked per iteration.
   * @param {Function} eachFunc The function to iterate over `collection`.
   * @returns {*} Returns the found element or its key, else `undefined`.
   */
  function baseFindKey(collection, predicate, eachFunc) {
    var result;
    eachFunc(collection, function(value, key, collection) {
      if (predicate(value, key, collection)) {
        result = key;
        return false;
      }
    });
    return result;
  }

  /**
   * The base implementation of `_.findIndex` and `_.findLastIndex` without
   * support for iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Function} predicate The function invoked per iteration.
   * @param {number} fromIndex The index to search from.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function baseFindIndex(array, predicate, fromIndex, fromRight) {
    var length = array.length,
        index = fromIndex + (fromRight ? 1 : -1);

    while ((fromRight ? index-- : ++index < length)) {
      if (predicate(array[index], index, array)) {
        return index;
      }
    }
    return -1;
  }

  /**
   * The base implementation of `_.indexOf` without `fromIndex` bounds checks.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} fromIndex The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function baseIndexOf(array, value, fromIndex) {
    return value === value
      ? strictIndexOf(array, value, fromIndex)
      : baseFindIndex(array, baseIsNaN, fromIndex);
  }

  /**
   * The base implementation of `_.isNaN` without support for number objects.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.
   */
  function baseIsNaN(value) {
    return value !== value;
  }

  /**
   * The base implementation of `_.property` without support for deep paths.
   *
   * @private
   * @param {string} key The key of the property to get.
   * @returns {Function} Returns the new accessor function.
   */
  function baseProperty(key) {
    return function(object) {
      return object == null ? undefined : object[key];
    };
  }

  /**
   * The base implementation of `_.propertyOf` without support for deep paths.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Function} Returns the new accessor function.
   */
  function basePropertyOf(object) {
    return function(key) {
      return object == null ? undefined : object[key];
    };
  }

  /**
   * The base implementation of `_.reduce` and `_.reduceRight`, without support
   * for iteratee shorthands, which iterates over `collection` using `eachFunc`.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {*} accumulator The initial value.
   * @param {boolean} initAccum Specify using the first or last element of
   *  `collection` as the initial value.
   * @param {Function} eachFunc The function to iterate over `collection`.
   * @returns {*} Returns the accumulated value.
   */
  function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) {
    eachFunc(collection, function(value, index, collection) {
      accumulator = initAccum
        ? (initAccum = false, value)
        : iteratee(accumulator, value, index, collection);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.sortBy` which uses `comparer` to define the
   * sort order of `array` and replaces criteria objects with their corresponding
   * values.
   *
   * @private
   * @param {Array} array The array to sort.
   * @param {Function} comparer The function to define sort order.
   * @returns {Array} Returns `array`.
   */
  function baseSortBy(array, comparer) {
    var length = array.length;

    array.sort(comparer);
    while (length--) {
      array[length] = array[length].value;
    }
    return array;
  }

  /**
   * The base implementation of `_.times` without support for iteratee shorthands
   * or max array length checks.
   *
   * @private
   * @param {number} n The number of times to invoke `iteratee`.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the array of results.
   */
  function baseTimes(n, iteratee) {
    var index = -1,
        result = Array(n);

    while (++index < n) {
      result[index] = iteratee(index);
    }
    return result;
  }

  /**
   * The base implementation of `_.unary` without support for storing metadata.
   *
   * @private
   * @param {Function} func The function to cap arguments for.
   * @returns {Function} Returns the new capped function.
   */
  function baseUnary(func) {
    return function(value) {
      return func(value);
    };
  }

  /**
   * The base implementation of `_.values` and `_.valuesIn` which creates an
   * array of `object` property values corresponding to the property names
   * of `props`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array} props The property names to get values for.
   * @returns {Object} Returns the array of property values.
   */
  function baseValues(object, props) {
    return arrayMap(props, function(key) {
      return object[key];
    });
  }

  /**
   * Checks if a `cache` value for `key` exists.
   *
   * @private
   * @param {Object} cache The cache to query.
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function cacheHas(cache, key) {
    return cache.has(key);
  }

  /**
   * Gets the number of `placeholder` occurrences in `array`.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} placeholder The placeholder to search for.
   * @returns {number} Returns the placeholder count.
   */
  function countHolders(array, placeholder) {
    var length = array.length,
        result = 0;

    while (length--) {
      if (array[length] === placeholder) {
        ++result;
      }
    }
    return result;
  }

  /**
   * Used by `_.escape` to convert characters to HTML entities.
   *
   * @private
   * @param {string} chr The matched character to escape.
   * @returns {string} Returns the escaped character.
   */
  var escapeHtmlChar = basePropertyOf(htmlEscapes);

  /**
   * Gets the value at `key` of `object`.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {string} key The key of the property to get.
   * @returns {*} Returns the property value.
   */
  function getValue(object, key) {
    return object == null ? undefined : object[key];
  }

  /**
   * Checks if `string` contains Unicode symbols.
   *
   * @private
   * @param {string} string The string to inspect.
   * @returns {boolean} Returns `true` if a symbol is found, else `false`.
   */
  function hasUnicode(string) {
    return reHasUnicode.test(string);
  }

  /**
   * Converts `iterator` to an array.
   *
   * @private
   * @param {Object} iterator The iterator to convert.
   * @returns {Array} Returns the converted array.
   */
  function iteratorToArray(iterator) {
    var data,
        result = [];

    while (!(data = iterator.next()).done) {
      result.push(data.value);
    }
    return result;
  }

  /**
   * Converts `map` to its key-value pairs.
   *
   * @private
   * @param {Object} map The map to convert.
   * @returns {Array} Returns the key-value pairs.
   */
  function mapToArray(map) {
    var index = -1,
        result = Array(map.size);

    map.forEach(function(value, key) {
      result[++index] = [key, value];
    });
    return result;
  }

  /**
   * Creates a unary function that invokes `func` with its argument transformed.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {Function} transform The argument transform.
   * @returns {Function} Returns the new function.
   */
  function overArg(func, transform) {
    return function(arg) {
      return func(transform(arg));
    };
  }

  /**
   * Replaces all `placeholder` elements in `array` with an internal placeholder
   * and returns an array of their indexes.
   *
   * @private
   * @param {Array} array The array to modify.
   * @param {*} placeholder The placeholder to replace.
   * @returns {Array} Returns the new array of placeholder indexes.
   */
  function replaceHolders(array, placeholder) {
    var index = -1,
        length = array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (value === placeholder || value === PLACEHOLDER) {
        array[index] = PLACEHOLDER;
        result[resIndex++] = index;
      }
    }
    return result;
  }

  /**
   * Gets the value at `key`, unless `key` is "__proto__".
   *
   * @private
   * @param {Object} object The object to query.
   * @param {string} key The key of the property to get.
   * @returns {*} Returns the property value.
   */
  function safeGet(object, key) {
    return key == '__proto__'
      ? undefined
      : object[key];
  }

  /**
   * Converts `set` to an array of its values.
   *
   * @private
   * @param {Object} set The set to convert.
   * @returns {Array} Returns the values.
   */
  function setToArray(set) {
    var index = -1,
        result = Array(set.size);

    set.forEach(function(value) {
      result[++index] = value;
    });
    return result;
  }

  /**
   * A specialized version of `_.indexOf` which performs strict equality
   * comparisons of values, i.e. `===`.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} fromIndex The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function strictIndexOf(array, value, fromIndex) {
    var index = fromIndex - 1,
        length = array.length;

    while (++index < length) {
      if (array[index] === value) {
        return index;
      }
    }
    return -1;
  }

  /**
   * Gets the number of symbols in `string`.
   *
   * @private
   * @param {string} string The string to inspect.
   * @returns {number} Returns the string size.
   */
  function stringSize(string) {
    return hasUnicode(string)
      ? unicodeSize(string)
      : asciiSize(string);
  }

  /**
   * Converts `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function stringToArray(string) {
    return hasUnicode(string)
      ? unicodeToArray(string)
      : asciiToArray(string);
  }

  /**
   * Gets the size of a Unicode `string`.
   *
   * @private
   * @param {string} string The string inspect.
   * @returns {number} Returns the string size.
   */
  function unicodeSize(string) {
    var result = reUnicode.lastIndex = 0;
    while (reUnicode.test(string)) {
      ++result;
    }
    return result;
  }

  /**
   * Converts a Unicode `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function unicodeToArray(string) {
    return string.match(reUnicode) || [];
  }

  /*--------------------------------------------------------------------------*/

  /** Used for built-in method references. */
  var arrayProto = Array.prototype,
      funcProto = Function.prototype,
      objectProto = Object.prototype;

  /** Used to detect overreaching core-js shims. */
  var coreJsData = root['__core-js_shared__'];

  /** Used to resolve the decompiled source of functions. */
  var funcToString = funcProto.toString;

  /** Used to check objects for own properties. */
  var hasOwnProperty = objectProto.hasOwnProperty;

  /** Used to generate unique IDs. */
  var idCounter = 0;

  /** Used to detect methods masquerading as native. */
  var maskSrcKey = (function() {
    var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || '');
    return uid ? ('Symbol(src)_1.' + uid) : '';
  }());

  /**
   * Used to resolve the
   * [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring)
   * of values.
   */
  var nativeObjectToString = objectProto.toString;

  /** Used to infer the `Object` constructor. */
  var objectCtorString = funcToString.call(Object);

  /** Used to restore the original `_` reference in `_.noConflict`. */
  var oldDash = root._;

  /** Used to detect if a method is native. */
  var reIsNative = RegExp('^' +
    funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\$&')
    .replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g, '$1.*?') + '$'
  );

  /** Built-in value references. */
  var Buffer = moduleExports ? root.Buffer : undefined,
      Symbol = root.Symbol,
      Uint8Array = root.Uint8Array,
      allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined,
      getPrototype = overArg(Object.getPrototypeOf, Object),
      objectCreate = Object.create,
      propertyIsEnumerable = objectProto.propertyIsEnumerable,
      splice = arrayProto.splice,
      spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined,
      symIterator = Symbol ? Symbol.iterator : undefined,
      symToStringTag = Symbol ? Symbol.toStringTag : undefined;

  var defineProperty = (function() {
    try {
      var func = getNative(Object, 'defineProperty');
      func({}, '', {});
      return func;
    } catch (e) {}
  }());

  /* Built-in method references for those with the same name as other `lodash` methods. */
  var nativeCeil = Math.ceil,
      nativeFloor = Math.floor,
      nativeGetSymbols = Object.getOwnPropertySymbols,
      nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined,
      nativeIsFinite = root.isFinite,
      nativeKeys = overArg(Object.keys, Object),
      nativeMax = Math.max,
      nativeMin = Math.min,
      nativeNow = Date.now,
      nativeRandom = Math.random,
      nativeReverse = arrayProto.reverse;

  /* Built-in method references that are verified to be native. */
  var DataView = getNative(root, 'DataView'),
      Map = getNative(root, 'Map'),
      Promise = getNative(root, 'Promise'),
      Set = getNative(root, 'Set'),
      WeakMap = getNative(root, 'WeakMap'),
      nativeCreate = getNative(Object, 'create');

  /** Used to store function metadata. */
  var metaMap = WeakMap && new WeakMap;

  /** Used to lookup unminified function names. */
  var realNames = {};

  /** Used to detect maps, sets, and weakmaps. */
  var dataViewCtorString = toSource(DataView),
      mapCtorString = toSource(Map),
      promiseCtorString = toSource(Promise),
      setCtorString = toSource(Set),
      weakMapCtorString = toSource(WeakMap);

  /** Used to convert symbols to primitives and strings. */
  var symbolProto = Symbol ? Symbol.prototype : undefined,
      symbolValueOf = symbolProto ? symbolProto.valueOf : undefined,
      symbolToString = symbolProto ? symbolProto.toString : undefined;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a `lodash` object which wraps `value` to enable implicit method
   * chain sequences. Methods that operate on and return arrays, collections,
   * and functions can be chained together. Methods that retrieve a single value
   * or may return a primitive value will automatically end the chain sequence
   * and return the unwrapped value. Otherwise, the value must be unwrapped
   * with `_#value`.
   *
   * Explicit chain sequences, which must be unwrapped with `_#value`, may be
   * enabled using `_.chain`.
   *
   * The execution of chained methods is lazy, that is, it's deferred until
   * `_#value` is implicitly or explicitly called.
   *
   * Lazy evaluation allows several methods to support shortcut fusion.
   * Shortcut fusion is an optimization to merge iteratee calls; this avoids
   * the creation of intermediate arrays and can greatly reduce the number of
   * iteratee executions. Sections of a chain sequence qualify for shortcut
   * fusion if the section is applied to an array and iteratees accept only
   * one argument. The heuristic for whether a section qualifies for shortcut
   * fusion is subject to change.
   *
   * Chaining is supported in custom builds as long as the `_#value` method is
   * directly or indirectly included in the build.
   *
   * In addition to lodash methods, wrappers have `Array` and `String` methods.
   *
   * The wrapper `Array` methods are:
   * `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift`
   *
   * The wrapper `String` methods are:
   * `replace` and `split`
   *
   * The wrapper methods that support shortcut fusion are:
   * `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`,
   * `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`,
   * `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray`
   *
   * The chainable wrapper methods are:
   * `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`,
   * `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`,
   * `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`,
   * `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`,
   * `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`,
   * `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`,
   * `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`,
   * `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`,
   * `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`,
   * `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`,
   * `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`,
   * `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`,
   * `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`,
   * `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`,
   * `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`,
   * `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`,
   * `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`,
   * `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`,
   * `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`,
   * `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`,
   * `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`,
   * `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`,
   * `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`,
   * `zipObject`, `zipObjectDeep`, and `zipWith`
   *
   * The wrapper methods that are **not** chainable by default are:
   * `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`,
   * `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`,
   * `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`,
   * `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`,
   * `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`,
   * `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`,
   * `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`,
   * `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`,
   * `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`,
   * `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`,
   * `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`,
   * `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`,
   * `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`,
   * `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`,
   * `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`,
   * `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`,
   * `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`,
   * `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`,
   * `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`,
   * `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`,
   * `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`,
   * `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`,
   * `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`,
   * `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`,
   * `upperFirst`, `value`, and `words`
   *
   * @name _
   * @constructor
   * @category Seq
   * @param {*} value The value to wrap in a `lodash` instance.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * var wrapped = _([1, 2, 3]);
   *
   * // Returns an unwrapped value.
   * wrapped.reduce(_.add);
   * // => 6
   *
   * // Returns a wrapped value.
   * var squares = wrapped.map(square);
   *
   * _.isArray(squares);
   * // => false
   *
   * _.isArray(squares.value());
   * // => true
   */
  function lodash(value) {
    if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) {
      if (value instanceof LodashWrapper) {
        return value;
      }
      if (hasOwnProperty.call(value, '__wrapped__')) {
        return wrapperClone(value);
      }
    }
    return new LodashWrapper(value);
  }

  /**
   * The base implementation of `_.create` without support for assigning
   * properties to the created object.
   *
   * @private
   * @param {Object} proto The object to inherit from.
   * @returns {Object} Returns the new object.
   */
  var baseCreate = (function() {
    function object() {}
    return function(proto) {
      if (!isObject(proto)) {
        return {};
      }
      if (objectCreate) {
        return objectCreate(proto);
      }
      object.prototype = proto;
      var result = new object;
      object.prototype = undefined;
      return result;
    };
  }());

  /**
   * The function whose prototype chain sequence wrappers inherit from.
   *
   * @private
   */
  function baseLodash() {
    // No operation performed.
  }

  /**
   * The base constructor for creating `lodash` wrapper objects.
   *
   * @private
   * @param {*} value The value to wrap.
   * @param {boolean} [chainAll] Enable explicit method chain sequences.
   */
  function LodashWrapper(value, chainAll) {
    this.__wrapped__ = value;
    this.__actions__ = [];
    this.__chain__ = !!chainAll;
    this.__index__ = 0;
    this.__values__ = undefined;
  }

  // Ensure wrappers are instances of `baseLodash`.
  lodash.prototype = baseLodash.prototype;
  lodash.prototype.constructor = lodash;

  LodashWrapper.prototype = baseCreate(baseLodash.prototype);
  LodashWrapper.prototype.constructor = LodashWrapper;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a lazy wrapper object which wraps `value` to enable lazy evaluation.
   *
   * @private
   * @constructor
   * @param {*} value The value to wrap.
   */
  function LazyWrapper(value) {
    this.__wrapped__ = value;
    this.__actions__ = [];
    this.__dir__ = 1;
    this.__filtered__ = false;
    this.__iteratees__ = [];
    this.__takeCount__ = MAX_ARRAY_LENGTH;
    this.__views__ = [];
  }

  /**
   * Creates a clone of the lazy wrapper object.
   *
   * @private
   * @name clone
   * @memberOf LazyWrapper
   * @returns {Object} Returns the cloned `LazyWrapper` object.
   */
  function lazyClone() {
    var result = new LazyWrapper(this.__wrapped__);
    result.__actions__ = copyArray(this.__actions__);
    result.__dir__ = this.__dir__;
    result.__filtered__ = this.__filtered__;
    result.__iteratees__ = copyArray(this.__iteratees__);
    result.__takeCount__ = this.__takeCount__;
    result.__views__ = copyArray(this.__views__);
    return result;
  }

  /**
   * Reverses the direction of lazy iteration.
   *
   * @private
   * @name reverse
   * @memberOf LazyWrapper
   * @returns {Object} Returns the new reversed `LazyWrapper` object.
   */
  function lazyReverse() {
    if (this.__filtered__) {
      var result = new LazyWrapper(this);
      result.__dir__ = -1;
      result.__filtered__ = true;
    } else {
      result = this.clone();
      result.__dir__ *= -1;
    }
    return result;
  }

  /**
   * Extracts the unwrapped value from its lazy wrapper.
   *
   * @private
   * @name value
   * @memberOf LazyWrapper
   * @returns {*} Returns the unwrapped value.
   */
  function lazyValue() {
    var array = this.__wrapped__.value(),
        dir = this.__dir__,
        isArr = isArray(array),
        isRight = dir < 0,
        arrLength = isArr ? array.length : 0,
        view = getView(0, arrLength, this.__views__),
        start = view.start,
        end = view.end,
        length = end - start,
        index = isRight ? end : (start - 1),
        iteratees = this.__iteratees__,
        iterLength = iteratees.length,
        resIndex = 0,
        takeCount = nativeMin(length, this.__takeCount__);

    if (!isArr || (!isRight && arrLength == length && takeCount == length)) {
      return baseWrapperValue(array, this.__actions__);
    }
    var result = [];

    outer:
    while (length-- && resIndex < takeCount) {
      index += dir;

      var iterIndex = -1,
          value = array[index];

      while (++iterIndex < iterLength) {
        var data = iteratees[iterIndex],
            iteratee = data.iteratee,
            type = data.type,
            computed = iteratee(value);

        if (type == LAZY_MAP_FLAG) {
          value = computed;
        } else if (!computed) {
          if (type == LAZY_FILTER_FLAG) {
            continue outer;
          } else {
            break outer;
          }
        }
      }
      result[resIndex++] = value;
    }
    return result;
  }

  // Ensure `LazyWrapper` is an instance of `baseLodash`.
  LazyWrapper.prototype = baseCreate(baseLodash.prototype);
  LazyWrapper.prototype.constructor = LazyWrapper;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a hash object.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function Hash(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the hash.
   *
   * @private
   * @name clear
   * @memberOf Hash
   */
  function hashClear() {
    this.__data__ = nativeCreate ? nativeCreate(null) : {};
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the hash.
   *
   * @private
   * @name delete
   * @memberOf Hash
   * @param {Object} hash The hash to modify.
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function hashDelete(key) {
    var result = this.has(key) && delete this.__data__[key];
    this.size -= result ? 1 : 0;
    return result;
  }

  /**
   * Gets the hash value for `key`.
   *
   * @private
   * @name get
   * @memberOf Hash
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function hashGet(key) {
    var data = this.__data__;
    if (nativeCreate) {
      var result = data[key];
      return result === HASH_UNDEFINED ? undefined : result;
    }
    return hasOwnProperty.call(data, key) ? data[key] : undefined;
  }

  /**
   * Checks if a hash value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf Hash
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function hashHas(key) {
    var data = this.__data__;
    return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key);
  }

  /**
   * Sets the hash `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf Hash
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the hash instance.
   */
  function hashSet(key, value) {
    var data = this.__data__;
    this.size += this.has(key) ? 0 : 1;
    data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value;
    return this;
  }

  // Add methods to `Hash`.
  Hash.prototype.clear = hashClear;
  Hash.prototype['delete'] = hashDelete;
  Hash.prototype.get = hashGet;
  Hash.prototype.has = hashHas;
  Hash.prototype.set = hashSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates an list cache object.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function ListCache(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the list cache.
   *
   * @private
   * @name clear
   * @memberOf ListCache
   */
  function listCacheClear() {
    this.__data__ = [];
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the list cache.
   *
   * @private
   * @name delete
   * @memberOf ListCache
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function listCacheDelete(key) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    if (index < 0) {
      return false;
    }
    var lastIndex = data.length - 1;
    if (index == lastIndex) {
      data.pop();
    } else {
      splice.call(data, index, 1);
    }
    --this.size;
    return true;
  }

  /**
   * Gets the list cache value for `key`.
   *
   * @private
   * @name get
   * @memberOf ListCache
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function listCacheGet(key) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    return index < 0 ? undefined : data[index][1];
  }

  /**
   * Checks if a list cache value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf ListCache
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function listCacheHas(key) {
    return assocIndexOf(this.__data__, key) > -1;
  }

  /**
   * Sets the list cache `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf ListCache
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the list cache instance.
   */
  function listCacheSet(key, value) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    if (index < 0) {
      ++this.size;
      data.push([key, value]);
    } else {
      data[index][1] = value;
    }
    return this;
  }

  // Add methods to `ListCache`.
  ListCache.prototype.clear = listCacheClear;
  ListCache.prototype['delete'] = listCacheDelete;
  ListCache.prototype.get = listCacheGet;
  ListCache.prototype.has = listCacheHas;
  ListCache.prototype.set = listCacheSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a map cache object to store key-value pairs.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function MapCache(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the map.
   *
   * @private
   * @name clear
   * @memberOf MapCache
   */
  function mapCacheClear() {
    this.size = 0;
    this.__data__ = {
      'hash': new Hash,
      'map': new (Map || ListCache),
      'string': new Hash
    };
  }

  /**
   * Removes `key` and its value from the map.
   *
   * @private
   * @name delete
   * @memberOf MapCache
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function mapCacheDelete(key) {
    var result = getMapData(this, key)['delete'](key);
    this.size -= result ? 1 : 0;
    return result;
  }

  /**
   * Gets the map value for `key`.
   *
   * @private
   * @name get
   * @memberOf MapCache
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function mapCacheGet(key) {
    return getMapData(this, key).get(key);
  }

  /**
   * Checks if a map value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf MapCache
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function mapCacheHas(key) {
    return getMapData(this, key).has(key);
  }

  /**
   * Sets the map `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf MapCache
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the map cache instance.
   */
  function mapCacheSet(key, value) {
    var data = getMapData(this, key),
        size = data.size;

    data.set(key, value);
    this.size += data.size == size ? 0 : 1;
    return this;
  }

  // Add methods to `MapCache`.
  MapCache.prototype.clear = mapCacheClear;
  MapCache.prototype['delete'] = mapCacheDelete;
  MapCache.prototype.get = mapCacheGet;
  MapCache.prototype.has = mapCacheHas;
  MapCache.prototype.set = mapCacheSet;

  /*------------------------------------------------------------------------*/

  /**
   *
   * Creates an array cache object to store unique values.
   *
   * @private
   * @constructor
   * @param {Array} [values] The values to cache.
   */
  function SetCache(values) {
    var index = -1,
        length = values == null ? 0 : values.length;

    this.__data__ = new MapCache;
    while (++index < length) {
      this.add(values[index]);
    }
  }

  /**
   * Adds `value` to the array cache.
   *
   * @private
   * @name add
   * @memberOf SetCache
   * @alias push
   * @param {*} value The value to cache.
   * @returns {Object} Returns the cache instance.
   */
  function setCacheAdd(value) {
    this.__data__.set(value, HASH_UNDEFINED);
    return this;
  }

  /**
   * Checks if `value` is in the array cache.
   *
   * @private
   * @name has
   * @memberOf SetCache
   * @param {*} value The value to search for.
   * @returns {number} Returns `true` if `value` is found, else `false`.
   */
  function setCacheHas(value) {
    return this.__data__.has(value);
  }

  // Add methods to `SetCache`.
  SetCache.prototype.add = SetCache.prototype.push = setCacheAdd;
  SetCache.prototype.has = setCacheHas;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a stack cache object to store key-value pairs.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function Stack(entries) {
    var data = this.__data__ = new ListCache(entries);
    this.size = data.size;
  }

  /**
   * Removes all key-value entries from the stack.
   *
   * @private
   * @name clear
   * @memberOf Stack
   */
  function stackClear() {
    this.__data__ = new ListCache;
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the stack.
   *
   * @private
   * @name delete
   * @memberOf Stack
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function stackDelete(key) {
    var data = this.__data__,
        result = data['delete'](key);

    this.size = data.size;
    return result;
  }

  /**
   * Gets the stack value for `key`.
   *
   * @private
   * @name get
   * @memberOf Stack
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function stackGet(key) {
    return this.__data__.get(key);
  }

  /**
   * Checks if a stack value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf Stack
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function stackHas(key) {
    return this.__data__.has(key);
  }

  /**
   * Sets the stack `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf Stack
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the stack cache instance.
   */
  function stackSet(key, value) {
    var data = this.__data__;
    if (data instanceof ListCache) {
      var pairs = data.__data__;
      if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) {
        pairs.push([key, value]);
        this.size = ++data.size;
        return this;
      }
      data = this.__data__ = new MapCache(pairs);
    }
    data.set(key, value);
    this.size = data.size;
    return this;
  }

  // Add methods to `Stack`.
  Stack.prototype.clear = stackClear;
  Stack.prototype['delete'] = stackDelete;
  Stack.prototype.get = stackGet;
  Stack.prototype.has = stackHas;
  Stack.prototype.set = stackSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates an array of the enumerable property names of the array-like `value`.
   *
   * @private
   * @param {*} value The value to query.
   * @param {boolean} inherited Specify returning inherited property names.
   * @returns {Array} Returns the array of property names.
   */
  function arrayLikeKeys(value, inherited) {
    var isArr = isArray(value),
        isArg = !isArr && isArguments(value),
        isBuff = !isArr && !isArg && isBuffer(value),
        isType = !isArr && !isArg && !isBuff && isTypedArray(value),
        skipIndexes = isArr || isArg || isBuff || isType,
        result = skipIndexes ? baseTimes(value.length, String) : [],
        length = result.length;

    for (var key in value) {
      if ((inherited || hasOwnProperty.call(value, key)) &&
          !(skipIndexes && (
             // Safari 9 has enumerable `arguments.length` in strict mode.
             key == 'length' ||
             // Node.js 0.10 has enumerable non-index properties on buffers.
             (isBuff && (key == 'offset' || key == 'parent')) ||
             // PhantomJS 2 has enumerable non-index properties on typed arrays.
             (isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) ||
             // Skip index properties.
             isIndex(key, length)
          ))) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * This function is like `assignValue` except that it doesn't assign
   * `undefined` values.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function assignMergeValue(object, key, value) {
    if ((value !== undefined && !eq(object[key], value)) ||
        (value === undefined && !(key in object))) {
      baseAssignValue(object, key, value);
    }
  }

  /**
   * Assigns `value` to `key` of `object` if the existing value is not equivalent
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function assignValue(object, key, value) {
    var objValue = object[key];
    if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) ||
        (value === undefined && !(key in object))) {
      baseAssignValue(object, key, value);
    }
  }

  /**
   * Gets the index at which the `key` is found in `array` of key-value pairs.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} key The key to search for.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function assocIndexOf(array, key) {
    var length = array.length;
    while (length--) {
      if (eq(array[length][0], key)) {
        return length;
      }
    }
    return -1;
  }

  /**
   * Aggregates elements of `collection` on `accumulator` with keys transformed
   * by `iteratee` and values set by `setter`.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform keys.
   * @param {Object} accumulator The initial aggregated object.
   * @returns {Function} Returns `accumulator`.
   */
  function baseAggregator(collection, setter, iteratee, accumulator) {
    baseEach(collection, function(value, key, collection) {
      setter(accumulator, value, iteratee(value), collection);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.assign` without support for multiple sources
   * or `customizer` functions.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @returns {Object} Returns `object`.
   */
  function baseAssign(object, source) {
    return object && copyObject(source, keys(source), object);
  }

  /**
   * The base implementation of `_.assignIn` without support for multiple sources
   * or `customizer` functions.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @returns {Object} Returns `object`.
   */
  function baseAssignIn(object, source) {
    return object && copyObject(source, keysIn(source), object);
  }

  /**
   * The base implementation of `assignValue` and `assignMergeValue` without
   * value checks.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function baseAssignValue(object, key, value) {
    if (key == '__proto__' && defineProperty) {
      defineProperty(object, key, {
        'configurable': true,
        'enumerable': true,
        'value': value,
        'writable': true
      });
    } else {
      object[key] = value;
    }
  }

  /**
   * The base implementation of `_.at` without support for individual paths.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {string[]} paths The property paths to pick.
   * @returns {Array} Returns the picked elements.
   */
  function baseAt(object, paths) {
    var index = -1,
        length = paths.length,
        result = Array(length),
        skip = object == null;

    while (++index < length) {
      result[index] = skip ? undefined : get(object, paths[index]);
    }
    return result;
  }

  /**
   * The base implementation of `_.clamp` which doesn't coerce arguments.
   *
   * @private
   * @param {number} number The number to clamp.
   * @param {number} [lower] The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the clamped number.
   */
  function baseClamp(number, lower, upper) {
    if (number === number) {
      if (upper !== undefined) {
        number = number <= upper ? number : upper;
      }
      if (lower !== undefined) {
        number = number >= lower ? number : lower;
      }
    }
    return number;
  }

  /**
   * The base implementation of `_.clone` and `_.cloneDeep` which tracks
   * traversed objects.
   *
   * @private
   * @param {*} value The value to clone.
   * @param {boolean} bitmask The bitmask flags.
   *  1 - Deep clone
   *  2 - Flatten inherited properties
   *  4 - Clone symbols
   * @param {Function} [customizer] The function to customize cloning.
   * @param {string} [key] The key of `value`.
   * @param {Object} [object] The parent object of `value`.
   * @param {Object} [stack] Tracks traversed objects and their clone counterparts.
   * @returns {*} Returns the cloned value.
   */
  function baseClone(value, bitmask, customizer, key, object, stack) {
    var result,
        isDeep = bitmask & CLONE_DEEP_FLAG,
        isFlat = bitmask & CLONE_FLAT_FLAG,
        isFull = bitmask & CLONE_SYMBOLS_FLAG;

    if (customizer) {
      result = object ? customizer(value, key, object, stack) : customizer(value);
    }
    if (result !== undefined) {
      return result;
    }
    if (!isObject(value)) {
      return value;
    }
    var isArr = isArray(value);
    if (isArr) {
      result = initCloneArray(value);
      if (!isDeep) {
        return copyArray(value, result);
      }
    } else {
      var tag = getTag(value),
          isFunc = tag == funcTag || tag == genTag;

      if (isBuffer(value)) {
        return cloneBuffer(value, isDeep);
      }
      if (tag == objectTag || tag == argsTag || (isFunc && !object)) {
        result = (isFlat || isFunc) ? {} : initCloneObject(value);
        if (!isDeep) {
          return isFlat
            ? copySymbolsIn(value, baseAssignIn(result, value))
            : copySymbols(value, baseAssign(result, value));
        }
      } else {
        if (!cloneableTags[tag]) {
          return object ? value : {};
        }
        result = initCloneByTag(value, tag, isDeep);
      }
    }
    // Check for circular references and return its corresponding clone.
    stack || (stack = new Stack);
    var stacked = stack.get(value);
    if (stacked) {
      return stacked;
    }
    stack.set(value, result);

    if (isSet(value)) {
      value.forEach(function(subValue) {
        result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack));
      });

      return result;
    }

    if (isMap(value)) {
      value.forEach(function(subValue, key) {
        result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack));
      });

      return result;
    }

    var keysFunc = isFull
      ? (isFlat ? getAllKeysIn : getAllKeys)
      : (isFlat ? keysIn : keys);

    var props = isArr ? undefined : keysFunc(value);
    arrayEach(props || value, function(subValue, key) {
      if (props) {
        key = subValue;
        subValue = value[key];
      }
      // Recursively populate clone (susceptible to call stack limits).
      assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack));
    });
    return result;
  }

  /**
   * The base implementation of `_.delay` and `_.defer` which accepts `args`
   * to provide to `func`.
   *
   * @private
   * @param {Function} func The function to delay.
   * @param {number} wait The number of milliseconds to delay invocation.
   * @param {Array} args The arguments to provide to `func`.
   * @returns {number|Object} Returns the timer id or timeout object.
   */
  function baseDelay(func, wait, args) {
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    return setTimeout(function() { func.apply(undefined, args); }, wait);
  }

  /**
   * The base implementation of methods like `_.difference` without support
   * for excluding multiple arrays or iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Array} values The values to exclude.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new array of filtered values.
   */
  function baseDifference(array, values, iteratee, comparator) {
    var index = -1,
        includes = arrayIncludes,
        isCommon = true,
        length = array.length,
        result = [],
        valuesLength = values.length;

    if (!length) {
      return result;
    }
    if (iteratee) {
      values = arrayMap(values, baseUnary(iteratee));
    }
    if (comparator) {
      includes = arrayIncludesWith;
      isCommon = false;
    }
    else if (values.length >= LARGE_ARRAY_SIZE) {
      includes = cacheHas;
      isCommon = false;
      values = new SetCache(values);
    }
    outer:
    while (++index < length) {
      var value = array[index],
          computed = iteratee == null ? value : iteratee(value);

      value = (comparator || value !== 0) ? value : 0;
      if (isCommon && computed === computed) {
        var valuesIndex = valuesLength;
        while (valuesIndex--) {
          if (values[valuesIndex] === computed) {
            continue outer;
          }
        }
        result.push(value);
      }
      else if (!includes(values, computed, comparator)) {
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.forEach` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array|Object} Returns `collection`.
   */
  var baseEach = createBaseEach(baseForOwn);

  /**
   * The base implementation of `_.every` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`
   */
  function baseEvery(collection, predicate) {
    var result = true;
    baseEach(collection, function(value, index, collection) {
      result = !!predicate(value, index, collection);
      return result;
    });
    return result;
  }

  /**
   * The base implementation of methods like `_.max` and `_.min` which accepts a
   * `comparator` to determine the extremum value.
   *
   * @private
   * @param {Array} array The array to iterate over.
   * @param {Function} iteratee The iteratee invoked per iteration.
   * @param {Function} comparator The comparator used to compare values.
   * @returns {*} Returns the extremum value.
   */
  function baseExtremum(array, iteratee, comparator) {
    var index = -1,
        length = array.length;

    while (++index < length) {
      var value = array[index],
          current = iteratee(value);

      if (current != null && (computed === undefined
            ? (current === current && !isSymbol(current))
            : comparator(current, computed)
          )) {
        var computed = current,
            result = value;
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.filter` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   */
  function baseFilter(collection, predicate) {
    var result = [];
    baseEach(collection, function(value, index, collection) {
      if (predicate(value, index, collection)) {
        result.push(value);
      }
    });
    return result;
  }

  /**
   * The base implementation of `_.flatten` with support for restricting flattening.
   *
   * @private
   * @param {Array} array The array to flatten.
   * @param {number} depth The maximum recursion depth.
   * @param {boolean} [predicate=isFlattenable] The function invoked per iteration.
   * @param {boolean} [isStrict] Restrict to values that pass `predicate` checks.
   * @param {Array} [result=[]] The initial result value.
   * @returns {Array} Returns the new flattened array.
   */
  function baseFlatten(array, depth, predicate, isStrict, result) {
    var index = -1,
        length = array.length;

    predicate || (predicate = isFlattenable);
    result || (result = []);

    while (++index < length) {
      var value = array[index];
      if (depth > 0 && predicate(value)) {
        if (depth > 1) {
          // Recursively flatten arrays (susceptible to call stack limits).
          baseFlatten(value, depth - 1, predicate, isStrict, result);
        } else {
          arrayPush(result, value);
        }
      } else if (!isStrict) {
        result[result.length] = value;
      }
    }
    return result;
  }

  /**
   * The base implementation of `baseForOwn` which iterates over `object`
   * properties returned by `keysFunc` and invokes `iteratee` for each property.
   * Iteratee functions may exit iteration early by explicitly returning `false`.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @returns {Object} Returns `object`.
   */
  var baseFor = createBaseFor();

  /**
   * This function is like `baseFor` except that it iterates over properties
   * in the opposite order.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @returns {Object} Returns `object`.
   */
  var baseForRight = createBaseFor(true);

  /**
   * The base implementation of `_.forOwn` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Object} Returns `object`.
   */
  function baseForOwn(object, iteratee) {
    return object && baseFor(object, iteratee, keys);
  }

  /**
   * The base implementation of `_.forOwnRight` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Object} Returns `object`.
   */
  function baseForOwnRight(object, iteratee) {
    return object && baseForRight(object, iteratee, keys);
  }

  /**
   * The base implementation of `_.functions` which creates an array of
   * `object` function property names filtered from `props`.
   *
   * @private
   * @param {Object} object The object to inspect.
   * @param {Array} props The property names to filter.
   * @returns {Array} Returns the function names.
   */
  function baseFunctions(object, props) {
    return arrayFilter(props, function(key) {
      return isFunction(object[key]);
    });
  }

  /**
   * The base implementation of `_.get` without support for default values.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to get.
   * @returns {*} Returns the resolved value.
   */
  function baseGet(object, path) {
    path = castPath(path, object);

    var index = 0,
        length = path.length;

    while (object != null && index < length) {
      object = object[toKey(path[index++])];
    }
    return (index && index == length) ? object : undefined;
  }

  /**
   * The base implementation of `getAllKeys` and `getAllKeysIn` which uses
   * `keysFunc` and `symbolsFunc` to get the enumerable property names and
   * symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @param {Function} symbolsFunc The function to get the symbols of `object`.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function baseGetAllKeys(object, keysFunc, symbolsFunc) {
    var result = keysFunc(object);
    return isArray(object) ? result : arrayPush(result, symbolsFunc(object));
  }

  /**
   * The base implementation of `getTag` without fallbacks for buggy environments.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the `toStringTag`.
   */
  function baseGetTag(value) {
    if (value == null) {
      return value === undefined ? undefinedTag : nullTag;
    }
    return (symToStringTag && symToStringTag in Object(value))
      ? getRawTag(value)
      : objectToString(value);
  }

  /**
   * The base implementation of `_.gt` which doesn't coerce arguments.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if `value` is greater than `other`,
   *  else `false`.
   */
  function baseGt(value, other) {
    return value > other;
  }

  /**
   * The base implementation of `_.has` without support for deep paths.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {Array|string} key The key to check.
   * @returns {boolean} Returns `true` if `key` exists, else `false`.
   */
  function baseHas(object, key) {
    return object != null && hasOwnProperty.call(object, key);
  }

  /**
   * The base implementation of `_.hasIn` without support for deep paths.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {Array|string} key The key to check.
   * @returns {boolean} Returns `true` if `key` exists, else `false`.
   */
  function baseHasIn(object, key) {
    return object != null && key in Object(object);
  }

  /**
   * The base implementation of methods like `_.intersection`, without support
   * for iteratee shorthands, that accepts an array of arrays to inspect.
   *
   * @private
   * @param {Array} arrays The arrays to inspect.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new array of shared values.
   */
  function baseIntersection(arrays, iteratee, comparator) {
    var includes = comparator ? arrayIncludesWith : arrayIncludes,
        length = arrays[0].length,
        othLength = arrays.length,
        othIndex = othLength,
        caches = Array(othLength),
        maxLength = Infinity,
        result = [];

    while (othIndex--) {
      var array = arrays[othIndex];
      if (othIndex && iteratee) {
        array = arrayMap(array, baseUnary(iteratee));
      }
      maxLength = nativeMin(array.length, maxLength);
      caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120))
        ? new SetCache(othIndex && array)
        : undefined;
    }
    array = arrays[0];

    var index = -1,
        seen = caches[0];

    outer:
    while (++index < length && result.length < maxLength) {
      var value = array[index],
          computed = iteratee ? iteratee(value) : value;

      value = (comparator || value !== 0) ? value : 0;
      if (!(seen
            ? cacheHas(seen, computed)
            : includes(result, computed, comparator)
          )) {
        othIndex = othLength;
        while (--othIndex) {
          var cache = caches[othIndex];
          if (!(cache
                ? cacheHas(cache, computed)
                : includes(arrays[othIndex], computed, comparator))
              ) {
            continue outer;
          }
        }
        if (seen) {
          seen.push(computed);
        }
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.invert` and `_.invertBy` which inverts
   * `object` with values transformed by `iteratee` and set by `setter`.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform values.
   * @param {Object} accumulator The initial inverted object.
   * @returns {Function} Returns `accumulator`.
   */
  function baseInverter(object, setter, iteratee, accumulator) {
    baseForOwn(object, function(value, key, object) {
      setter(accumulator, iteratee(value), key, object);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.invoke` without support for individual
   * method arguments.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the method to invoke.
   * @param {Array} args The arguments to invoke the method with.
   * @returns {*} Returns the result of the invoked method.
   */
  function baseInvoke(object, path, args) {
    path = castPath(path, object);
    object = parent(object, path);
    var func = object == null ? object : object[toKey(last(path))];
    return func == null ? undefined : apply(func, object, args);
  }

  /**
   * The base implementation of `_.isArguments`.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an `arguments` object,
   */
  function baseIsArguments(value) {
    return isObjectLike(value) && baseGetTag(value) == argsTag;
  }

  /**
   * The base implementation of `_.isDate` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.
   */
  function baseIsDate(value) {
    return isObjectLike(value) && baseGetTag(value) == dateTag;
  }

  /**
   * The base implementation of `_.isEqual` which supports partial comparisons
   * and tracks traversed objects.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @param {boolean} bitmask The bitmask flags.
   *  1 - Unordered comparison
   *  2 - Partial comparison
   * @param {Function} [customizer] The function to customize comparisons.
   * @param {Object} [stack] Tracks traversed `value` and `other` objects.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   */
  function baseIsEqual(value, other, bitmask, customizer, stack) {
    if (value === other) {
      return true;
    }
    if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) {
      return value !== value && other !== other;
    }
    return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack);
  }

  /**
   * A specialized version of `baseIsEqual` for arrays and objects which performs
   * deep comparisons and tracks traversed objects enabling objects with circular
   * references to be compared.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} [stack] Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) {
    var objIsArr = isArray(object),
        othIsArr = isArray(other),
        objTag = objIsArr ? arrayTag : getTag(object),
        othTag = othIsArr ? arrayTag : getTag(other);

    objTag = objTag == argsTag ? objectTag : objTag;
    othTag = othTag == argsTag ? objectTag : othTag;

    var objIsObj = objTag == objectTag,
        othIsObj = othTag == objectTag,
        isSameTag = objTag == othTag;

    if (isSameTag && isBuffer(object)) {
      if (!isBuffer(other)) {
        return false;
      }
      objIsArr = true;
      objIsObj = false;
    }
    if (isSameTag && !objIsObj) {
      stack || (stack = new Stack);
      return (objIsArr || isTypedArray(object))
        ? equalArrays(object, other, bitmask, customizer, equalFunc, stack)
        : equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack);
    }
    if (!(bitmask & COMPARE_PARTIAL_FLAG)) {
      var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'),
          othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__');

      if (objIsWrapped || othIsWrapped) {
        var objUnwrapped = objIsWrapped ? object.value() : object,
            othUnwrapped = othIsWrapped ? other.value() : other;

        stack || (stack = new Stack);
        return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack);
      }
    }
    if (!isSameTag) {
      return false;
    }
    stack || (stack = new Stack);
    return equalObjects(object, other, bitmask, customizer, equalFunc, stack);
  }

  /**
   * The base implementation of `_.isMap` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a map, else `false`.
   */
  function baseIsMap(value) {
    return isObjectLike(value) && getTag(value) == mapTag;
  }

  /**
   * The base implementation of `_.isMatch` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to inspect.
   * @param {Object} source The object of property values to match.
   * @param {Array} matchData The property names, values, and compare flags to match.
   * @param {Function} [customizer] The function to customize comparisons.
   * @returns {boolean} Returns `true` if `object` is a match, else `false`.
   */
  function baseIsMatch(object, source, matchData, customizer) {
    var index = matchData.length,
        length = index,
        noCustomizer = !customizer;

    if (object == null) {
      return !length;
    }
    object = Object(object);
    while (index--) {
      var data = matchData[index];
      if ((noCustomizer && data[2])
            ? data[1] !== object[data[0]]
            : !(data[0] in object)
          ) {
        return false;
      }
    }
    while (++index < length) {
      data = matchData[index];
      var key = data[0],
          objValue = object[key],
          srcValue = data[1];

      if (noCustomizer && data[2]) {
        if (objValue === undefined && !(key in object)) {
          return false;
        }
      } else {
        var stack = new Stack;
        if (customizer) {
          var result = customizer(objValue, srcValue, key, object, source, stack);
        }
        if (!(result === undefined
              ? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack)
              : result
            )) {
          return false;
        }
      }
    }
    return true;
  }

  /**
   * The base implementation of `_.isNative` without bad shim checks.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a native function,
   *  else `false`.
   */
  function baseIsNative(value) {
    if (!isObject(value) || isMasked(value)) {
      return false;
    }
    var pattern = isFunction(value) ? reIsNative : reIsHostCtor;
    return pattern.test(toSource(value));
  }

  /**
   * The base implementation of `_.isRegExp` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.
   */
  function baseIsRegExp(value) {
    return isObjectLike(value) && baseGetTag(value) == regexpTag;
  }

  /**
   * The base implementation of `_.isSet` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a set, else `false`.
   */
  function baseIsSet(value) {
    return isObjectLike(value) && getTag(value) == setTag;
  }

  /**
   * The base implementation of `_.isTypedArray` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.
   */
  function baseIsTypedArray(value) {
    return isObjectLike(value) &&
      isLength(value.length) && !!typedArrayTags[baseGetTag(value)];
  }

  /**
   * The base implementation of `_.iteratee`.
   *
   * @private
   * @param {*} [value=_.identity] The value to convert to an iteratee.
   * @returns {Function} Returns the iteratee.
   */
  function baseIteratee(value) {
    // Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9.
    // See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details.
    if (typeof value == 'function') {
      return value;
    }
    if (value == null) {
      return identity;
    }
    if (typeof value == 'object') {
      return isArray(value)
        ? baseMatchesProperty(value[0], value[1])
        : baseMatches(value);
    }
    return property(value);
  }

  /**
   * The base implementation of `_.keys` which doesn't treat sparse arrays as dense.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function baseKeys(object) {
    if (!isPrototype(object)) {
      return nativeKeys(object);
    }
    var result = [];
    for (var key in Object(object)) {
      if (hasOwnProperty.call(object, key) && key != 'constructor') {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function baseKeysIn(object) {
    if (!isObject(object)) {
      return nativeKeysIn(object);
    }
    var isProto = isPrototype(object),
        result = [];

    for (var key in object) {
      if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.lt` which doesn't coerce arguments.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if `value` is less than `other`,
   *  else `false`.
   */
  function baseLt(value, other) {
    return value < other;
  }

  /**
   * The base implementation of `_.map` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   */
  function baseMap(collection, iteratee) {
    var index = -1,
        result = isArrayLike(collection) ? Array(collection.length) : [];

    baseEach(collection, function(value, key, collection) {
      result[++index] = iteratee(value, key, collection);
    });
    return result;
  }

  /**
   * The base implementation of `_.matches` which doesn't clone `source`.
   *
   * @private
   * @param {Object} source The object of property values to match.
   * @returns {Function} Returns the new spec function.
   */
  function baseMatches(source) {
    var matchData = getMatchData(source);
    if (matchData.length == 1 && matchData[0][2]) {
      return matchesStrictComparable(matchData[0][0], matchData[0][1]);
    }
    return function(object) {
      return object === source || baseIsMatch(object, source, matchData);
    };
  }

  /**
   * The base implementation of `_.matchesProperty` which doesn't clone `srcValue`.
   *
   * @private
   * @param {string} path The path of the property to get.
   * @param {*} srcValue The value to match.
   * @returns {Function} Returns the new spec function.
   */
  function baseMatchesProperty(path, srcValue) {
    if (isKey(path) && isStrictComparable(srcValue)) {
      return matchesStrictComparable(toKey(path), srcValue);
    }
    return function(object) {
      var objValue = get(object, path);
      return (objValue === undefined && objValue === srcValue)
        ? hasIn(object, path)
        : baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG);
    };
  }

  /**
   * The base implementation of `_.merge` without support for multiple sources.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @param {number} srcIndex The index of `source`.
   * @param {Function} [customizer] The function to customize merged values.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   */
  function baseMerge(object, source, srcIndex, customizer, stack) {
    if (object === source) {
      return;
    }
    baseFor(source, function(srcValue, key) {
      if (isObject(srcValue)) {
        stack || (stack = new Stack);
        baseMergeDeep(object, source, key, srcIndex, baseMerge, customizer, stack);
      }
      else {
        var newValue = customizer
          ? customizer(safeGet(object, key), srcValue, (key + ''), object, source, stack)
          : undefined;

        if (newValue === undefined) {
          newValue = srcValue;
        }
        assignMergeValue(object, key, newValue);
      }
    }, keysIn);
  }

  /**
   * A specialized version of `baseMerge` for arrays and objects which performs
   * deep merges and tracks traversed objects enabling objects with circular
   * references to be merged.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @param {string} key The key of the value to merge.
   * @param {number} srcIndex The index of `source`.
   * @param {Function} mergeFunc The function to merge values.
   * @param {Function} [customizer] The function to customize assigned values.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   */
  function baseMergeDeep(object, source, key, srcIndex, mergeFunc, customizer, stack) {
    var objValue = safeGet(object, key),
        srcValue = safeGet(source, key),
        stacked = stack.get(srcValue);

    if (stacked) {
      assignMergeValue(object, key, stacked);
      return;
    }
    var newValue = customizer
      ? customizer(objValue, srcValue, (key + ''), object, source, stack)
      : undefined;

    var isCommon = newValue === undefined;

    if (isCommon) {
      var isArr = isArray(srcValue),
          isBuff = !isArr && isBuffer(srcValue),
          isTyped = !isArr && !isBuff && isTypedArray(srcValue);

      newValue = srcValue;
      if (isArr || isBuff || isTyped) {
        if (isArray(objValue)) {
          newValue = objValue;
        }
        else if (isArrayLikeObject(objValue)) {
          newValue = copyArray(objValue);
        }
        else if (isBuff) {
          isCommon = false;
          newValue = cloneBuffer(srcValue, true);
        }
        else if (isTyped) {
          isCommon = false;
          newValue = cloneTypedArray(srcValue, true);
        }
        else {
          newValue = [];
        }
      }
      else if (isPlainObject(srcValue) || isArguments(srcValue)) {
        newValue = objValue;
        if (isArguments(objValue)) {
          newValue = toPlainObject(objValue);
        }
        else if (!isObject(objValue) || (srcIndex && isFunction(objValue))) {
          newValue = initCloneObject(srcValue);
        }
      }
      else {
        isCommon = false;
      }
    }
    if (isCommon) {
      // Recursively merge objects and arrays (susceptible to call stack limits).
      stack.set(srcValue, newValue);
      mergeFunc(newValue, srcValue, srcIndex, customizer, stack);
      stack['delete'](srcValue);
    }
    assignMergeValue(object, key, newValue);
  }

  /**
   * The base implementation of `_.orderBy` without param guards.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by.
   * @param {string[]} orders The sort orders of `iteratees`.
   * @returns {Array} Returns the new sorted array.
   */
  function baseOrderBy(collection, iteratees, orders) {
    var index = -1;
    iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee));

    var result = baseMap(collection, function(value, key, collection) {
      var criteria = arrayMap(iteratees, function(iteratee) {
        return iteratee(value);
      });
      return { 'criteria': criteria, 'index': ++index, 'value': value };
    });

    return baseSortBy(result, function(object, other) {
      return compareMultiple(object, other, orders);
    });
  }

  /**
   * The base implementation of `_.pick` without support for individual
   * property identifiers.
   *
   * @private
   * @param {Object} object The source object.
   * @param {string[]} paths The property paths to pick.
   * @returns {Object} Returns the new object.
   */
  function basePick(object, paths) {
    return basePickBy(object, paths, function(value, path) {
      return hasIn(object, path);
    });
  }

  /**
   * The base implementation of  `_.pickBy` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The source object.
   * @param {string[]} paths The property paths to pick.
   * @param {Function} predicate The function invoked per property.
   * @returns {Object} Returns the new object.
   */
  function basePickBy(object, paths, predicate) {
    var index = -1,
        length = paths.length,
        result = {};

    while (++index < length) {
      var path = paths[index],
          value = baseGet(object, path);

      if (predicate(value, path)) {
        baseSet(result, castPath(path, object), value);
      }
    }
    return result;
  }

  /**
   * A specialized version of `baseProperty` which supports deep paths.
   *
   * @private
   * @param {Array|string} path The path of the property to get.
   * @returns {Function} Returns the new accessor function.
   */
  function basePropertyDeep(path) {
    return function(object) {
      return baseGet(object, path);
    };
  }

  /**
   * The base implementation of `_.random` without support for returning
   * floating-point numbers.
   *
   * @private
   * @param {number} lower The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the random number.
   */
  function baseRandom(lower, upper) {
    return lower + nativeFloor(nativeRandom() * (upper - lower + 1));
  }

  /**
   * The base implementation of `_.range` and `_.rangeRight` which doesn't
   * coerce arguments.
   *
   * @private
   * @param {number} start The start of the range.
   * @param {number} end The end of the range.
   * @param {number} step The value to increment or decrement by.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Array} Returns the range of numbers.
   */
  function baseRange(start, end, step, fromRight) {
    var index = -1,
        length = nativeMax(nativeCeil((end - start) / (step || 1)), 0),
        result = Array(length);

    while (length--) {
      result[fromRight ? length : ++index] = start;
      start += step;
    }
    return result;
  }

  /**
   * The base implementation of `_.rest` which doesn't validate or coerce arguments.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @returns {Function} Returns the new function.
   */
  function baseRest(func, start) {
    return setToString(overRest(func, start, identity), func + '');
  }

  /**
   * The base implementation of `_.set`.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {Array|string} path The path of the property to set.
   * @param {*} value The value to set.
   * @param {Function} [customizer] The function to customize path creation.
   * @returns {Object} Returns `object`.
   */
  function baseSet(object, path, value, customizer) {
    if (!isObject(object)) {
      return object;
    }
    path = castPath(path, object);

    var index = -1,
        length = path.length,
        lastIndex = length - 1,
        nested = object;

    while (nested != null && ++index < length) {
      var key = toKey(path[index]),
          newValue = value;

      if (index != lastIndex) {
        var objValue = nested[key];
        newValue = customizer ? customizer(objValue, key, nested) : undefined;
        if (newValue === undefined) {
          newValue = isObject(objValue)
            ? objValue
            : (isIndex(path[index + 1]) ? [] : {});
        }
      }
      assignValue(nested, key, newValue);
      nested = nested[key];
    }
    return object;
  }

  /**
   * The base implementation of `setData` without support for hot loop shorting.
   *
   * @private
   * @param {Function} func The function to associate metadata with.
   * @param {*} data The metadata.
   * @returns {Function} Returns `func`.
   */
  var baseSetData = !metaMap ? identity : function(func, data) {
    metaMap.set(func, data);
    return func;
  };

  /**
   * The base implementation of `setToString` without support for hot loop shorting.
   *
   * @private
   * @param {Function} func The function to modify.
   * @param {Function} string The `toString` result.
   * @returns {Function} Returns `func`.
   */
  var baseSetToString = !defineProperty ? identity : function(func, string) {
    return defineProperty(func, 'toString', {
      'configurable': true,
      'enumerable': false,
      'value': constant(string),
      'writable': true
    });
  };

  /**
   * The base implementation of `_.slice` without an iteratee call guard.
   *
   * @private
   * @param {Array} array The array to slice.
   * @param {number} [start=0] The start position.
   * @param {number} [end=array.length] The end position.
   * @returns {Array} Returns the slice of `array`.
   */
  function baseSlice(array, start, end) {
    var index = -1,
        length = array.length;

    if (start < 0) {
      start = -start > length ? 0 : (length + start);
    }
    end = end > length ? length : end;
    if (end < 0) {
      end += length;
    }
    length = start > end ? 0 : ((end - start) >>> 0);
    start >>>= 0;

    var result = Array(length);
    while (++index < length) {
      result[index] = array[index + start];
    }
    return result;
  }

  /**
   * The base implementation of `_.some` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   */
  function baseSome(collection, predicate) {
    var result;

    baseEach(collection, function(value, index, collection) {
      result = predicate(value, index, collection);
      return !result;
    });
    return !!result;
  }

  /**
   * The base implementation of `_.toString` which doesn't convert nullish
   * values to empty strings.
   *
   * @private
   * @param {*} value The value to process.
   * @returns {string} Returns the string.
   */
  function baseToString(value) {
    // Exit early for strings to avoid a performance hit in some environments.
    if (typeof value == 'string') {
      return value;
    }
    if (isArray(value)) {
      // Recursively convert values (susceptible to call stack limits).
      return arrayMap(value, baseToString) + '';
    }
    if (isSymbol(value)) {
      return symbolToString ? symbolToString.call(value) : '';
    }
    var result = (value + '');
    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;
  }

  /**
   * The base implementation of `_.uniqBy` without support for iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new duplicate free array.
   */
  function baseUniq(array, iteratee, comparator) {
    var index = -1,
        includes = arrayIncludes,
        length = array.length,
        isCommon = true,
        result = [],
        seen = result;

    if (comparator) {
      isCommon = false;
      includes = arrayIncludesWith;
    }
    else if (length >= LARGE_ARRAY_SIZE) {
      var set = iteratee ? null : createSet(array);
      if (set) {
        return setToArray(set);
      }
      isCommon = false;
      includes = cacheHas;
      seen = new SetCache;
    }
    else {
      seen = iteratee ? [] : result;
    }
    outer:
    while (++index < length) {
      var value = array[index],
          computed = iteratee ? iteratee(value) : value;

      value = (comparator || value !== 0) ? value : 0;
      if (isCommon && computed === computed) {
        var seenIndex = seen.length;
        while (seenIndex--) {
          if (seen[seenIndex] === computed) {
            continue outer;
          }
        }
        if (iteratee) {
          seen.push(computed);
        }
        result.push(value);
      }
      else if (!includes(seen, computed, comparator)) {
        if (seen !== result) {
          seen.push(computed);
        }
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.unset`.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {Array|string} path The property path to unset.
   * @returns {boolean} Returns `true` if the property is deleted, else `false`.
   */
  function baseUnset(object, path) {
    path = castPath(path, object);
    object = parent(object, path);
    return object == null || delete object[toKey(last(path))];
  }

  /**
   * The base implementation of `wrapperValue` which returns the result of
   * performing a sequence of actions on the unwrapped `value`, where each
   * successive action is supplied the return value of the previous.
   *
   * @private
   * @param {*} value The unwrapped value.
   * @param {Array} actions Actions to perform to resolve the unwrapped value.
   * @returns {*} Returns the resolved value.
   */
  function baseWrapperValue(value, actions) {
    var result = value;
    if (result instanceof LazyWrapper) {
      result = result.value();
    }
    return arrayReduce(actions, function(result, action) {
      return action.func.apply(action.thisArg, arrayPush([result], action.args));
    }, result);
  }

  /**
   * This base implementation of `_.zipObject` which assigns values using `assignFunc`.
   *
   * @private
   * @param {Array} props The property identifiers.
   * @param {Array} values The property values.
   * @param {Function} assignFunc The function to assign values.
   * @returns {Object} Returns the new object.
   */
  function baseZipObject(props, values, assignFunc) {
    var index = -1,
        length = props.length,
        valsLength = values.length,
        result = {};

    while (++index < length) {
      var value = index < valsLength ? values[index] : undefined;
      assignFunc(result, props[index], value);
    }
    return result;
  }

  /**
   * Casts `value` to an empty array if it's not an array like object.
   *
   * @private
   * @param {*} value The value to inspect.
   * @returns {Array|Object} Returns the cast array-like object.
   */
  function castArrayLikeObject(value) {
    return isArrayLikeObject(value) ? value : [];
  }

  /**
   * Casts `value` to a path array if it's not one.
   *
   * @private
   * @param {*} value The value to inspect.
   * @param {Object} [object] The object to query keys on.
   * @returns {Array} Returns the cast property path array.
   */
  function castPath(value, object) {
    if (isArray(value)) {
      return value;
    }
    return isKey(value, object) ? [value] : stringToPath(toString(value));
  }

  /**
   * Creates a clone of  `buffer`.
   *
   * @private
   * @param {Buffer} buffer The buffer to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Buffer} Returns the cloned buffer.
   */
  function cloneBuffer(buffer, isDeep) {
    if (isDeep) {
      return buffer.slice();
    }
    var length = buffer.length,
        result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length);

    buffer.copy(result);
    return result;
  }

  /**
   * Creates a clone of `arrayBuffer`.
   *
   * @private
   * @param {ArrayBuffer} arrayBuffer The array buffer to clone.
   * @returns {ArrayBuffer} Returns the cloned array buffer.
   */
  function cloneArrayBuffer(arrayBuffer) {
    var result = new arrayBuffer.constructor(arrayBuffer.byteLength);
    new Uint8Array(result).set(new Uint8Array(arrayBuffer));
    return result;
  }

  /**
   * Creates a clone of `dataView`.
   *
   * @private
   * @param {Object} dataView The data view to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the cloned data view.
   */
  function cloneDataView(dataView, isDeep) {
    var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer;
    return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength);
  }

  /**
   * Creates a clone of `regexp`.
   *
   * @private
   * @param {Object} regexp The regexp to clone.
   * @returns {Object} Returns the cloned regexp.
   */
  function cloneRegExp(regexp) {
    var result = new regexp.constructor(regexp.source, reFlags.exec(regexp));
    result.lastIndex = regexp.lastIndex;
    return result;
  }

  /**
   * Creates a clone of the `symbol` object.
   *
   * @private
   * @param {Object} symbol The symbol object to clone.
   * @returns {Object} Returns the cloned symbol object.
   */
  function cloneSymbol(symbol) {
    return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {};
  }

  /**
   * Creates a clone of `typedArray`.
   *
   * @private
   * @param {Object} typedArray The typed array to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the cloned typed array.
   */
  function cloneTypedArray(typedArray, isDeep) {
    var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer;
    return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length);
  }

  /**
   * Compares values to sort them in ascending order.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {number} Returns the sort order indicator for `value`.
   */
  function compareAscending(value, other) {
    if (value !== other) {
      var valIsDefined = value !== undefined,
          valIsNull = value === null,
          valIsReflexive = value === value,
          valIsSymbol = isSymbol(value);

      var othIsDefined = other !== undefined,
          othIsNull = other === null,
          othIsReflexive = other === other,
          othIsSymbol = isSymbol(other);

      if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) ||
          (valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) ||
          (valIsNull && othIsDefined && othIsReflexive) ||
          (!valIsDefined && othIsReflexive) ||
          !valIsReflexive) {
        return 1;
      }
      if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) ||
          (othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) ||
          (othIsNull && valIsDefined && valIsReflexive) ||
          (!othIsDefined && valIsReflexive) ||
          !othIsReflexive) {
        return -1;
      }
    }
    return 0;
  }

  /**
   * Used by `_.orderBy` to compare multiple properties of a value to another
   * and stable sort them.
   *
   * If `orders` is unspecified, all values are sorted in ascending order. Otherwise,
   * specify an order of "desc" for descending or "asc" for ascending sort order
   * of corresponding values.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {boolean[]|string[]} orders The order to sort by for each property.
   * @returns {number} Returns the sort order indicator for `object`.
   */
  function compareMultiple(object, other, orders) {
    var index = -1,
        objCriteria = object.criteria,
        othCriteria = other.criteria,
        length = objCriteria.length,
        ordersLength = orders.length;

    while (++index < length) {
      var result = compareAscending(objCriteria[index], othCriteria[index]);
      if (result) {
        if (index >= ordersLength) {
          return result;
        }
        var order = orders[index];
        return result * (order == 'desc' ? -1 : 1);
      }
    }
    // Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications
    // that causes it, under certain circumstances, to provide the same value for
    // `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247
    // for more details.
    //
    // This also ensures a stable sort in V8 and other engines.
    // See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details.
    return object.index - other.index;
  }

  /**
   * Creates an array that is the composition of partially applied arguments,
   * placeholders, and provided arguments into a single array of arguments.
   *
   * @private
   * @param {Array} args The provided arguments.
   * @param {Array} partials The arguments to prepend to those provided.
   * @param {Array} holders The `partials` placeholder indexes.
   * @params {boolean} [isCurried] Specify composing for a curried function.
   * @returns {Array} Returns the new array of composed arguments.
   */
  function composeArgs(args, partials, holders, isCurried) {
    var argsIndex = -1,
        argsLength = args.length,
        holdersLength = holders.length,
        leftIndex = -1,
        leftLength = partials.length,
        rangeLength = nativeMax(argsLength - holdersLength, 0),
        result = Array(leftLength + rangeLength),
        isUncurried = !isCurried;

    while (++leftIndex < leftLength) {
      result[leftIndex] = partials[leftIndex];
    }
    while (++argsIndex < holdersLength) {
      if (isUncurried || argsIndex < argsLength) {
        result[holders[argsIndex]] = args[argsIndex];
      }
    }
    while (rangeLength--) {
      result[leftIndex++] = args[argsIndex++];
    }
    return result;
  }

  /**
   * This function is like `composeArgs` except that the arguments composition
   * is tailored for `_.partialRight`.
   *
   * @private
   * @param {Array} args The provided arguments.
   * @param {Array} partials The arguments to append to those provided.
   * @param {Array} holders The `partials` placeholder indexes.
   * @params {boolean} [isCurried] Specify composing for a curried function.
   * @returns {Array} Returns the new array of composed arguments.
   */
  function composeArgsRight(args, partials, holders, isCurried) {
    var argsIndex = -1,
        argsLength = args.length,
        holdersIndex = -1,
        holdersLength = holders.length,
        rightIndex = -1,
        rightLength = partials.length,
        rangeLength = nativeMax(argsLength - holdersLength, 0),
        result = Array(rangeLength + rightLength),
        isUncurried = !isCurried;

    while (++argsIndex < rangeLength) {
      result[argsIndex] = args[argsIndex];
    }
    var offset = argsIndex;
    while (++rightIndex < rightLength) {
      result[offset + rightIndex] = partials[rightIndex];
    }
    while (++holdersIndex < holdersLength) {
      if (isUncurried || argsIndex < argsLength) {
        result[offset + holders[holdersIndex]] = args[argsIndex++];
      }
    }
    return result;
  }

  /**
   * Copies the values of `source` to `array`.
   *
   * @private
   * @param {Array} source The array to copy values from.
   * @param {Array} [array=[]] The array to copy values to.
   * @returns {Array} Returns `array`.
   */
  function copyArray(source, array) {
    var index = -1,
        length = source.length;

    array || (array = Array(length));
    while (++index < length) {
      array[index] = source[index];
    }
    return array;
  }

  /**
   * Copies properties of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy properties from.
   * @param {Array} props The property identifiers to copy.
   * @param {Object} [object={}] The object to copy properties to.
   * @param {Function} [customizer] The function to customize copied values.
   * @returns {Object} Returns `object`.
   */
  function copyObject(source, props, object, customizer) {
    var isNew = !object;
    object || (object = {});

    var index = -1,
        length = props.length;

    while (++index < length) {
      var key = props[index];

      var newValue = customizer
        ? customizer(object[key], source[key], key, object, source)
        : undefined;

      if (newValue === undefined) {
        newValue = source[key];
      }
      if (isNew) {
        baseAssignValue(object, key, newValue);
      } else {
        assignValue(object, key, newValue);
      }
    }
    return object;
  }

  /**
   * Copies own symbols of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy symbols from.
   * @param {Object} [object={}] The object to copy symbols to.
   * @returns {Object} Returns `object`.
   */
  function copySymbols(source, object) {
    return copyObject(source, getSymbols(source), object);
  }

  /**
   * Copies own and inherited symbols of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy symbols from.
   * @param {Object} [object={}] The object to copy symbols to.
   * @returns {Object} Returns `object`.
   */
  function copySymbolsIn(source, object) {
    return copyObject(source, getSymbolsIn(source), object);
  }

  /**
   * Creates a function like `_.groupBy`.
   *
   * @private
   * @param {Function} setter The function to set accumulator values.
   * @param {Function} [initializer] The accumulator object initializer.
   * @returns {Function} Returns the new aggregator function.
   */
  function createAggregator(setter, initializer) {
    return function(collection, iteratee) {
      var func = isArray(collection) ? arrayAggregator : baseAggregator,
          accumulator = initializer ? initializer() : {};

      return func(collection, setter, baseIteratee(iteratee, 2), accumulator);
    };
  }

  /**
   * Creates a function like `_.assign`.
   *
   * @private
   * @param {Function} assigner The function to assign values.
   * @returns {Function} Returns the new assigner function.
   */
  function createAssigner(assigner) {
    return baseRest(function(object, sources) {
      var index = -1,
          length = sources.length,
          customizer = length > 1 ? sources[length - 1] : undefined,
          guard = length > 2 ? sources[2] : undefined;

      customizer = (assigner.length > 3 && typeof customizer == 'function')
        ? (length--, customizer)
        : undefined;

      if (guard && isIterateeCall(sources[0], sources[1], guard)) {
        customizer = length < 3 ? undefined : customizer;
        length = 1;
      }
      object = Object(object);
      while (++index < length) {
        var source = sources[index];
        if (source) {
          assigner(object, source, index, customizer);
        }
      }
      return object;
    });
  }

  /**
   * Creates a `baseEach` or `baseEachRight` function.
   *
   * @private
   * @param {Function} eachFunc The function to iterate over a collection.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new base function.
   */
  function createBaseEach(eachFunc, fromRight) {
    return function(collection, iteratee) {
      if (collection == null) {
        return collection;
      }
      if (!isArrayLike(collection)) {
        return eachFunc(collection, iteratee);
      }
      var length = collection.length,
          index = fromRight ? length : -1,
          iterable = Object(collection);

      while ((fromRight ? index-- : ++index < length)) {
        if (iteratee(iterable[index], index, iterable) === false) {
          break;
        }
      }
      return collection;
    };
  }

  /**
   * Creates a base function for methods like `_.forIn` and `_.forOwn`.
   *
   * @private
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new base function.
   */
  function createBaseFor(fromRight) {
    return function(object, iteratee, keysFunc) {
      var index = -1,
          iterable = Object(object),
          props = keysFunc(object),
          length = props.length;

      while (length--) {
        var key = props[fromRight ? length : ++index];
        if (iteratee(iterable[key], key, iterable) === false) {
          break;
        }
      }
      return object;
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with the optional `this`
   * binding of `thisArg`.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createBind(func, bitmask, thisArg) {
    var isBind = bitmask & WRAP_BIND_FLAG,
        Ctor = createCtor(func);

    function wrapper() {
      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;
      return fn.apply(isBind ? thisArg : this, arguments);
    }
    return wrapper;
  }

  /**
   * Creates a function that produces an instance of `Ctor` regardless of
   * whether it was invoked as part of a `new` expression or by `call` or `apply`.
   *
   * @private
   * @param {Function} Ctor The constructor to wrap.
   * @returns {Function} Returns the new wrapped function.
   */
  function createCtor(Ctor) {
    return function() {
      // Use a `switch` statement to work with class constructors. See
      // http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist
      // for more details.
      var args = arguments;
      switch (args.length) {
        case 0: return new Ctor;
        case 1: return new Ctor(args[0]);
        case 2: return new Ctor(args[0], args[1]);
        case 3: return new Ctor(args[0], args[1], args[2]);
        case 4: return new Ctor(args[0], args[1], args[2], args[3]);
        case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]);
        case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]);
        case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
      }
      var thisBinding = baseCreate(Ctor.prototype),
          result = Ctor.apply(thisBinding, args);

      // Mimic the constructor's `return` behavior.
      // See https://es5.github.io/#x13.2.2 for more details.
      return isObject(result) ? result : thisBinding;
    };
  }

  /**
   * Creates a function that wraps `func` to enable currying.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {number} arity The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createCurry(func, bitmask, arity) {
    var Ctor = createCtor(func);

    function wrapper() {
      var length = arguments.length,
          args = Array(length),
          index = length,
          placeholder = getHolder(wrapper);

      while (index--) {
        args[index] = arguments[index];
      }
      var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder)
        ? []
        : replaceHolders(args, placeholder);

      length -= holders.length;
      if (length < arity) {
        return createRecurry(
          func, bitmask, createHybrid, wrapper.placeholder, undefined,
          args, holders, undefined, undefined, arity - length);
      }
      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;
      return apply(fn, this, args);
    }
    return wrapper;
  }

  /**
   * Creates a `_.find` or `_.findLast` function.
   *
   * @private
   * @param {Function} findIndexFunc The function to find the collection index.
   * @returns {Function} Returns the new find function.
   */
  function createFind(findIndexFunc) {
    return function(collection, predicate, fromIndex) {
      var iterable = Object(collection);
      if (!isArrayLike(collection)) {
        var iteratee = baseIteratee(predicate, 3);
        collection = keys(collection);
        predicate = function(key) { return iteratee(iterable[key], key, iterable); };
      }
      var index = findIndexFunc(collection, predicate, fromIndex);
      return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined;
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with optional `this`
   * binding of `thisArg`, partial application, and currying.
   *
   * @private
   * @param {Function|string} func The function or method name to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to prepend to those provided to
   *  the new function.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [partialsRight] The arguments to append to those provided
   *  to the new function.
   * @param {Array} [holdersRight] The `partialsRight` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) {
    var isAry = bitmask & WRAP_ARY_FLAG,
        isBind = bitmask & WRAP_BIND_FLAG,
        isBindKey = bitmask & WRAP_BIND_KEY_FLAG,
        isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG),
        isFlip = bitmask & WRAP_FLIP_FLAG,
        Ctor = isBindKey ? undefined : createCtor(func);

    function wrapper() {
      var length = arguments.length,
          args = Array(length),
          index = length;

      while (index--) {
        args[index] = arguments[index];
      }
      if (isCurried) {
        var placeholder = getHolder(wrapper),
            holdersCount = countHolders(args, placeholder);
      }
      if (partials) {
        args = composeArgs(args, partials, holders, isCurried);
      }
      if (partialsRight) {
        args = composeArgsRight(args, partialsRight, holdersRight, isCurried);
      }
      length -= holdersCount;
      if (isCurried && length < arity) {
        var newHolders = replaceHolders(args, placeholder);
        return createRecurry(
          func, bitmask, createHybrid, wrapper.placeholder, thisArg,
          args, newHolders, argPos, ary, arity - length
        );
      }
      var thisBinding = isBind ? thisArg : this,
          fn = isBindKey ? thisBinding[func] : func;

      length = args.length;
      if (argPos) {
        args = reorder(args, argPos);
      } else if (isFlip && length > 1) {
        args.reverse();
      }
      if (isAry && ary < length) {
        args.length = ary;
      }
      if (this && this !== root && this instanceof wrapper) {
        fn = Ctor || createCtor(fn);
      }
      return fn.apply(thisBinding, args);
    }
    return wrapper;
  }

  /**
   * Creates a function like `_.invertBy`.
   *
   * @private
   * @param {Function} setter The function to set accumulator values.
   * @param {Function} toIteratee The function to resolve iteratees.
   * @returns {Function} Returns the new inverter function.
   */
  function createInverter(setter, toIteratee) {
    return function(object, iteratee) {
      return baseInverter(object, setter, toIteratee(iteratee), {});
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with the `this` binding
   * of `thisArg` and `partials` prepended to the arguments it receives.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {Array} partials The arguments to prepend to those provided to
   *  the new function.
   * @returns {Function} Returns the new wrapped function.
   */
  function createPartial(func, bitmask, thisArg, partials) {
    var isBind = bitmask & WRAP_BIND_FLAG,
        Ctor = createCtor(func);

    function wrapper() {
      var argsIndex = -1,
          argsLength = arguments.length,
          leftIndex = -1,
          leftLength = partials.length,
          args = Array(leftLength + argsLength),
          fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;

      while (++leftIndex < leftLength) {
        args[leftIndex] = partials[leftIndex];
      }
      while (argsLength--) {
        args[leftIndex++] = arguments[++argsIndex];
      }
      return apply(fn, isBind ? thisArg : this, args);
    }
    return wrapper;
  }

  /**
   * Creates a `_.range` or `_.rangeRight` function.
   *
   * @private
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new range function.
   */
  function createRange(fromRight) {
    return function(start, end, step) {
      if (step && typeof step != 'number' && isIterateeCall(start, end, step)) {
        end = step = undefined;
      }
      // Ensure the sign of `-0` is preserved.
      start = toFinite(start);
      if (end === undefined) {
        end = start;
        start = 0;
      } else {
        end = toFinite(end);
      }
      step = step === undefined ? (start < end ? 1 : -1) : toFinite(step);
      return baseRange(start, end, step, fromRight);
    };
  }

  /**
   * Creates a function that wraps `func` to continue currying.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {Function} wrapFunc The function to create the `func` wrapper.
   * @param {*} placeholder The placeholder value.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to prepend to those provided to
   *  the new function.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) {
    var isCurry = bitmask & WRAP_CURRY_FLAG,
        newHolders = isCurry ? holders : undefined,
        newHoldersRight = isCurry ? undefined : holders,
        newPartials = isCurry ? partials : undefined,
        newPartialsRight = isCurry ? undefined : partials;

    bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG);
    bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG);

    if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) {
      bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG);
    }
    var newData = [
      func, bitmask, thisArg, newPartials, newHolders, newPartialsRight,
      newHoldersRight, argPos, ary, arity
    ];

    var result = wrapFunc.apply(undefined, newData);
    if (isLaziable(func)) {
      setData(result, newData);
    }
    result.placeholder = placeholder;
    return setWrapToString(result, func, bitmask);
  }

  /**
   * Creates a set object of `values`.
   *
   * @private
   * @param {Array} values The values to add to the set.
   * @returns {Object} Returns the new set.
   */
  var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) {
    return new Set(values);
  };

  /**
   * Creates a function that either curries or invokes `func` with optional
   * `this` binding and partially applied arguments.
   *
   * @private
   * @param {Function|string} func The function or method name to wrap.
   * @param {number} bitmask The bitmask flags.
   *    1 - `_.bind`
   *    2 - `_.bindKey`
   *    4 - `_.curry` or `_.curryRight` of a bound function
   *    8 - `_.curry`
   *   16 - `_.curryRight`
   *   32 - `_.partial`
   *   64 - `_.partialRight`
   *  128 - `_.rearg`
   *  256 - `_.ary`
   *  512 - `_.flip`
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to be partially applied.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) {
    var isBindKey = bitmask & WRAP_BIND_KEY_FLAG;
    if (!isBindKey && typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    var length = partials ? partials.length : 0;
    if (!length) {
      bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG);
      partials = holders = undefined;
    }
    ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0);
    arity = arity === undefined ? arity : toInteger(arity);
    length -= holders ? holders.length : 0;

    if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) {
      var partialsRight = partials,
          holdersRight = holders;

      partials = holders = undefined;
    }
    var data = isBindKey ? undefined : getData(func);

    var newData = [
      func, bitmask, thisArg, partials, holders, partialsRight, holdersRight,
      argPos, ary, arity
    ];

    if (data) {
      mergeData(newData, data);
    }
    func = newData[0];
    bitmask = newData[1];
    thisArg = newData[2];
    partials = newData[3];
    holders = newData[4];
    arity = newData[9] = newData[9] === undefined
      ? (isBindKey ? 0 : func.length)
      : nativeMax(newData[9] - length, 0);

    if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) {
      bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG);
    }
    if (!bitmask || bitmask == WRAP_BIND_FLAG) {
      var result = createBind(func, bitmask, thisArg);
    } else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) {
      result = createCurry(func, bitmask, arity);
    } else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) {
      result = createPartial(func, bitmask, thisArg, partials);
    } else {
      result = createHybrid.apply(undefined, newData);
    }
    var setter = data ? baseSetData : setData;
    return setWrapToString(setter(result, newData), func, bitmask);
  }

  /**
   * Used by `_.defaultsDeep` to customize its `_.merge` use to merge source
   * objects into destination objects that are passed thru.
   *
   * @private
   * @param {*} objValue The destination value.
   * @param {*} srcValue The source value.
   * @param {string} key The key of the property to merge.
   * @param {Object} object The parent object of `objValue`.
   * @param {Object} source The parent object of `srcValue`.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   * @returns {*} Returns the value to assign.
   */
  function customDefaultsMerge(objValue, srcValue, key, object, source, stack) {
    if (isObject(objValue) && isObject(srcValue)) {
      // Recursively merge objects and arrays (susceptible to call stack limits).
      stack.set(srcValue, objValue);
      baseMerge(objValue, srcValue, undefined, customDefaultsMerge, stack);
      stack['delete'](srcValue);
    }
    return objValue;
  }

  /**
   * Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain
   * objects.
   *
   * @private
   * @param {*} value The value to inspect.
   * @param {string} key The key of the property to inspect.
   * @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`.
   */
  function customOmitClone(value) {
    return isPlainObject(value) ? undefined : value;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for arrays with support for
   * partial deep comparisons.
   *
   * @private
   * @param {Array} array The array to compare.
   * @param {Array} other The other array to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `array` and `other` objects.
   * @returns {boolean} Returns `true` if the arrays are equivalent, else `false`.
   */
  function equalArrays(array, other, bitmask, customizer, equalFunc, stack) {
    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,
        arrLength = array.length,
        othLength = other.length;

    if (arrLength != othLength && !(isPartial && othLength > arrLength)) {
      return false;
    }
    // Assume cyclic values are equal.
    var stacked = stack.get(array);
    if (stacked && stack.get(other)) {
      return stacked == other;
    }
    var index = -1,
        result = true,
        seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined;

    stack.set(array, other);
    stack.set(other, array);

    // Ignore non-index properties.
    while (++index < arrLength) {
      var arrValue = array[index],
          othValue = other[index];

      if (customizer) {
        var compared = isPartial
          ? customizer(othValue, arrValue, index, other, array, stack)
          : customizer(arrValue, othValue, index, array, other, stack);
      }
      if (compared !== undefined) {
        if (compared) {
          continue;
        }
        result = false;
        break;
      }
      // Recursively compare arrays (susceptible to call stack limits).
      if (seen) {
        if (!arraySome(other, function(othValue, othIndex) {
              if (!cacheHas(seen, othIndex) &&
                  (arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) {
                return seen.push(othIndex);
              }
            })) {
          result = false;
          break;
        }
      } else if (!(
            arrValue === othValue ||
              equalFunc(arrValue, othValue, bitmask, customizer, stack)
          )) {
        result = false;
        break;
      }
    }
    stack['delete'](array);
    stack['delete'](other);
    return result;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for comparing objects of
   * the same `toStringTag`.
   *
   * **Note:** This function only supports comparing values with tags of
   * `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {string} tag The `toStringTag` of the objects to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) {
    switch (tag) {
      case dataViewTag:
        if ((object.byteLength != other.byteLength) ||
            (object.byteOffset != other.byteOffset)) {
          return false;
        }
        object = object.buffer;
        other = other.buffer;

      case arrayBufferTag:
        if ((object.byteLength != other.byteLength) ||
            !equalFunc(new Uint8Array(object), new Uint8Array(other))) {
          return false;
        }
        return true;

      case boolTag:
      case dateTag:
      case numberTag:
        // Coerce booleans to `1` or `0` and dates to milliseconds.
        // Invalid dates are coerced to `NaN`.
        return eq(+object, +other);

      case errorTag:
        return object.name == other.name && object.message == other.message;

      case regexpTag:
      case stringTag:
        // Coerce regexes to strings and treat strings, primitives and objects,
        // as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring
        // for more details.
        return object == (other + '');

      case mapTag:
        var convert = mapToArray;

      case setTag:
        var isPartial = bitmask & COMPARE_PARTIAL_FLAG;
        convert || (convert = setToArray);

        if (object.size != other.size && !isPartial) {
          return false;
        }
        // Assume cyclic values are equal.
        var stacked = stack.get(object);
        if (stacked) {
          return stacked == other;
        }
        bitmask |= COMPARE_UNORDERED_FLAG;

        // Recursively compare objects (susceptible to call stack limits).
        stack.set(object, other);
        var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack);
        stack['delete'](object);
        return result;

      case symbolTag:
        if (symbolValueOf) {
          return symbolValueOf.call(object) == symbolValueOf.call(other);
        }
    }
    return false;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for objects with support for
   * partial deep comparisons.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function equalObjects(object, other, bitmask, customizer, equalFunc, stack) {
    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,
        objProps = getAllKeys(object),
        objLength = objProps.length,
        othProps = getAllKeys(other),
        othLength = othProps.length;

    if (objLength != othLength && !isPartial) {
      return false;
    }
    var index = objLength;
    while (index--) {
      var key = objProps[index];
      if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) {
        return false;
      }
    }
    // Assume cyclic values are equal.
    var stacked = stack.get(object);
    if (stacked && stack.get(other)) {
      return stacked == other;
    }
    var result = true;
    stack.set(object, other);
    stack.set(other, object);

    var skipCtor = isPartial;
    while (++index < objLength) {
      key = objProps[index];
      var objValue = object[key],
          othValue = other[key];

      if (customizer) {
        var compared = isPartial
          ? customizer(othValue, objValue, key, other, object, stack)
          : customizer(objValue, othValue, key, object, other, stack);
      }
      // Recursively compare objects (susceptible to call stack limits).
      if (!(compared === undefined
            ? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack))
            : compared
          )) {
        result = false;
        break;
      }
      skipCtor || (skipCtor = key == 'constructor');
    }
    if (result && !skipCtor) {
      var objCtor = object.constructor,
          othCtor = other.constructor;

      // Non `Object` object instances with different constructors are not equal.
      if (objCtor != othCtor &&
          ('constructor' in object && 'constructor' in other) &&
          !(typeof objCtor == 'function' && objCtor instanceof objCtor &&
            typeof othCtor == 'function' && othCtor instanceof othCtor)) {
        result = false;
      }
    }
    stack['delete'](object);
    stack['delete'](other);
    return result;
  }

  /**
   * A specialized version of `baseRest` which flattens the rest array.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @returns {Function} Returns the new function.
   */
  function flatRest(func) {
    return setToString(overRest(func, undefined, flatten), func + '');
  }

  /**
   * Creates an array of own enumerable property names and symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function getAllKeys(object) {
    return baseGetAllKeys(object, keys, getSymbols);
  }

  /**
   * Creates an array of own and inherited enumerable property names and
   * symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function getAllKeysIn(object) {
    return baseGetAllKeys(object, keysIn, getSymbolsIn);
  }

  /**
   * Gets metadata for `func`.
   *
   * @private
   * @param {Function} func The function to query.
   * @returns {*} Returns the metadata for `func`.
   */
  var getData = !metaMap ? noop : function(func) {
    return metaMap.get(func);
  };

  /**
   * Gets the name of `func`.
   *
   * @private
   * @param {Function} func The function to query.
   * @returns {string} Returns the function name.
   */
  function getFuncName(func) {
    var result = (func.name + ''),
        array = realNames[result],
        length = hasOwnProperty.call(realNames, result) ? array.length : 0;

    while (length--) {
      var data = array[length],
          otherFunc = data.func;
      if (otherFunc == null || otherFunc == func) {
        return data.name;
      }
    }
    return result;
  }

  /**
   * Gets the argument placeholder value for `func`.
   *
   * @private
   * @param {Function} func The function to inspect.
   * @returns {*} Returns the placeholder value.
   */
  function getHolder(func) {
    var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func;
    return object.placeholder;
  }

  /**
   * Gets the data for `map`.
   *
   * @private
   * @param {Object} map The map to query.
   * @param {string} key The reference key.
   * @returns {*} Returns the map data.
   */
  function getMapData(map, key) {
    var data = map.__data__;
    return isKeyable(key)
      ? data[typeof key == 'string' ? 'string' : 'hash']
      : data.map;
  }

  /**
   * Gets the property names, values, and compare flags of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the match data of `object`.
   */
  function getMatchData(object) {
    var result = keys(object),
        length = result.length;

    while (length--) {
      var key = result[length],
          value = object[key];

      result[length] = [key, value, isStrictComparable(value)];
    }
    return result;
  }

  /**
   * Gets the native function at `key` of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {string} key The key of the method to get.
   * @returns {*} Returns the function if it's native, else `undefined`.
   */
  function getNative(object, key) {
    var value = getValue(object, key);
    return baseIsNative(value) ? value : undefined;
  }

  /**
   * A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the raw `toStringTag`.
   */
  function getRawTag(value) {
    var isOwn = hasOwnProperty.call(value, symToStringTag),
        tag = value[symToStringTag];

    try {
      value[symToStringTag] = undefined;
      var unmasked = true;
    } catch (e) {}

    var result = nativeObjectToString.call(value);
    if (unmasked) {
      if (isOwn) {
        value[symToStringTag] = tag;
      } else {
        delete value[symToStringTag];
      }
    }
    return result;
  }

  /**
   * Creates an array of the own enumerable symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of symbols.
   */
  var getSymbols = !nativeGetSymbols ? stubArray : function(object) {
    if (object == null) {
      return [];
    }
    object = Object(object);
    return arrayFilter(nativeGetSymbols(object), function(symbol) {
      return propertyIsEnumerable.call(object, symbol);
    });
  };

  /**
   * Creates an array of the own and inherited enumerable symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of symbols.
   */
  var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) {
    var result = [];
    while (object) {
      arrayPush(result, getSymbols(object));
      object = getPrototype(object);
    }
    return result;
  };

  /**
   * Gets the `toStringTag` of `value`.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the `toStringTag`.
   */
  var getTag = baseGetTag;

  // Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6.
  if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) ||
      (Map && getTag(new Map) != mapTag) ||
      (Promise && getTag(Promise.resolve()) != promiseTag) ||
      (Set && getTag(new Set) != setTag) ||
      (WeakMap && getTag(new WeakMap) != weakMapTag)) {
    getTag = function(value) {
      var result = baseGetTag(value),
          Ctor = result == objectTag ? value.constructor : undefined,
          ctorString = Ctor ? toSource(Ctor) : '';

      if (ctorString) {
        switch (ctorString) {
          case dataViewCtorString: return dataViewTag;
          case mapCtorString: return mapTag;
          case promiseCtorString: return promiseTag;
          case setCtorString: return setTag;
          case weakMapCtorString: return weakMapTag;
        }
      }
      return result;
    };
  }

  /**
   * Gets the view, applying any `transforms` to the `start` and `end` positions.
   *
   * @private
   * @param {number} start The start of the view.
   * @param {number} end The end of the view.
   * @param {Array} transforms The transformations to apply to the view.
   * @returns {Object} Returns an object containing the `start` and `end`
   *  positions of the view.
   */
  function getView(start, end, transforms) {
    var index = -1,
        length = transforms.length;

    while (++index < length) {
      var data = transforms[index],
          size = data.size;

      switch (data.type) {
        case 'drop':      start += size; break;
        case 'dropRight': end -= size; break;
        case 'take':      end = nativeMin(end, start + size); break;
        case 'takeRight': start = nativeMax(start, end - size); break;
      }
    }
    return { 'start': start, 'end': end };
  }

  /**
   * Extracts wrapper details from the `source` body comment.
   *
   * @private
   * @param {string} source The source to inspect.
   * @returns {Array} Returns the wrapper details.
   */
  function getWrapDetails(source) {
    var match = source.match(reWrapDetails);
    return match ? match[1].split(reSplitDetails) : [];
  }

  /**
   * Checks if `path` exists on `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @param {Function} hasFunc The function to check properties.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   */
  function hasPath(object, path, hasFunc) {
    path = castPath(path, object);

    var index = -1,
        length = path.length,
        result = false;

    while (++index < length) {
      var key = toKey(path[index]);
      if (!(result = object != null && hasFunc(object, key))) {
        break;
      }
      object = object[key];
    }
    if (result || ++index != length) {
      return result;
    }
    length = object == null ? 0 : object.length;
    return !!length && isLength(length) && isIndex(key, length) &&
      (isArray(object) || isArguments(object));
  }

  /**
   * Initializes an array clone.
   *
   * @private
   * @param {Array} array The array to clone.
   * @returns {Array} Returns the initialized clone.
   */
  function initCloneArray(array) {
    var length = array.length,
        result = new array.constructor(length);

    // Add properties assigned by `RegExp#exec`.
    if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) {
      result.index = array.index;
      result.input = array.input;
    }
    return result;
  }

  /**
   * Initializes an object clone.
   *
   * @private
   * @param {Object} object The object to clone.
   * @returns {Object} Returns the initialized clone.
   */
  function initCloneObject(object) {
    return (typeof object.constructor == 'function' && !isPrototype(object))
      ? baseCreate(getPrototype(object))
      : {};
  }

  /**
   * Initializes an object clone based on its `toStringTag`.
   *
   * **Note:** This function only supports cloning values with tags of
   * `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`.
   *
   * @private
   * @param {Object} object The object to clone.
   * @param {string} tag The `toStringTag` of the object to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the initialized clone.
   */
  function initCloneByTag(object, tag, isDeep) {
    var Ctor = object.constructor;
    switch (tag) {
      case arrayBufferTag:
        return cloneArrayBuffer(object);

      case boolTag:
      case dateTag:
        return new Ctor(+object);

      case dataViewTag:
        return cloneDataView(object, isDeep);

      case float32Tag: case float64Tag:
      case int8Tag: case int16Tag: case int32Tag:
      case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag:
        return cloneTypedArray(object, isDeep);

      case mapTag:
        return new Ctor;

      case numberTag:
      case stringTag:
        return new Ctor(object);

      case regexpTag:
        return cloneRegExp(object);

      case setTag:
        return new Ctor;

      case symbolTag:
        return cloneSymbol(object);
    }
  }

  /**
   * Inserts wrapper `details` in a comment at the top of the `source` body.
   *
   * @private
   * @param {string} source The source to modify.
   * @returns {Array} details The details to insert.
   * @returns {string} Returns the modified source.
   */
  function insertWrapDetails(source, details) {
    var length = details.length;
    if (!length) {
      return source;
    }
    var lastIndex = length - 1;
    details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex];
    details = details.join(length > 2 ? ', ' : ' ');
    return source.replace(reWrapComment, '{\n/* [wrapped with ' + details + '] */\n');
  }

  /**
   * Checks if `value` is a flattenable `arguments` object or array.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is flattenable, else `false`.
   */
  function isFlattenable(value) {
    return isArray(value) || isArguments(value) ||
      !!(spreadableSymbol && value && value[spreadableSymbol]);
  }

  /**
   * Checks if `value` is a valid array-like index.
   *
   * @private
   * @param {*} value The value to check.
   * @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index.
   * @returns {boolean} Returns `true` if `value` is a valid index, else `false`.
   */
  function isIndex(value, length) {
    var type = typeof value;
    length = length == null ? MAX_SAFE_INTEGER : length;

    return !!length &&
      (type == 'number' ||
        (type != 'symbol' && reIsUint.test(value))) &&
          (value > -1 && value % 1 == 0 && value < length);
  }

  /**
   * Checks if the given arguments are from an iteratee call.
   *
   * @private
   * @param {*} value The potential iteratee value argument.
   * @param {*} index The potential iteratee index or key argument.
   * @param {*} object The potential iteratee object argument.
   * @returns {boolean} Returns `true` if the arguments are from an iteratee call,
   *  else `false`.
   */
  function isIterateeCall(value, index, object) {
    if (!isObject(object)) {
      return false;
    }
    var type = typeof index;
    if (type == 'number'
          ? (isArrayLike(object) && isIndex(index, object.length))
          : (type == 'string' && index in object)
        ) {
      return eq(object[index], value);
    }
    return false;
  }

  /**
   * Checks if `value` is a property name and not a property path.
   *
   * @private
   * @param {*} value The value to check.
   * @param {Object} [object] The object to query keys on.
   * @returns {boolean} Returns `true` if `value` is a property name, else `false`.
   */
  function isKey(value, object) {
    if (isArray(value)) {
      return false;
    }
    var type = typeof value;
    if (type == 'number' || type == 'symbol' || type == 'boolean' ||
        value == null || isSymbol(value)) {
      return true;
    }
    return reIsPlainProp.test(value) || !reIsDeepProp.test(value) ||
      (object != null && value in Object(object));
  }

  /**
   * Checks if `value` is suitable for use as unique object key.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is suitable, else `false`.
   */
  function isKeyable(value) {
    var type = typeof value;
    return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean')
      ? (value !== '__proto__')
      : (value === null);
  }

  /**
   * Checks if `func` has a lazy counterpart.
   *
   * @private
   * @param {Function} func The function to check.
   * @returns {boolean} Returns `true` if `func` has a lazy counterpart,
   *  else `false`.
   */
  function isLaziable(func) {
    var funcName = getFuncName(func),
        other = lodash[funcName];

    if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) {
      return false;
    }
    if (func === other) {
      return true;
    }
    var data = getData(other);
    return !!data && func === data[0];
  }

  /**
   * Checks if `func` has its source masked.
   *
   * @private
   * @param {Function} func The function to check.
   * @returns {boolean} Returns `true` if `func` is masked, else `false`.
   */
  function isMasked(func) {
    return !!maskSrcKey && (maskSrcKey in func);
  }

  /**
   * Checks if `value` is likely a prototype object.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a prototype, else `false`.
   */
  function isPrototype(value) {
    var Ctor = value && value.constructor,
        proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto;

    return value === proto;
  }

  /**
   * Checks if `value` is suitable for strict equality comparisons, i.e. `===`.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` if suitable for strict
   *  equality comparisons, else `false`.
   */
  function isStrictComparable(value) {
    return value === value && !isObject(value);
  }

  /**
   * A specialized version of `matchesProperty` for source values suitable
   * for strict equality comparisons, i.e. `===`.
   *
   * @private
   * @param {string} key The key of the property to get.
   * @param {*} srcValue The value to match.
   * @returns {Function} Returns the new spec function.
   */
  function matchesStrictComparable(key, srcValue) {
    return function(object) {
      if (object == null) {
        return false;
      }
      return object[key] === srcValue &&
        (srcValue !== undefined || (key in Object(object)));
    };
  }

  /**
   * A specialized version of `_.memoize` which clears the memoized function's
   * cache when it exceeds `MAX_MEMOIZE_SIZE`.
   *
   * @private
   * @param {Function} func The function to have its output memoized.
   * @returns {Function} Returns the new memoized function.
   */
  function memoizeCapped(func) {
    var result = memoize(func, function(key) {
      if (cache.size === MAX_MEMOIZE_SIZE) {
        cache.clear();
      }
      return key;
    });

    var cache = result.cache;
    return result;
  }

  /**
   * Merges the function metadata of `source` into `data`.
   *
   * Merging metadata reduces the number of wrappers used to invoke a function.
   * This is possible because methods like `_.bind`, `_.curry`, and `_.partial`
   * may be applied regardless of execution order. Methods like `_.ary` and
   * `_.rearg` modify function arguments, making the order in which they are
   * executed important, preventing the merging of metadata. However, we make
   * an exception for a safe combined case where curried functions have `_.ary`
   * and or `_.rearg` applied.
   *
   * @private
   * @param {Array} data The destination metadata.
   * @param {Array} source The source metadata.
   * @returns {Array} Returns `data`.
   */
  function mergeData(data, source) {
    var bitmask = data[1],
        srcBitmask = source[1],
        newBitmask = bitmask | srcBitmask,
        isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG);

    var isCombo =
      ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) ||
      ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) ||
      ((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG));

    // Exit early if metadata can't be merged.
    if (!(isCommon || isCombo)) {
      return data;
    }
    // Use source `thisArg` if available.
    if (srcBitmask & WRAP_BIND_FLAG) {
      data[2] = source[2];
      // Set when currying a bound function.
      newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG;
    }
    // Compose partial arguments.
    var value = source[3];
    if (value) {
      var partials = data[3];
      data[3] = partials ? composeArgs(partials, value, source[4]) : value;
      data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4];
    }
    // Compose partial right arguments.
    value = source[5];
    if (value) {
      partials = data[5];
      data[5] = partials ? composeArgsRight(partials, value, source[6]) : value;
      data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6];
    }
    // Use source `argPos` if available.
    value = source[7];
    if (value) {
      data[7] = value;
    }
    // Use source `ary` if it's smaller.
    if (srcBitmask & WRAP_ARY_FLAG) {
      data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]);
    }
    // Use source `arity` if one is not provided.
    if (data[9] == null) {
      data[9] = source[9];
    }
    // Use source `func` and merge bitmasks.
    data[0] = source[0];
    data[1] = newBitmask;

    return data;
  }

  /**
   * This function is like
   * [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)
   * except that it includes inherited enumerable properties.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function nativeKeysIn(object) {
    var result = [];
    if (object != null) {
      for (var key in Object(object)) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * Converts `value` to a string using `Object.prototype.toString`.
   *
   * @private
   * @param {*} value The value to convert.
   * @returns {string} Returns the converted string.
   */
  function objectToString(value) {
    return nativeObjectToString.call(value);
  }

  /**
   * A specialized version of `baseRest` which transforms the rest array.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @param {Function} transform The rest array transform.
   * @returns {Function} Returns the new function.
   */
  function overRest(func, start, transform) {
    start = nativeMax(start === undefined ? (func.length - 1) : start, 0);
    return function() {
      var args = arguments,
          index = -1,
          length = nativeMax(args.length - start, 0),
          array = Array(length);

      while (++index < length) {
        array[index] = args[start + index];
      }
      index = -1;
      var otherArgs = Array(start + 1);
      while (++index < start) {
        otherArgs[index] = args[index];
      }
      otherArgs[start] = transform(array);
      return apply(func, this, otherArgs);
    };
  }

  /**
   * Gets the parent value at `path` of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array} path The path to get the parent value of.
   * @returns {*} Returns the parent value.
   */
  function parent(object, path) {
    return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1));
  }

  /**
   * Reorder `array` according to the specified indexes where the element at
   * the first index is assigned as the first element, the element at
   * the second index is assigned as the second element, and so on.
   *
   * @private
   * @param {Array} array The array to reorder.
   * @param {Array} indexes The arranged array indexes.
   * @returns {Array} Returns `array`.
   */
  function reorder(array, indexes) {
    var arrLength = array.length,
        length = nativeMin(indexes.length, arrLength),
        oldArray = copyArray(array);

    while (length--) {
      var index = indexes[length];
      array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined;
    }
    return array;
  }

  /**
   * Sets metadata for `func`.
   *
   * **Note:** If this function becomes hot, i.e. is invoked a lot in a short
   * period of time, it will trip its breaker and transition to an identity
   * function to avoid garbage collection pauses in V8. See
   * [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070)
   * for more details.
   *
   * @private
   * @param {Function} func The function to associate metadata with.
   * @param {*} data The metadata.
   * @returns {Function} Returns `func`.
   */
  var setData = shortOut(baseSetData);

  /**
   * Sets the `toString` method of `func` to return `string`.
   *
   * @private
   * @param {Function} func The function to modify.
   * @param {Function} string The `toString` result.
   * @returns {Function} Returns `func`.
   */
  var setToString = shortOut(baseSetToString);

  /**
   * Sets the `toString` method of `wrapper` to mimic the source of `reference`
   * with wrapper details in a comment at the top of the source body.
   *
   * @private
   * @param {Function} wrapper The function to modify.
   * @param {Function} reference The reference function.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @returns {Function} Returns `wrapper`.
   */
  function setWrapToString(wrapper, reference, bitmask) {
    var source = (reference + '');
    return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask)));
  }

  /**
   * Creates a function that'll short out and invoke `identity` instead
   * of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN`
   * milliseconds.
   *
   * @private
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new shortable function.
   */
  function shortOut(func) {
    var count = 0,
        lastCalled = 0;

    return function() {
      var stamp = nativeNow(),
          remaining = HOT_SPAN - (stamp - lastCalled);

      lastCalled = stamp;
      if (remaining > 0) {
        if (++count >= HOT_COUNT) {
          return arguments[0];
        }
      } else {
        count = 0;
      }
      return func.apply(undefined, arguments);
    };
  }

  /**
   * Converts `string` to a property path array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the property path array.
   */
  var stringToPath = memoizeCapped(function(string) {
    var result = [];
    if (string.charCodeAt(0) === 46 /* . */) {
      result.push('');
    }
    string.replace(rePropName, function(match, number, quote, subString) {
      result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match));
    });
    return result;
  });

  /**
   * Converts `value` to a string key if it's not a string or symbol.
   *
   * @private
   * @param {*} value The value to inspect.
   * @returns {string|symbol} Returns the key.
   */
  function toKey(value) {
    if (typeof value == 'string' || isSymbol(value)) {
      return value;
    }
    var result = (value + '');
    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;
  }

  /**
   * Converts `func` to its source code.
   *
   * @private
   * @param {Function} func The function to convert.
   * @returns {string} Returns the source code.
   */
  function toSource(func) {
    if (func != null) {
      try {
        return funcToString.call(func);
      } catch (e) {}
      try {
        return (func + '');
      } catch (e) {}
    }
    return '';
  }

  /**
   * Updates wrapper `details` based on `bitmask` flags.
   *
   * @private
   * @returns {Array} details The details to modify.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @returns {Array} Returns `details`.
   */
  function updateWrapDetails(details, bitmask) {
    arrayEach(wrapFlags, function(pair) {
      var value = '_.' + pair[0];
      if ((bitmask & pair[1]) && !arrayIncludes(details, value)) {
        details.push(value);
      }
    });
    return details.sort();
  }

  /**
   * Creates a clone of `wrapper`.
   *
   * @private
   * @param {Object} wrapper The wrapper to clone.
   * @returns {Object} Returns the cloned wrapper.
   */
  function wrapperClone(wrapper) {
    if (wrapper instanceof LazyWrapper) {
      return wrapper.clone();
    }
    var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__);
    result.__actions__ = copyArray(wrapper.__actions__);
    result.__index__  = wrapper.__index__;
    result.__values__ = wrapper.__values__;
    return result;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates an array with all falsey values removed. The values `false`, `null`,
   * `0`, `""`, `undefined`, and `NaN` are falsey.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to compact.
   * @returns {Array} Returns the new array of filtered values.
   * @example
   *
   * _.compact([0, 1, false, 2, '', 3]);
   * // => [1, 2, 3]
   */
  function compact(array) {
    var index = -1,
        length = array == null ? 0 : array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (value) {
        result[resIndex++] = value;
      }
    }
    return result;
  }

  /**
   * Creates a new array concatenating `array` with any additional arrays
   * and/or values.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to concatenate.
   * @param {...*} [values] The values to concatenate.
   * @returns {Array} Returns the new concatenated array.
   * @example
   *
   * var array = [1];
   * var other = _.concat(array, 2, [3], [[4]]);
   *
   * console.log(other);
   * // => [1, 2, 3, [4]]
   *
   * console.log(array);
   * // => [1]
   */
  function concat() {
    var length = arguments.length;
    if (!length) {
      return [];
    }
    var args = Array(length - 1),
        array = arguments[0],
        index = length;

    while (index--) {
      args[index - 1] = arguments[index];
    }
    return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1));
  }

  /**
   * Creates an array of `array` values not included in the other given arrays
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. The order and references of result values are
   * determined by the first array.
   *
   * **Note:** Unlike `_.pullAll`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {...Array} [values] The values to exclude.
   * @returns {Array} Returns the new array of filtered values.
   * @see _.without, _.xor
   * @example
   *
   * _.difference([2, 1], [2, 3]);
   * // => [1]
   */
  var difference = baseRest(function(array, values) {
    return isArrayLikeObject(array)
      ? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true))
      : [];
  });

  /**
   * Creates a slice of `array` with `n` elements dropped from the beginning.
   *
   * @static
   * @memberOf _
   * @since 0.5.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to drop.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.drop([1, 2, 3]);
   * // => [2, 3]
   *
   * _.drop([1, 2, 3], 2);
   * // => [3]
   *
   * _.drop([1, 2, 3], 5);
   * // => []
   *
   * _.drop([1, 2, 3], 0);
   * // => [1, 2, 3]
   */
  function drop(array, n, guard) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    return baseSlice(array, n < 0 ? 0 : n, length);
  }

  /**
   * This method is like `_.find` except that it returns the index of the first
   * element `predicate` returns truthy for instead of the element itself.
   *
   * @static
   * @memberOf _
   * @since 1.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {number} Returns the index of the found element, else `-1`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'active': false },
   *   { 'user': 'fred',    'active': false },
   *   { 'user': 'pebbles', 'active': true }
   * ];
   *
   * _.findIndex(users, function(o) { return o.user == 'barney'; });
   * // => 0
   *
   * // The `_.matches` iteratee shorthand.
   * _.findIndex(users, { 'user': 'fred', 'active': false });
   * // => 1
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findIndex(users, ['active', false]);
   * // => 0
   *
   * // The `_.property` iteratee shorthand.
   * _.findIndex(users, 'active');
   * // => 2
   */
  function findIndex(array, predicate, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = fromIndex == null ? 0 : toInteger(fromIndex);
    if (index < 0) {
      index = nativeMax(length + index, 0);
    }
    return baseFindIndex(array, baseIteratee(predicate, 3), index);
  }

  /**
   * This method is like `_.findIndex` except that it iterates over elements
   * of `collection` from right to left.
   *
   * @static
   * @memberOf _
   * @since 2.0.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=array.length-1] The index to search from.
   * @returns {number} Returns the index of the found element, else `-1`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'active': true },
   *   { 'user': 'fred',    'active': false },
   *   { 'user': 'pebbles', 'active': false }
   * ];
   *
   * _.findLastIndex(users, function(o) { return o.user == 'pebbles'; });
   * // => 2
   *
   * // The `_.matches` iteratee shorthand.
   * _.findLastIndex(users, { 'user': 'barney', 'active': true });
   * // => 0
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findLastIndex(users, ['active', false]);
   * // => 2
   *
   * // The `_.property` iteratee shorthand.
   * _.findLastIndex(users, 'active');
   * // => 0
   */
  function findLastIndex(array, predicate, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = length - 1;
    if (fromIndex !== undefined) {
      index = toInteger(fromIndex);
      index = fromIndex < 0
        ? nativeMax(length + index, 0)
        : nativeMin(index, length - 1);
    }
    return baseFindIndex(array, baseIteratee(predicate, 3), index, true);
  }

  /**
   * Flattens `array` a single level deep.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to flatten.
   * @returns {Array} Returns the new flattened array.
   * @example
   *
   * _.flatten([1, [2, [3, [4]], 5]]);
   * // => [1, 2, [3, [4]], 5]
   */
  function flatten(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseFlatten(array, 1) : [];
  }

  /**
   * Recursively flattens `array`.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to flatten.
   * @returns {Array} Returns the new flattened array.
   * @example
   *
   * _.flattenDeep([1, [2, [3, [4]], 5]]);
   * // => [1, 2, 3, 4, 5]
   */
  function flattenDeep(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseFlatten(array, INFINITY) : [];
  }

  /**
   * Gets the first element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @alias first
   * @category Array
   * @param {Array} array The array to query.
   * @returns {*} Returns the first element of `array`.
   * @example
   *
   * _.head([1, 2, 3]);
   * // => 1
   *
   * _.head([]);
   * // => undefined
   */
  function head(array) {
    return (array && array.length) ? array[0] : undefined;
  }

  /**
   * Gets the index at which the first occurrence of `value` is found in `array`
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. If `fromIndex` is negative, it's used as the
   * offset from the end of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   * @example
   *
   * _.indexOf([1, 2, 1, 2], 2);
   * // => 1
   *
   * // Search from the `fromIndex`.
   * _.indexOf([1, 2, 1, 2], 2, 2);
   * // => 3
   */
  function indexOf(array, value, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = fromIndex == null ? 0 : toInteger(fromIndex);
    if (index < 0) {
      index = nativeMax(length + index, 0);
    }
    return baseIndexOf(array, value, index);
  }

  /**
   * Gets all but the last element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.initial([1, 2, 3]);
   * // => [1, 2]
   */
  function initial(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseSlice(array, 0, -1) : [];
  }

  /**
   * Creates an array of unique values that are included in all given arrays
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. The order and references of result values are
   * determined by the first array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to inspect.
   * @returns {Array} Returns the new array of intersecting values.
   * @example
   *
   * _.intersection([2, 1], [2, 3]);
   * // => [2]
   */
  var intersection = baseRest(function(arrays) {
    var mapped = arrayMap(arrays, castArrayLikeObject);
    return (mapped.length && mapped[0] === arrays[0])
      ? baseIntersection(mapped)
      : [];
  });

  /**
   * Gets the last element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @returns {*} Returns the last element of `array`.
   * @example
   *
   * _.last([1, 2, 3]);
   * // => 3
   */
  function last(array) {
    var length = array == null ? 0 : array.length;
    return length ? array[length - 1] : undefined;
  }

  /**
   * Reverses `array` so that the first element becomes the last, the second
   * element becomes the second to last, and so on.
   *
   * **Note:** This method mutates `array` and is based on
   * [`Array#reverse`](https://mdn.io/Array/reverse).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to modify.
   * @returns {Array} Returns `array`.
   * @example
   *
   * var array = [1, 2, 3];
   *
   * _.reverse(array);
   * // => [3, 2, 1]
   *
   * console.log(array);
   * // => [3, 2, 1]
   */
  function reverse(array) {
    return array == null ? array : nativeReverse.call(array);
  }

  /**
   * Creates a slice of `array` from `start` up to, but not including, `end`.
   *
   * **Note:** This method is used instead of
   * [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are
   * returned.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to slice.
   * @param {number} [start=0] The start position.
   * @param {number} [end=array.length] The end position.
   * @returns {Array} Returns the slice of `array`.
   */
  function slice(array, start, end) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    if (end && typeof end != 'number' && isIterateeCall(array, start, end)) {
      start = 0;
      end = length;
    }
    else {
      start = start == null ? 0 : toInteger(start);
      end = end === undefined ? length : toInteger(end);
    }
    return baseSlice(array, start, end);
  }

  /**
   * Creates a slice of `array` with `n` elements taken from the beginning.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to take.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.take([1, 2, 3]);
   * // => [1]
   *
   * _.take([1, 2, 3], 2);
   * // => [1, 2]
   *
   * _.take([1, 2, 3], 5);
   * // => [1, 2, 3]
   *
   * _.take([1, 2, 3], 0);
   * // => []
   */
  function take(array, n, guard) {
    if (!(array && array.length)) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    return baseSlice(array, 0, n < 0 ? 0 : n);
  }

  /**
   * Creates a slice of `array` with `n` elements taken from the end.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to take.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.takeRight([1, 2, 3]);
   * // => [3]
   *
   * _.takeRight([1, 2, 3], 2);
   * // => [2, 3]
   *
   * _.takeRight([1, 2, 3], 5);
   * // => [1, 2, 3]
   *
   * _.takeRight([1, 2, 3], 0);
   * // => []
   */
  function takeRight(array, n, guard) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    n = length - n;
    return baseSlice(array, n < 0 ? 0 : n, length);
  }

  /**
   * Creates an array of unique values, in order, from all given arrays using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to inspect.
   * @returns {Array} Returns the new array of combined values.
   * @example
   *
   * _.union([2], [1, 2]);
   * // => [2, 1]
   */
  var union = baseRest(function(arrays) {
    return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true));
  });

  /**
   * Creates a duplicate-free version of an array, using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons, in which only the first occurrence of each element
   * is kept. The order of result values is determined by the order they occur
   * in the array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @returns {Array} Returns the new duplicate free array.
   * @example
   *
   * _.uniq([2, 1, 2]);
   * // => [2, 1]
   */
  function uniq(array) {
    return (array && array.length) ? baseUniq(array) : [];
  }

  /**
   * This method is like `_.uniq` except that it accepts `iteratee` which is
   * invoked for each element in `array` to generate the criterion by which
   * uniqueness is computed. The order of result values is determined by the
   * order they occur in the array. The iteratee is invoked with one argument:
   * (value).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.
   * @returns {Array} Returns the new duplicate free array.
   * @example
   *
   * _.uniqBy([2.1, 1.2, 2.3], Math.floor);
   * // => [2.1, 1.2]
   *
   * // The `_.property` iteratee shorthand.
   * _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x');
   * // => [{ 'x': 1 }, { 'x': 2 }]
   */
  function uniqBy(array, iteratee) {
    return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : [];
  }

  /**
   * This method is like `_.zip` except that it accepts an array of grouped
   * elements and creates an array regrouping the elements to their pre-zip
   * configuration.
   *
   * @static
   * @memberOf _
   * @since 1.2.0
   * @category Array
   * @param {Array} array The array of grouped elements to process.
   * @returns {Array} Returns the new array of regrouped elements.
   * @example
   *
   * var zipped = _.zip(['a', 'b'], [1, 2], [true, false]);
   * // => [['a', 1, true], ['b', 2, false]]
   *
   * _.unzip(zipped);
   * // => [['a', 'b'], [1, 2], [true, false]]
   */
  function unzip(array) {
    if (!(array && array.length)) {
      return [];
    }
    var length = 0;
    array = arrayFilter(array, function(group) {
      if (isArrayLikeObject(group)) {
        length = nativeMax(group.length, length);
        return true;
      }
    });
    return baseTimes(length, function(index) {
      return arrayMap(array, baseProperty(index));
    });
  }

  /**
   * Creates an array excluding all given values using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * **Note:** Unlike `_.pull`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {...*} [values] The values to exclude.
   * @returns {Array} Returns the new array of filtered values.
   * @see _.difference, _.xor
   * @example
   *
   * _.without([2, 1, 2, 3], 1, 2);
   * // => [3]
   */
  var without = baseRest(function(array, values) {
    return isArrayLikeObject(array)
      ? baseDifference(array, values)
      : [];
  });

  /**
   * Creates an array of grouped elements, the first of which contains the
   * first elements of the given arrays, the second of which contains the
   * second elements of the given arrays, and so on.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to process.
   * @returns {Array} Returns the new array of grouped elements.
   * @example
   *
   * _.zip(['a', 'b'], [1, 2], [true, false]);
   * // => [['a', 1, true], ['b', 2, false]]
   */
  var zip = baseRest(unzip);

  /**
   * This method is like `_.fromPairs` except that it accepts two arrays,
   * one of property identifiers and one of corresponding values.
   *
   * @static
   * @memberOf _
   * @since 0.4.0
   * @category Array
   * @param {Array} [props=[]] The property identifiers.
   * @param {Array} [values=[]] The property values.
   * @returns {Object} Returns the new object.
   * @example
   *
   * _.zipObject(['a', 'b'], [1, 2]);
   * // => { 'a': 1, 'b': 2 }
   */
  function zipObject(props, values) {
    return baseZipObject(props || [], values || [], assignValue);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a `lodash` wrapper instance that wraps `value` with explicit method
   * chain sequences enabled. The result of such sequences must be unwrapped
   * with `_#value`.
   *
   * @static
   * @memberOf _
   * @since 1.3.0
   * @category Seq
   * @param {*} value The value to wrap.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'age': 36 },
   *   { 'user': 'fred',    'age': 40 },
   *   { 'user': 'pebbles', 'age': 1 }
   * ];
   *
   * var youngest = _
   *   .chain(users)
   *   .sortBy('age')
   *   .map(function(o) {
   *     return o.user + ' is ' + o.age;
   *   })
   *   .head()
   *   .value();
   * // => 'pebbles is 1'
   */
  function chain(value) {
    var result = lodash(value);
    result.__chain__ = true;
    return result;
  }

  /**
   * This method invokes `interceptor` and returns `value`. The interceptor
   * is invoked with one argument; (value). The purpose of this method is to
   * "tap into" a method chain sequence in order to modify intermediate results.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @param {*} value The value to provide to `interceptor`.
   * @param {Function} interceptor The function to invoke.
   * @returns {*} Returns `value`.
   * @example
   *
   * _([1, 2, 3])
   *  .tap(function(array) {
   *    // Mutate input array.
   *    array.pop();
   *  })
   *  .reverse()
   *  .value();
   * // => [2, 1]
   */
  function tap(value, interceptor) {
    interceptor(value);
    return value;
  }

  /**
   * This method is like `_.tap` except that it returns the result of `interceptor`.
   * The purpose of this method is to "pass thru" values replacing intermediate
   * results in a method chain sequence.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Seq
   * @param {*} value The value to provide to `interceptor`.
   * @param {Function} interceptor The function to invoke.
   * @returns {*} Returns the result of `interceptor`.
   * @example
   *
   * _('  abc  ')
   *  .chain()
   *  .trim()
   *  .thru(function(value) {
   *    return [value];
   *  })
   *  .value();
   * // => ['abc']
   */
  function thru(value, interceptor) {
    return interceptor(value);
  }

  /**
   * This method is the wrapper version of `_.at`.
   *
   * @name at
   * @memberOf _
   * @since 1.0.0
   * @category Seq
   * @param {...(string|string[])} [paths] The property paths to pick.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c': 3 } }, 4] };
   *
   * _(object).at(['a[0].b.c', 'a[1]']).value();
   * // => [3, 4]
   */
  var wrapperAt = flatRest(function(paths) {
    var length = paths.length,
        start = length ? paths[0] : 0,
        value = this.__wrapped__,
        interceptor = function(object) { return baseAt(object, paths); };

    if (length > 1 || this.__actions__.length ||
        !(value instanceof LazyWrapper) || !isIndex(start)) {
      return this.thru(interceptor);
    }
    value = value.slice(start, +start + (length ? 1 : 0));
    value.__actions__.push({
      'func': thru,
      'args': [interceptor],
      'thisArg': undefined
    });
    return new LodashWrapper(value, this.__chain__).thru(function(array) {
      if (length && !array.length) {
        array.push(undefined);
      }
      return array;
    });
  });

  /**
   * Creates a `lodash` wrapper instance with explicit method chain sequences enabled.
   *
   * @name chain
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36 },
   *   { 'user': 'fred',   'age': 40 }
   * ];
   *
   * // A sequence without explicit chaining.
   * _(users).head();
   * // => { 'user': 'barney', 'age': 36 }
   *
   * // A sequence with explicit chaining.
   * _(users)
   *   .chain()
   *   .head()
   *   .pick('user')
   *   .value();
   * // => { 'user': 'barney' }
   */
  function wrapperChain() {
    return chain(this);
  }

  /**
   * Executes the chain sequence and returns the wrapped result.
   *
   * @name commit
   * @memberOf _
   * @since 3.2.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var array = [1, 2];
   * var wrapped = _(array).push(3);
   *
   * console.log(array);
   * // => [1, 2]
   *
   * wrapped = wrapped.commit();
   * console.log(array);
   * // => [1, 2, 3]
   *
   * wrapped.last();
   * // => 3
   *
   * console.log(array);
   * // => [1, 2, 3]
   */
  function wrapperCommit() {
    return new LodashWrapper(this.value(), this.__chain__);
  }

  /**
   * Gets the next value on a wrapped object following the
   * [iterator protocol](https://mdn.io/iteration_protocols#iterator).
   *
   * @name next
   * @memberOf _
   * @since 4.0.0
   * @category Seq
   * @returns {Object} Returns the next iterator value.
   * @example
   *
   * var wrapped = _([1, 2]);
   *
   * wrapped.next();
   * // => { 'done': false, 'value': 1 }
   *
   * wrapped.next();
   * // => { 'done': false, 'value': 2 }
   *
   * wrapped.next();
   * // => { 'done': true, 'value': undefined }
   */
  function wrapperNext() {
    if (this.__values__ === undefined) {
      this.__values__ = toArray(this.value());
    }
    var done = this.__index__ >= this.__values__.length,
        value = done ? undefined : this.__values__[this.__index__++];

    return { 'done': done, 'value': value };
  }

  /**
   * Enables the wrapper to be iterable.
   *
   * @name Symbol.iterator
   * @memberOf _
   * @since 4.0.0
   * @category Seq
   * @returns {Object} Returns the wrapper object.
   * @example
   *
   * var wrapped = _([1, 2]);
   *
   * wrapped[Symbol.iterator]() === wrapped;
   * // => true
   *
   * Array.from(wrapped);
   * // => [1, 2]
   */
  function wrapperToIterator() {
    return this;
  }

  /**
   * Creates a clone of the chain sequence planting `value` as the wrapped value.
   *
   * @name plant
   * @memberOf _
   * @since 3.2.0
   * @category Seq
   * @param {*} value The value to plant.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * var wrapped = _([1, 2]).map(square);
   * var other = wrapped.plant([3, 4]);
   *
   * other.value();
   * // => [9, 16]
   *
   * wrapped.value();
   * // => [1, 4]
   */
  function wrapperPlant(value) {
    var result,
        parent = this;

    while (parent instanceof baseLodash) {
      var clone = wrapperClone(parent);
      clone.__index__ = 0;
      clone.__values__ = undefined;
      if (result) {
        previous.__wrapped__ = clone;
      } else {
        result = clone;
      }
      var previous = clone;
      parent = parent.__wrapped__;
    }
    previous.__wrapped__ = value;
    return result;
  }

  /**
   * This method is the wrapper version of `_.reverse`.
   *
   * **Note:** This method mutates the wrapped array.
   *
   * @name reverse
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var array = [1, 2, 3];
   *
   * _(array).reverse().value()
   * // => [3, 2, 1]
   *
   * console.log(array);
   * // => [3, 2, 1]
   */
  function wrapperReverse() {
    var value = this.__wrapped__;
    if (value instanceof LazyWrapper) {
      var wrapped = value;
      if (this.__actions__.length) {
        wrapped = new LazyWrapper(this);
      }
      wrapped = wrapped.reverse();
      wrapped.__actions__.push({
        'func': thru,
        'args': [reverse],
        'thisArg': undefined
      });
      return new LodashWrapper(wrapped, this.__chain__);
    }
    return this.thru(reverse);
  }

  /**
   * Executes the chain sequence to resolve the unwrapped value.
   *
   * @name value
   * @memberOf _
   * @since 0.1.0
   * @alias toJSON, valueOf
   * @category Seq
   * @returns {*} Returns the resolved unwrapped value.
   * @example
   *
   * _([1, 2, 3]).value();
   * // => [1, 2, 3]
   */
  function wrapperValue() {
    return baseWrapperValue(this.__wrapped__, this.__actions__);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates an object composed of keys generated from the results of running
   * each element of `collection` thru `iteratee`. The corresponding value of
   * each key is the number of times the key was returned by `iteratee`. The
   * iteratee is invoked with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 0.5.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The iteratee to transform keys.
   * @returns {Object} Returns the composed aggregate object.
   * @example
   *
   * _.countBy([6.1, 4.2, 6.3], Math.floor);
   * // => { '4': 1, '6': 2 }
   *
   * // The `_.property` iteratee shorthand.
   * _.countBy(['one', 'two', 'three'], 'length');
   * // => { '3': 2, '5': 1 }
   */
  var countBy = createAggregator(function(result, value, key) {
    if (hasOwnProperty.call(result, key)) {
      ++result[key];
    } else {
      baseAssignValue(result, key, 1);
    }
  });

  /**
   * Checks if `predicate` returns truthy for **all** elements of `collection`.
   * Iteration is stopped once `predicate` returns falsey. The predicate is
   * invoked with three arguments: (value, index|key, collection).
   *
   * **Note:** This method returns `true` for
   * [empty collections](https://en.wikipedia.org/wiki/Empty_set) because
   * [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of
   * elements of empty collections.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`.
   * @example
   *
   * _.every([true, 1, null, 'yes'], Boolean);
   * // => false
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': false },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.every(users, { 'user': 'barney', 'active': false });
   * // => false
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.every(users, ['active', false]);
   * // => true
   *
   * // The `_.property` iteratee shorthand.
   * _.every(users, 'active');
   * // => false
   */
  function every(collection, predicate, guard) {
    var func = isArray(collection) ? arrayEvery : baseEvery;
    if (guard && isIterateeCall(collection, predicate, guard)) {
      predicate = undefined;
    }
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Iterates over elements of `collection`, returning an array of all elements
   * `predicate` returns truthy for. The predicate is invoked with three
   * arguments: (value, index|key, collection).
   *
   * **Note:** Unlike `_.remove`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   * @see _.reject
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': true },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * _.filter(users, function(o) { return !o.active; });
   * // => objects for ['fred']
   *
   * // The `_.matches` iteratee shorthand.
   * _.filter(users, { 'age': 36, 'active': true });
   * // => objects for ['barney']
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.filter(users, ['active', false]);
   * // => objects for ['fred']
   *
   * // The `_.property` iteratee shorthand.
   * _.filter(users, 'active');
   * // => objects for ['barney']
   */
  function filter(collection, predicate) {
    var func = isArray(collection) ? arrayFilter : baseFilter;
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Iterates over elements of `collection`, returning the first element
   * `predicate` returns truthy for. The predicate is invoked with three
   * arguments: (value, index|key, collection).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {*} Returns the matched element, else `undefined`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'age': 36, 'active': true },
   *   { 'user': 'fred',    'age': 40, 'active': false },
   *   { 'user': 'pebbles', 'age': 1,  'active': true }
   * ];
   *
   * _.find(users, function(o) { return o.age < 40; });
   * // => object for 'barney'
   *
   * // The `_.matches` iteratee shorthand.
   * _.find(users, { 'age': 1, 'active': true });
   * // => object for 'pebbles'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.find(users, ['active', false]);
   * // => object for 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.find(users, 'active');
   * // => object for 'barney'
   */
  var find = createFind(findIndex);

  /**
   * Iterates over elements of `collection` and invokes `iteratee` for each element.
   * The iteratee is invoked with three arguments: (value, index|key, collection).
   * Iteratee functions may exit iteration early by explicitly returning `false`.
   *
   * **Note:** As with other "Collections" methods, objects with a "length"
   * property are iterated like arrays. To avoid this behavior use `_.forIn`
   * or `_.forOwn` for object iteration.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @alias each
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @returns {Array|Object} Returns `collection`.
   * @see _.forEachRight
   * @example
   *
   * _.forEach([1, 2], function(value) {
   *   console.log(value);
   * });
   * // => Logs `1` then `2`.
   *
   * _.forEach({ 'a': 1, 'b': 2 }, function(value, key) {
   *   console.log(key);
   * });
   * // => Logs 'a' then 'b' (iteration order is not guaranteed).
   */
  function forEach(collection, iteratee) {
    var func = isArray(collection) ? arrayEach : baseEach;
    return func(collection, baseIteratee(iteratee, 3));
  }

  /**
   * Creates an array of values by running each element in `collection` thru
   * `iteratee`. The iteratee is invoked with three arguments:
   * (value, index|key, collection).
   *
   * Many lodash methods are guarded to work as iteratees for methods like
   * `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`.
   *
   * The guarded methods are:
   * `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`,
   * `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`,
   * `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`,
   * `template`, `trim`, `trimEnd`, `trimStart`, and `words`
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * _.map([4, 8], square);
   * // => [16, 64]
   *
   * _.map({ 'a': 4, 'b': 8 }, square);
   * // => [16, 64] (iteration order is not guaranteed)
   *
   * var users = [
   *   { 'user': 'barney' },
   *   { 'user': 'fred' }
   * ];
   *
   * // The `_.property` iteratee shorthand.
   * _.map(users, 'user');
   * // => ['barney', 'fred']
   */
  function map(collection, iteratee) {
    var func = isArray(collection) ? arrayMap : baseMap;
    return func(collection, baseIteratee(iteratee, 3));
  }

  /**
   * Reduces `collection` to a value which is the accumulated result of running
   * each element in `collection` thru `iteratee`, where each successive
   * invocation is supplied the return value of the previous. If `accumulator`
   * is not given, the first element of `collection` is used as the initial
   * value. The iteratee is invoked with four arguments:
   * (accumulator, value, index|key, collection).
   *
   * Many lodash methods are guarded to work as iteratees for methods like
   * `_.reduce`, `_.reduceRight`, and `_.transform`.
   *
   * The guarded methods are:
   * `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`,
   * and `sortBy`
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @param {*} [accumulator] The initial value.
   * @returns {*} Returns the accumulated value.
   * @see _.reduceRight
   * @example
   *
   * _.reduce([1, 2], function(sum, n) {
   *   return sum + n;
   * }, 0);
   * // => 3
   *
   * _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) {
   *   (result[value] || (result[value] = [])).push(key);
   *   return result;
   * }, {});
   * // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed)
   */
  function reduce(collection, iteratee, accumulator) {
    var func = isArray(collection) ? arrayReduce : baseReduce,
        initAccum = arguments.length < 3;

    return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach);
  }

  /**
   * The opposite of `_.filter`; this method returns the elements of `collection`
   * that `predicate` does **not** return truthy for.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   * @see _.filter
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': false },
   *   { 'user': 'fred',   'age': 40, 'active': true }
   * ];
   *
   * _.reject(users, function(o) { return !o.active; });
   * // => objects for ['fred']
   *
   * // The `_.matches` iteratee shorthand.
   * _.reject(users, { 'age': 40, 'active': true });
   * // => objects for ['barney']
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.reject(users, ['active', false]);
   * // => objects for ['fred']
   *
   * // The `_.property` iteratee shorthand.
   * _.reject(users, 'active');
   * // => objects for ['barney']
   */
  function reject(collection, predicate) {
    var func = isArray(collection) ? arrayFilter : baseFilter;
    return func(collection, negate(baseIteratee(predicate, 3)));
  }

  /**
   * Gets the size of `collection` by returning its length for array-like
   * values or the number of own enumerable string keyed properties for objects.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object|string} collection The collection to inspect.
   * @returns {number} Returns the collection size.
   * @example
   *
   * _.size([1, 2, 3]);
   * // => 3
   *
   * _.size({ 'a': 1, 'b': 2 });
   * // => 2
   *
   * _.size('pebbles');
   * // => 7
   */
  function size(collection) {
    if (collection == null) {
      return 0;
    }
    if (isArrayLike(collection)) {
      return isString(collection) ? stringSize(collection) : collection.length;
    }
    var tag = getTag(collection);
    if (tag == mapTag || tag == setTag) {
      return collection.size;
    }
    return baseKeys(collection).length;
  }

  /**
   * Checks if `predicate` returns truthy for **any** element of `collection`.
   * Iteration is stopped once `predicate` returns truthy. The predicate is
   * invoked with three arguments: (value, index|key, collection).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   * @example
   *
   * _.some([null, 0, 'yes', false], Boolean);
   * // => true
   *
   * var users = [
   *   { 'user': 'barney', 'active': true },
   *   { 'user': 'fred',   'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.some(users, { 'user': 'barney', 'active': false });
   * // => false
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.some(users, ['active', false]);
   * // => true
   *
   * // The `_.property` iteratee shorthand.
   * _.some(users, 'active');
   * // => true
   */
  function some(collection, predicate, guard) {
    var func = isArray(collection) ? arraySome : baseSome;
    if (guard && isIterateeCall(collection, predicate, guard)) {
      predicate = undefined;
    }
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Creates an array of elements, sorted in ascending order by the results of
   * running each element in a collection thru each iteratee. This method
   * performs a stable sort, that is, it preserves the original sort order of
   * equal elements. The iteratees are invoked with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {...(Function|Function[])} [iteratees=[_.identity]]
   *  The iteratees to sort by.
   * @returns {Array} Returns the new sorted array.
   * @example
   *
   * var users = [
   *   { 'user': 'fred',   'age': 48 },
   *   { 'user': 'barney', 'age': 36 },
   *   { 'user': 'fred',   'age': 40 },
   *   { 'user': 'barney', 'age': 34 }
   * ];
   *
   * _.sortBy(users, [function(o) { return o.user; }]);
   * // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]]
   *
   * _.sortBy(users, ['user', 'age']);
   * // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]]
   */
  var sortBy = baseRest(function(collection, iteratees) {
    if (collection == null) {
      return [];
    }
    var length = iteratees.length;
    if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) {
      iteratees = [];
    } else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) {
      iteratees = [iteratees[0]];
    }
    return baseOrderBy(collection, baseFlatten(iteratees, 1), []);
  });

  /*------------------------------------------------------------------------*/

  /**
   * Gets the timestamp of the number of milliseconds that have elapsed since
   * the Unix epoch (1 January 1970 00:00:00 UTC).
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Date
   * @returns {number} Returns the timestamp.
   * @example
   *
   * _.defer(function(stamp) {
   *   console.log(_.now() - stamp);
   * }, _.now());
   * // => Logs the number of milliseconds it took for the deferred invocation.
   */
  var now = function() {
    return root.Date.now();
  };

  /*------------------------------------------------------------------------*/

  /**
   * Creates a function that invokes `func`, with the `this` binding and arguments
   * of the created function, while it's called less than `n` times. Subsequent
   * calls to the created function return the result of the last `func` invocation.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Function
   * @param {number} n The number of calls at which `func` is no longer invoked.
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new restricted function.
   * @example
   *
   * jQuery(element).on('click', _.before(5, addContactToList));
   * // => Allows adding up to 4 contacts to the list.
   */
  function before(n, func) {
    var result;
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    n = toInteger(n);
    return function() {
      if (--n > 0) {
        result = func.apply(this, arguments);
      }
      if (n <= 1) {
        func = undefined;
      }
      return result;
    };
  }

  /**
   * Creates a function that invokes `func` with the `this` binding of `thisArg`
   * and `partials` prepended to the arguments it receives.
   *
   * The `_.bind.placeholder` value, which defaults to `_` in monolithic builds,
   * may be used as a placeholder for partially applied arguments.
   *
   * **Note:** Unlike native `Function#bind`, this method doesn't set the "length"
   * property of bound functions.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to bind.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {...*} [partials] The arguments to be partially applied.
   * @returns {Function} Returns the new bound function.
   * @example
   *
   * function greet(greeting, punctuation) {
   *   return greeting + ' ' + this.user + punctuation;
   * }
   *
   * var object = { 'user': 'fred' };
   *
   * var bound = _.bind(greet, object, 'hi');
   * bound('!');
   * // => 'hi fred!'
   *
   * // Bound with placeholders.
   * var bound = _.bind(greet, object, _, '!');
   * bound('hi');
   * // => 'hi fred!'
   */
  var bind = baseRest(function(func, thisArg, partials) {
    var bitmask = WRAP_BIND_FLAG;
    if (partials.length) {
      var holders = replaceHolders(partials, getHolder(bind));
      bitmask |= WRAP_PARTIAL_FLAG;
    }
    return createWrap(func, bitmask, thisArg, partials, holders);
  });

  /**
   * Creates a debounced function that delays invoking `func` until after `wait`
   * milliseconds have elapsed since the last time the debounced function was
   * invoked. The debounced function comes with a `cancel` method to cancel
   * delayed `func` invocations and a `flush` method to immediately invoke them.
   * Provide `options` to indicate whether `func` should be invoked on the
   * leading and/or trailing edge of the `wait` timeout. The `func` is invoked
   * with the last arguments provided to the debounced function. Subsequent
   * calls to the debounced function return the result of the last `func`
   * invocation.
   *
   * **Note:** If `leading` and `trailing` options are `true`, `func` is
   * invoked on the trailing edge of the timeout only if the debounced function
   * is invoked more than once during the `wait` timeout.
   *
   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred
   * until to the next tick, similar to `setTimeout` with a timeout of `0`.
   *
   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)
   * for details over the differences between `_.debounce` and `_.throttle`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to debounce.
   * @param {number} [wait=0] The number of milliseconds to delay.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.leading=false]
   *  Specify invoking on the leading edge of the timeout.
   * @param {number} [options.maxWait]
   *  The maximum time `func` is allowed to be delayed before it's invoked.
   * @param {boolean} [options.trailing=true]
   *  Specify invoking on the trailing edge of the timeout.
   * @returns {Function} Returns the new debounced function.
   * @example
   *
   * // Avoid costly calculations while the window size is in flux.
   * jQuery(window).on('resize', _.debounce(calculateLayout, 150));
   *
   * // Invoke `sendMail` when clicked, debouncing subsequent calls.
   * jQuery(element).on('click', _.debounce(sendMail, 300, {
   *   'leading': true,
   *   'trailing': false
   * }));
   *
   * // Ensure `batchLog` is invoked once after 1 second of debounced calls.
   * var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 });
   * var source = new EventSource('/stream');
   * jQuery(source).on('message', debounced);
   *
   * // Cancel the trailing debounced invocation.
   * jQuery(window).on('popstate', debounced.cancel);
   */
  function debounce(func, wait, options) {
    var lastArgs,
        lastThis,
        maxWait,
        result,
        timerId,
        lastCallTime,
        lastInvokeTime = 0,
        leading = false,
        maxing = false,
        trailing = true;

    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    wait = toNumber(wait) || 0;
    if (isObject(options)) {
      leading = !!options.leading;
      maxing = 'maxWait' in options;
      maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait;
      trailing = 'trailing' in options ? !!options.trailing : trailing;
    }

    function invokeFunc(time) {
      var args = lastArgs,
          thisArg = lastThis;

      lastArgs = lastThis = undefined;
      lastInvokeTime = time;
      result = func.apply(thisArg, args);
      return result;
    }

    function leadingEdge(time) {
      // Reset any `maxWait` timer.
      lastInvokeTime = time;
      // Start the timer for the trailing edge.
      timerId = setTimeout(timerExpired, wait);
      // Invoke the leading edge.
      return leading ? invokeFunc(time) : result;
    }

    function remainingWait(time) {
      var timeSinceLastCall = time - lastCallTime,
          timeSinceLastInvoke = time - lastInvokeTime,
          timeWaiting = wait - timeSinceLastCall;

      return maxing
        ? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke)
        : timeWaiting;
    }

    function shouldInvoke(time) {
      var timeSinceLastCall = time - lastCallTime,
          timeSinceLastInvoke = time - lastInvokeTime;

      // Either this is the first call, activity has stopped and we're at the
      // trailing edge, the system time has gone backwards and we're treating
      // it as the trailing edge, or we've hit the `maxWait` limit.
      return (lastCallTime === undefined || (timeSinceLastCall >= wait) ||
        (timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait));
    }

    function timerExpired() {
      var time = now();
      if (shouldInvoke(time)) {
        return trailingEdge(time);
      }
      // Restart the timer.
      timerId = setTimeout(timerExpired, remainingWait(time));
    }

    function trailingEdge(time) {
      timerId = undefined;

      // Only invoke if we have `lastArgs` which means `func` has been
      // debounced at least once.
      if (trailing && lastArgs) {
        return invokeFunc(time);
      }
      lastArgs = lastThis = undefined;
      return result;
    }

    function cancel() {
      if (timerId !== undefined) {
        clearTimeout(timerId);
      }
      lastInvokeTime = 0;
      lastArgs = lastCallTime = lastThis = timerId = undefined;
    }

    function flush() {
      return timerId === undefined ? result : trailingEdge(now());
    }

    function debounced() {
      var time = now(),
          isInvoking = shouldInvoke(time);

      lastArgs = arguments;
      lastThis = this;
      lastCallTime = time;

      if (isInvoking) {
        if (timerId === undefined) {
          return leadingEdge(lastCallTime);
        }
        if (maxing) {
          // Handle invocations in a tight loop.
          timerId = setTimeout(timerExpired, wait);
          return invokeFunc(lastCallTime);
        }
      }
      if (timerId === undefined) {
        timerId = setTimeout(timerExpired, wait);
      }
      return result;
    }
    debounced.cancel = cancel;
    debounced.flush = flush;
    return debounced;
  }

  /**
   * Defers invoking the `func` until the current call stack has cleared. Any
   * additional arguments are provided to `func` when it's invoked.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to defer.
   * @param {...*} [args] The arguments to invoke `func` with.
   * @returns {number} Returns the timer id.
   * @example
   *
   * _.defer(function(text) {
   *   console.log(text);
   * }, 'deferred');
   * // => Logs 'deferred' after one millisecond.
   */
  var defer = baseRest(function(func, args) {
    return baseDelay(func, 1, args);
  });

  /**
   * Invokes `func` after `wait` milliseconds. Any additional arguments are
   * provided to `func` when it's invoked.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to delay.
   * @param {number} wait The number of milliseconds to delay invocation.
   * @param {...*} [args] The arguments to invoke `func` with.
   * @returns {number} Returns the timer id.
   * @example
   *
   * _.delay(function(text) {
   *   console.log(text);
   * }, 1000, 'later');
   * // => Logs 'later' after one second.
   */
  var delay = baseRest(function(func, wait, args) {
    return baseDelay(func, toNumber(wait) || 0, args);
  });

  /**
   * Creates a function that memoizes the result of `func`. If `resolver` is
   * provided, it determines the cache key for storing the result based on the
   * arguments provided to the memoized function. By default, the first argument
   * provided to the memoized function is used as the map cache key. The `func`
   * is invoked with the `this` binding of the memoized function.
   *
   * **Note:** The cache is exposed as the `cache` property on the memoized
   * function. Its creation may be customized by replacing the `_.memoize.Cache`
   * constructor with one whose instances implement the
   * [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object)
   * method interface of `clear`, `delete`, `get`, `has`, and `set`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to have its output memoized.
   * @param {Function} [resolver] The function to resolve the cache key.
   * @returns {Function} Returns the new memoized function.
   * @example
   *
   * var object = { 'a': 1, 'b': 2 };
   * var other = { 'c': 3, 'd': 4 };
   *
   * var values = _.memoize(_.values);
   * values(object);
   * // => [1, 2]
   *
   * values(other);
   * // => [3, 4]
   *
   * object.a = 2;
   * values(object);
   * // => [1, 2]
   *
   * // Modify the result cache.
   * values.cache.set(object, ['a', 'b']);
   * values(object);
   * // => ['a', 'b']
   *
   * // Replace `_.memoize.Cache`.
   * _.memoize.Cache = WeakMap;
   */
  function memoize(func, resolver) {
    if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    var memoized = function() {
      var args = arguments,
          key = resolver ? resolver.apply(this, args) : args[0],
          cache = memoized.cache;

      if (cache.has(key)) {
        return cache.get(key);
      }
      var result = func.apply(this, args);
      memoized.cache = cache.set(key, result) || cache;
      return result;
    };
    memoized.cache = new (memoize.Cache || MapCache);
    return memoized;
  }

  // Expose `MapCache`.
  memoize.Cache = MapCache;

  /**
   * Creates a function that negates the result of the predicate `func`. The
   * `func` predicate is invoked with the `this` binding and arguments of the
   * created function.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Function
   * @param {Function} predicate The predicate to negate.
   * @returns {Function} Returns the new negated function.
   * @example
   *
   * function isEven(n) {
   *   return n % 2 == 0;
   * }
   *
   * _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven));
   * // => [1, 3, 5]
   */
  function negate(predicate) {
    if (typeof predicate != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    return function() {
      var args = arguments;
      switch (args.length) {
        case 0: return !predicate.call(this);
        case 1: return !predicate.call(this, args[0]);
        case 2: return !predicate.call(this, args[0], args[1]);
        case 3: return !predicate.call(this, args[0], args[1], args[2]);
      }
      return !predicate.apply(this, args);
    };
  }

  /**
   * Creates a function that is restricted to invoking `func` once. Repeat calls
   * to the function return the value of the first invocation. The `func` is
   * invoked with the `this` binding and arguments of the created function.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new restricted function.
   * @example
   *
   * var initialize = _.once(createApplication);
   * initialize();
   * initialize();
   * // => `createApplication` is invoked once
   */
  function once(func) {
    return before(2, func);
  }

  /**
   * Creates a function that invokes `func` with the `this` binding of the
   * created function and arguments from `start` and beyond provided as
   * an array.
   *
   * **Note:** This method is based on the
   * [rest parameter](https://mdn.io/rest_parameters).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Function
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @returns {Function} Returns the new function.
   * @example
   *
   * var say = _.rest(function(what, names) {
   *   return what + ' ' + _.initial(names).join(', ') +
   *     (_.size(names) > 1 ? ', & ' : '') + _.last(names);
   * });
   *
   * say('hello', 'fred', 'barney', 'pebbles');
   * // => 'hello fred, barney, & pebbles'
   */
  function rest(func, start) {
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    start = start === undefined ? start : toInteger(start);
    return baseRest(func, start);
  }

  /**
   * Creates a throttled function that only invokes `func` at most once per
   * every `wait` milliseconds. The throttled function comes with a `cancel`
   * method to cancel delayed `func` invocations and a `flush` method to
   * immediately invoke them. Provide `options` to indicate whether `func`
   * should be invoked on the leading and/or trailing edge of the `wait`
   * timeout. The `func` is invoked with the last arguments provided to the
   * throttled function. Subsequent calls to the throttled function return the
   * result of the last `func` invocation.
   *
   * **Note:** If `leading` and `trailing` options are `true`, `func` is
   * invoked on the trailing edge of the timeout only if the throttled function
   * is invoked more than once during the `wait` timeout.
   *
   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred
   * until to the next tick, similar to `setTimeout` with a timeout of `0`.
   *
   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)
   * for details over the differences between `_.throttle` and `_.debounce`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to throttle.
   * @param {number} [wait=0] The number of milliseconds to throttle invocations to.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.leading=true]
   *  Specify invoking on the leading edge of the timeout.
   * @param {boolean} [options.trailing=true]
   *  Specify invoking on the trailing edge of the timeout.
   * @returns {Function} Returns the new throttled function.
   * @example
   *
   * // Avoid excessively updating the position while scrolling.
   * jQuery(window).on('scroll', _.throttle(updatePosition, 100));
   *
   * // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes.
   * var throttled = _.throttle(renewToken, 300000, { 'trailing': false });
   * jQuery(element).on('click', throttled);
   *
   * // Cancel the trailing throttled invocation.
   * jQuery(window).on('popstate', throttled.cancel);
   */
  function throttle(func, wait, options) {
    var leading = true,
        trailing = true;

    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    if (isObject(options)) {
      leading = 'leading' in options ? !!options.leading : leading;
      trailing = 'trailing' in options ? !!options.trailing : trailing;
    }
    return debounce(func, wait, {
      'leading': leading,
      'maxWait': wait,
      'trailing': trailing
    });
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a shallow clone of `value`.
   *
   * **Note:** This method is loosely based on the
   * [structured clone algorithm](https://mdn.io/Structured_clone_algorithm)
   * and supports cloning arrays, array buffers, booleans, date objects, maps,
   * numbers, `Object` objects, regexes, sets, strings, symbols, and typed
   * arrays. The own enumerable properties of `arguments` objects are cloned
   * as plain objects. An empty object is returned for uncloneable values such
   * as error objects, functions, DOM nodes, and WeakMaps.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to clone.
   * @returns {*} Returns the cloned value.
   * @see _.cloneDeep
   * @example
   *
   * var objects = [{ 'a': 1 }, { 'b': 2 }];
   *
   * var shallow = _.clone(objects);
   * console.log(shallow[0] === objects[0]);
   * // => true
   */
  function clone(value) {
    return baseClone(value, CLONE_SYMBOLS_FLAG);
  }

  /**
   * This method is like `_.clone` except that it recursively clones `value`.
   *
   * @static
   * @memberOf _
   * @since 1.0.0
   * @category Lang
   * @param {*} value The value to recursively clone.
   * @returns {*} Returns the deep cloned value.
   * @see _.clone
   * @example
   *
   * var objects = [{ 'a': 1 }, { 'b': 2 }];
   *
   * var deep = _.cloneDeep(objects);
   * console.log(deep[0] === objects[0]);
   * // => false
   */
  function cloneDeep(value) {
    return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG);
  }

  /**
   * Performs a
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * comparison between two values to determine if they are equivalent.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   * @example
   *
   * var object = { 'a': 1 };
   * var other = { 'a': 1 };
   *
   * _.eq(object, object);
   * // => true
   *
   * _.eq(object, other);
   * // => false
   *
   * _.eq('a', 'a');
   * // => true
   *
   * _.eq('a', Object('a'));
   * // => false
   *
   * _.eq(NaN, NaN);
   * // => true
   */
  function eq(value, other) {
    return value === other || (value !== value && other !== other);
  }

  /**
   * Checks if `value` is likely an `arguments` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an `arguments` object,
   *  else `false`.
   * @example
   *
   * _.isArguments(function() { return arguments; }());
   * // => true
   *
   * _.isArguments([1, 2, 3]);
   * // => false
   */
  var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) {
    return isObjectLike(value) && hasOwnProperty.call(value, 'callee') &&
      !propertyIsEnumerable.call(value, 'callee');
  };

  /**
   * Checks if `value` is classified as an `Array` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an array, else `false`.
   * @example
   *
   * _.isArray([1, 2, 3]);
   * // => true
   *
   * _.isArray(document.body.children);
   * // => false
   *
   * _.isArray('abc');
   * // => false
   *
   * _.isArray(_.noop);
   * // => false
   */
  var isArray = Array.isArray;

  /**
   * Checks if `value` is array-like. A value is considered array-like if it's
   * not a function and has a `value.length` that's an integer greater than or
   * equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is array-like, else `false`.
   * @example
   *
   * _.isArrayLike([1, 2, 3]);
   * // => true
   *
   * _.isArrayLike(document.body.children);
   * // => true
   *
   * _.isArrayLike('abc');
   * // => true
   *
   * _.isArrayLike(_.noop);
   * // => false
   */
  function isArrayLike(value) {
    return value != null && isLength(value.length) && !isFunction(value);
  }

  /**
   * This method is like `_.isArrayLike` except that it also checks if `value`
   * is an object.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an array-like object,
   *  else `false`.
   * @example
   *
   * _.isArrayLikeObject([1, 2, 3]);
   * // => true
   *
   * _.isArrayLikeObject(document.body.children);
   * // => true
   *
   * _.isArrayLikeObject('abc');
   * // => false
   *
   * _.isArrayLikeObject(_.noop);
   * // => false
   */
  function isArrayLikeObject(value) {
    return isObjectLike(value) && isArrayLike(value);
  }

  /**
   * Checks if `value` is classified as a boolean primitive or object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a boolean, else `false`.
   * @example
   *
   * _.isBoolean(false);
   * // => true
   *
   * _.isBoolean(null);
   * // => false
   */
  function isBoolean(value) {
    return value === true || value === false ||
      (isObjectLike(value) && baseGetTag(value) == boolTag);
  }

  /**
   * Checks if `value` is a buffer.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a buffer, else `false`.
   * @example
   *
   * _.isBuffer(new Buffer(2));
   * // => true
   *
   * _.isBuffer(new Uint8Array(2));
   * // => false
   */
  var isBuffer = nativeIsBuffer || stubFalse;

  /**
   * Checks if `value` is classified as a `Date` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.
   * @example
   *
   * _.isDate(new Date);
   * // => true
   *
   * _.isDate('Mon April 23 2012');
   * // => false
   */
  var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate;

  /**
   * Checks if `value` is an empty object, collection, map, or set.
   *
   * Objects are considered empty if they have no own enumerable string keyed
   * properties.
   *
   * Array-like values such as `arguments` objects, arrays, buffers, strings, or
   * jQuery-like collections are considered empty if they have a `length` of `0`.
   * Similarly, maps and sets are considered empty if they have a `size` of `0`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is empty, else `false`.
   * @example
   *
   * _.isEmpty(null);
   * // => true
   *
   * _.isEmpty(true);
   * // => true
   *
   * _.isEmpty(1);
   * // => true
   *
   * _.isEmpty([1, 2, 3]);
   * // => false
   *
   * _.isEmpty({ 'a': 1 });
   * // => false
   */
  function isEmpty(value) {
    if (value == null) {
      return true;
    }
    if (isArrayLike(value) &&
        (isArray(value) || typeof value == 'string' || typeof value.splice == 'function' ||
          isBuffer(value) || isTypedArray(value) || isArguments(value))) {
      return !value.length;
    }
    var tag = getTag(value);
    if (tag == mapTag || tag == setTag) {
      return !value.size;
    }
    if (isPrototype(value)) {
      return !baseKeys(value).length;
    }
    for (var key in value) {
      if (hasOwnProperty.call(value, key)) {
        return false;
      }
    }
    return true;
  }

  /**
   * Performs a deep comparison between two values to determine if they are
   * equivalent.
   *
   * **Note:** This method supports comparing arrays, array buffers, booleans,
   * date objects, error objects, maps, numbers, `Object` objects, regexes,
   * sets, strings, symbols, and typed arrays. `Object` objects are compared
   * by their own, not inherited, enumerable properties. Functions and DOM
   * nodes are compared by strict equality, i.e. `===`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   * @example
   *
   * var object = { 'a': 1 };
   * var other = { 'a': 1 };
   *
   * _.isEqual(object, other);
   * // => true
   *
   * object === other;
   * // => false
   */
  function isEqual(value, other) {
    return baseIsEqual(value, other);
  }

  /**
   * Checks if `value` is a finite primitive number.
   *
   * **Note:** This method is based on
   * [`Number.isFinite`](https://mdn.io/Number/isFinite).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a finite number, else `false`.
   * @example
   *
   * _.isFinite(3);
   * // => true
   *
   * _.isFinite(Number.MIN_VALUE);
   * // => true
   *
   * _.isFinite(Infinity);
   * // => false
   *
   * _.isFinite('3');
   * // => false
   */
  function isFinite(value) {
    return typeof value == 'number' && nativeIsFinite(value);
  }

  /**
   * Checks if `value` is classified as a `Function` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a function, else `false`.
   * @example
   *
   * _.isFunction(_);
   * // => true
   *
   * _.isFunction(/abc/);
   * // => false
   */
  function isFunction(value) {
    if (!isObject(value)) {
      return false;
    }
    // The use of `Object#toString` avoids issues with the `typeof` operator
    // in Safari 9 which returns 'object' for typed arrays and other constructors.
    var tag = baseGetTag(value);
    return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag;
  }

  /**
   * Checks if `value` is a valid array-like length.
   *
   * **Note:** This method is loosely based on
   * [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a valid length, else `false`.
   * @example
   *
   * _.isLength(3);
   * // => true
   *
   * _.isLength(Number.MIN_VALUE);
   * // => false
   *
   * _.isLength(Infinity);
   * // => false
   *
   * _.isLength('3');
   * // => false
   */
  function isLength(value) {
    return typeof value == 'number' &&
      value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER;
  }

  /**
   * Checks if `value` is the
   * [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types)
   * of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`)
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an object, else `false`.
   * @example
   *
   * _.isObject({});
   * // => true
   *
   * _.isObject([1, 2, 3]);
   * // => true
   *
   * _.isObject(_.noop);
   * // => true
   *
   * _.isObject(null);
   * // => false
   */
  function isObject(value) {
    var type = typeof value;
    return value != null && (type == 'object' || type == 'function');
  }

  /**
   * Checks if `value` is object-like. A value is object-like if it's not `null`
   * and has a `typeof` result of "object".
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is object-like, else `false`.
   * @example
   *
   * _.isObjectLike({});
   * // => true
   *
   * _.isObjectLike([1, 2, 3]);
   * // => true
   *
   * _.isObjectLike(_.noop);
   * // => false
   *
   * _.isObjectLike(null);
   * // => false
   */
  function isObjectLike(value) {
    return value != null && typeof value == 'object';
  }

  /**
   * Checks if `value` is classified as a `Map` object.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a map, else `false`.
   * @example
   *
   * _.isMap(new Map);
   * // => true
   *
   * _.isMap(new WeakMap);
   * // => false
   */
  var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap;

  /**
   * Checks if `value` is `NaN`.
   *
   * **Note:** This method is based on
   * [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as
   * global [`isNaN`](https://mdn.io/isNaN) which returns `true` for
   * `undefined` and other non-number values.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.
   * @example
   *
   * _.isNaN(NaN);
   * // => true
   *
   * _.isNaN(new Number(NaN));
   * // => true
   *
   * isNaN(undefined);
   * // => true
   *
   * _.isNaN(undefined);
   * // => false
   */
  function isNaN(value) {
    // An `NaN` primitive is the only value that is not equal to itself.
    // Perform the `toStringTag` check first to avoid errors with some
    // ActiveX objects in IE.
    return isNumber(value) && value != +value;
  }

  /**
   * Checks if `value` is `null`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `null`, else `false`.
   * @example
   *
   * _.isNull(null);
   * // => true
   *
   * _.isNull(void 0);
   * // => false
   */
  function isNull(value) {
    return value === null;
  }

  /**
   * Checks if `value` is classified as a `Number` primitive or object.
   *
   * **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are
   * classified as numbers, use the `_.isFinite` method.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a number, else `false`.
   * @example
   *
   * _.isNumber(3);
   * // => true
   *
   * _.isNumber(Number.MIN_VALUE);
   * // => true
   *
   * _.isNumber(Infinity);
   * // => true
   *
   * _.isNumber('3');
   * // => false
   */
  function isNumber(value) {
    return typeof value == 'number' ||
      (isObjectLike(value) && baseGetTag(value) == numberTag);
  }

  /**
   * Checks if `value` is a plain object, that is, an object created by the
   * `Object` constructor or one with a `[[Prototype]]` of `null`.
   *
   * @static
   * @memberOf _
   * @since 0.8.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a plain object, else `false`.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   * }
   *
   * _.isPlainObject(new Foo);
   * // => false
   *
   * _.isPlainObject([1, 2, 3]);
   * // => false
   *
   * _.isPlainObject({ 'x': 0, 'y': 0 });
   * // => true
   *
   * _.isPlainObject(Object.create(null));
   * // => true
   */
  function isPlainObject(value) {
    if (!isObjectLike(value) || baseGetTag(value) != objectTag) {
      return false;
    }
    var proto = getPrototype(value);
    if (proto === null) {
      return true;
    }
    var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor;
    return typeof Ctor == 'function' && Ctor instanceof Ctor &&
      funcToString.call(Ctor) == objectCtorString;
  }

  /**
   * Checks if `value` is classified as a `RegExp` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.
   * @example
   *
   * _.isRegExp(/abc/);
   * // => true
   *
   * _.isRegExp('/abc/');
   * // => false
   */
  var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp;

  /**
   * Checks if `value` is classified as a `Set` object.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a set, else `false`.
   * @example
   *
   * _.isSet(new Set);
   * // => true
   *
   * _.isSet(new WeakSet);
   * // => false
   */
  var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet;

  /**
   * Checks if `value` is classified as a `String` primitive or object.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a string, else `false`.
   * @example
   *
   * _.isString('abc');
   * // => true
   *
   * _.isString(1);
   * // => false
   */
  function isString(value) {
    return typeof value == 'string' ||
      (!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag);
  }

  /**
   * Checks if `value` is classified as a `Symbol` primitive or object.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a symbol, else `false`.
   * @example
   *
   * _.isSymbol(Symbol.iterator);
   * // => true
   *
   * _.isSymbol('abc');
   * // => false
   */
  function isSymbol(value) {
    return typeof value == 'symbol' ||
      (isObjectLike(value) && baseGetTag(value) == symbolTag);
  }

  /**
   * Checks if `value` is classified as a typed array.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.
   * @example
   *
   * _.isTypedArray(new Uint8Array);
   * // => true
   *
   * _.isTypedArray([]);
   * // => false
   */
  var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray;

  /**
   * Checks if `value` is `undefined`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `undefined`, else `false`.
   * @example
   *
   * _.isUndefined(void 0);
   * // => true
   *
   * _.isUndefined(null);
   * // => false
   */
  function isUndefined(value) {
    return value === undefined;
  }

  /**
   * Converts `value` to an array.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {Array} Returns the converted array.
   * @example
   *
   * _.toArray({ 'a': 1, 'b': 2 });
   * // => [1, 2]
   *
   * _.toArray('abc');
   * // => ['a', 'b', 'c']
   *
   * _.toArray(1);
   * // => []
   *
   * _.toArray(null);
   * // => []
   */
  function toArray(value) {
    if (!value) {
      return [];
    }
    if (isArrayLike(value)) {
      return isString(value) ? stringToArray(value) : copyArray(value);
    }
    if (symIterator && value[symIterator]) {
      return iteratorToArray(value[symIterator]());
    }
    var tag = getTag(value),
        func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values);

    return func(value);
  }

  /**
   * Converts `value` to a finite number.
   *
   * @static
   * @memberOf _
   * @since 4.12.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {number} Returns the converted number.
   * @example
   *
   * _.toFinite(3.2);
   * // => 3.2
   *
   * _.toFinite(Number.MIN_VALUE);
   * // => 5e-324
   *
   * _.toFinite(Infinity);
   * // => 1.7976931348623157e+308
   *
   * _.toFinite('3.2');
   * // => 3.2
   */
  function toFinite(value) {
    if (!value) {
      return value === 0 ? value : 0;
    }
    value = toNumber(value);
    if (value === INFINITY || value === -INFINITY) {
      var sign = (value < 0 ? -1 : 1);
      return sign * MAX_INTEGER;
    }
    return value === value ? value : 0;
  }

  /**
   * Converts `value` to an integer.
   *
   * **Note:** This method is loosely based on
   * [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {number} Returns the converted integer.
   * @example
   *
   * _.toInteger(3.2);
   * // => 3
   *
   * _.toInteger(Number.MIN_VALUE);
   * // => 0
   *
   * _.toInteger(Infinity);
   * // => 1.7976931348623157e+308
   *
   * _.toInteger('3.2');
   * // => 3
   */
  function toInteger(value) {
    var result = toFinite(value),
        remainder = result % 1;

    return result === result ? (remainder ? result - remainder : result) : 0;
  }

  /**
   * Converts `value` to a number.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to process.
   * @returns {number} Returns the number.
   * @example
   *
   * _.toNumber(3.2);
   * // => 3.2
   *
   * _.toNumber(Number.MIN_VALUE);
   * // => 5e-324
   *
   * _.toNumber(Infinity);
   * // => Infinity
   *
   * _.toNumber('3.2');
   * // => 3.2
   */
  function toNumber(value) {
    if (typeof value == 'number') {
      return value;
    }
    if (isSymbol(value)) {
      return NAN;
    }
    if (isObject(value)) {
      var other = typeof value.valueOf == 'function' ? value.valueOf() : value;
      value = isObject(other) ? (other + '') : other;
    }
    if (typeof value != 'string') {
      return value === 0 ? value : +value;
    }
    value = value.replace(reTrim, '');
    var isBinary = reIsBinary.test(value);
    return (isBinary || reIsOctal.test(value))
      ? freeParseInt(value.slice(2), isBinary ? 2 : 8)
      : (reIsBadHex.test(value) ? NAN : +value);
  }

  /**
   * Converts `value` to a plain object flattening inherited enumerable string
   * keyed properties of `value` to own properties of the plain object.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {Object} Returns the converted plain object.
   * @example
   *
   * function Foo() {
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.assign({ 'a': 1 }, new Foo);
   * // => { 'a': 1, 'b': 2 }
   *
   * _.assign({ 'a': 1 }, _.toPlainObject(new Foo));
   * // => { 'a': 1, 'b': 2, 'c': 3 }
   */
  function toPlainObject(value) {
    return copyObject(value, keysIn(value));
  }

  /**
   * Converts `value` to a string. An empty string is returned for `null`
   * and `undefined` values. The sign of `-0` is preserved.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {string} Returns the converted string.
   * @example
   *
   * _.toString(null);
   * // => ''
   *
   * _.toString(-0);
   * // => '-0'
   *
   * _.toString([1, 2, 3]);
   * // => '1,2,3'
   */
  function toString(value) {
    return value == null ? '' : baseToString(value);
  }

  /*------------------------------------------------------------------------*/

  /**
   * This method is like `_.assign` except that it iterates over own and
   * inherited source properties.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @alias extend
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.assign
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   * }
   *
   * function Bar() {
   *   this.c = 3;
   * }
   *
   * Foo.prototype.b = 2;
   * Bar.prototype.d = 4;
   *
   * _.assignIn({ 'a': 0 }, new Foo, new Bar);
   * // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 }
   */
  var assignIn = createAssigner(function(object, source) {
    copyObject(source, keysIn(source), object);
  });

  /**
   * Creates an object that inherits from the `prototype` object. If a
   * `properties` object is given, its own enumerable string keyed properties
   * are assigned to the created object.
   *
   * @static
   * @memberOf _
   * @since 2.3.0
   * @category Object
   * @param {Object} prototype The object to inherit from.
   * @param {Object} [properties] The properties to assign to the object.
   * @returns {Object} Returns the new object.
   * @example
   *
   * function Shape() {
   *   this.x = 0;
   *   this.y = 0;
   * }
   *
   * function Circle() {
   *   Shape.call(this);
   * }
   *
   * Circle.prototype = _.create(Shape.prototype, {
   *   'constructor': Circle
   * });
   *
   * var circle = new Circle;
   * circle instanceof Circle;
   * // => true
   *
   * circle instanceof Shape;
   * // => true
   */
  function create(prototype, properties) {
    var result = baseCreate(prototype);
    return properties == null ? result : baseAssign(result, properties);
  }

  /**
   * Assigns own and inherited enumerable string keyed properties of source
   * objects to the destination object for all destination properties that
   * resolve to `undefined`. Source objects are applied from left to right.
   * Once a property is set, additional values of the same property are ignored.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.defaultsDeep
   * @example
   *
   * _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 });
   * // => { 'a': 1, 'b': 2 }
   */
  var defaults = baseRest(function(object, sources) {
    object = Object(object);

    var index = -1;
    var length = sources.length;
    var guard = length > 2 ? sources[2] : undefined;

    if (guard && isIterateeCall(sources[0], sources[1], guard)) {
      length = 1;
    }

    while (++index < length) {
      var source = sources[index];
      var props = keysIn(source);
      var propsIndex = -1;
      var propsLength = props.length;

      while (++propsIndex < propsLength) {
        var key = props[propsIndex];
        var value = object[key];

        if (value === undefined ||
            (eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) {
          object[key] = source[key];
        }
      }
    }

    return object;
  });

  /**
   * This method is like `_.defaults` except that it recursively assigns
   * default properties.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 3.10.0
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.defaults
   * @example
   *
   * _.defaultsDeep({ 'a': { 'b': 2 } }, { 'a': { 'b': 1, 'c': 3 } });
   * // => { 'a': { 'b': 2, 'c': 3 } }
   */
  var defaultsDeep = baseRest(function(args) {
    args.push(undefined, customDefaultsMerge);
    return apply(mergeWith, undefined, args);
  });

  /**
   * This method is like `_.find` except that it returns the key of the first
   * element `predicate` returns truthy for instead of the element itself.
   *
   * @static
   * @memberOf _
   * @since 1.1.0
   * @category Object
   * @param {Object} object The object to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {string|undefined} Returns the key of the matched element,
   *  else `undefined`.
   * @example
   *
   * var users = {
   *   'barney':  { 'age': 36, 'active': true },
   *   'fred':    { 'age': 40, 'active': false },
   *   'pebbles': { 'age': 1,  'active': true }
   * };
   *
   * _.findKey(users, function(o) { return o.age < 40; });
   * // => 'barney' (iteration order is not guaranteed)
   *
   * // The `_.matches` iteratee shorthand.
   * _.findKey(users, { 'age': 1, 'active': true });
   * // => 'pebbles'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findKey(users, ['active', false]);
   * // => 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.findKey(users, 'active');
   * // => 'barney'
   */
  function findKey(object, predicate) {
    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn);
  }

  /**
   * This method is like `_.findKey` except that it iterates over elements of
   * a collection in the opposite order.
   *
   * @static
   * @memberOf _
   * @since 2.0.0
   * @category Object
   * @param {Object} object The object to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {string|undefined} Returns the key of the matched element,
   *  else `undefined`.
   * @example
   *
   * var users = {
   *   'barney':  { 'age': 36, 'active': true },
   *   'fred':    { 'age': 40, 'active': false },
   *   'pebbles': { 'age': 1,  'active': true }
   * };
   *
   * _.findLastKey(users, function(o) { return o.age < 40; });
   * // => returns 'pebbles' assuming `_.findKey` returns 'barney'
   *
   * // The `_.matches` iteratee shorthand.
   * _.findLastKey(users, { 'age': 36, 'active': true });
   * // => 'barney'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findLastKey(users, ['active', false]);
   * // => 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.findLastKey(users, 'active');
   * // => 'pebbles'
   */
  function findLastKey(object, predicate) {
    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight);
  }

  /**
   * Gets the value at `path` of `object`. If the resolved value is
   * `undefined`, the `defaultValue` is returned in its place.
   *
   * @static
   * @memberOf _
   * @since 3.7.0
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to get.
   * @param {*} [defaultValue] The value returned for `undefined` resolved values.
   * @returns {*} Returns the resolved value.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c': 3 } }] };
   *
   * _.get(object, 'a[0].b.c');
   * // => 3
   *
   * _.get(object, ['a', '0', 'b', 'c']);
   * // => 3
   *
   * _.get(object, 'a.b.c', 'default');
   * // => 'default'
   */
  function get(object, path, defaultValue) {
    var result = object == null ? undefined : baseGet(object, path);
    return result === undefined ? defaultValue : result;
  }

  /**
   * Checks if `path` is a direct property of `object`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   * @example
   *
   * var object = { 'a': { 'b': 2 } };
   * var other = _.create({ 'a': _.create({ 'b': 2 }) });
   *
   * _.has(object, 'a');
   * // => true
   *
   * _.has(object, 'a.b');
   * // => true
   *
   * _.has(object, ['a', 'b']);
   * // => true
   *
   * _.has(other, 'a');
   * // => false
   */
  function has(object, path) {
    return object != null && hasPath(object, path, baseHas);
  }

  /**
   * Checks if `path` is a direct or inherited property of `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   * @example
   *
   * var object = _.create({ 'a': _.create({ 'b': 2 }) });
   *
   * _.hasIn(object, 'a');
   * // => true
   *
   * _.hasIn(object, 'a.b');
   * // => true
   *
   * _.hasIn(object, ['a', 'b']);
   * // => true
   *
   * _.hasIn(object, 'b');
   * // => false
   */
  function hasIn(object, path) {
    return object != null && hasPath(object, path, baseHasIn);
  }

  /**
   * Creates an object composed of the inverted keys and values of `object`.
   * If `object` contains duplicate values, subsequent values overwrite
   * property assignments of previous values.
   *
   * @static
   * @memberOf _
   * @since 0.7.0
   * @category Object
   * @param {Object} object The object to invert.
   * @returns {Object} Returns the new inverted object.
   * @example
   *
   * var object = { 'a': 1, 'b': 2, 'c': 1 };
   *
   * _.invert(object);
   * // => { '1': 'c', '2': 'b' }
   */
  var invert = createInverter(function(result, value, key) {
    if (value != null &&
        typeof value.toString != 'function') {
      value = nativeObjectToString.call(value);
    }

    result[value] = key;
  }, constant(identity));

  /**
   * This method is like `_.invert` except that the inverted object is generated
   * from the results of running each element of `object` thru `iteratee`. The
   * corresponding inverted value of each inverted key is an array of keys
   * responsible for generating the inverted value. The iteratee is invoked
   * with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 4.1.0
   * @category Object
   * @param {Object} object The object to invert.
   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.
   * @returns {Object} Returns the new inverted object.
   * @example
   *
   * var object = { 'a': 1, 'b': 2, 'c': 1 };
   *
   * _.invertBy(object);
   * // => { '1': ['a', 'c'], '2': ['b'] }
   *
   * _.invertBy(object, function(value) {
   *   return 'group' + value;
   * });
   * // => { 'group1': ['a', 'c'], 'group2': ['b'] }
   */
  var invertBy = createInverter(function(result, value, key) {
    if (value != null &&
        typeof value.toString != 'function') {
      value = nativeObjectToString.call(value);
    }

    if (hasOwnProperty.call(result, value)) {
      result[value].push(key);
    } else {
      result[value] = [key];
    }
  }, baseIteratee);

  /**
   * Creates an array of the own enumerable property names of `object`.
   *
   * **Note:** Non-object values are coerced to objects. See the
   * [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)
   * for more details.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.keys(new Foo);
   * // => ['a', 'b'] (iteration order is not guaranteed)
   *
   * _.keys('hi');
   * // => ['0', '1']
   */
  function keys(object) {
    return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object);
  }

  /**
   * Creates an array of the own and inherited enumerable property names of `object`.
   *
   * **Note:** Non-object values are coerced to objects.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.keysIn(new Foo);
   * // => ['a', 'b', 'c'] (iteration order is not guaranteed)
   */
  function keysIn(object) {
    return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object);
  }

  /**
   * This method is like `_.merge` except that it accepts `customizer` which
   * is invoked to produce the merged values of the destination and source
   * properties. If `customizer` returns `undefined`, merging is handled by the
   * method instead. The `customizer` is invoked with six arguments:
   * (objValue, srcValue, key, object, source, stack).
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} sources The source objects.
   * @param {Function} customizer The function to customize assigned values.
   * @returns {Object} Returns `object`.
   * @example
   *
   * function customizer(objValue, srcValue) {
   *   if (_.isArray(objValue)) {
   *     return objValue.concat(srcValue);
   *   }
   * }
   *
   * var object = { 'a': [1], 'b': [2] };
   * var other = { 'a': [3], 'b': [4] };
   *
   * _.mergeWith(object, other, customizer);
   * // => { 'a': [1, 3], 'b': [2, 4] }
   */
  var mergeWith = createAssigner(function(object, source, srcIndex, customizer) {
    baseMerge(object, source, srcIndex, customizer);
  });

  /**
   * The opposite of `_.pick`; this method creates an object composed of the
   * own and inherited enumerable property paths of `object` that are not omitted.
   *
   * **Note:** This method is considerably slower than `_.pick`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The source object.
   * @param {...(string|string[])} [paths] The property paths to omit.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.omit(object, ['a', 'c']);
   * // => { 'b': '2' }
   */
  var omit = flatRest(function(object, paths) {
    var result = {};
    if (object == null) {
      return result;
    }
    var isDeep = false;
    paths = arrayMap(paths, function(path) {
      path = castPath(path, object);
      isDeep || (isDeep = path.length > 1);
      return path;
    });
    copyObject(object, getAllKeysIn(object), result);
    if (isDeep) {
      result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone);
    }
    var length = paths.length;
    while (length--) {
      baseUnset(result, paths[length]);
    }
    return result;
  });

  /**
   * The opposite of `_.pickBy`; this method creates an object composed of
   * the own and inherited enumerable string keyed properties of `object` that
   * `predicate` doesn't return truthy for. The predicate is invoked with two
   * arguments: (value, key).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The source object.
   * @param {Function} [predicate=_.identity] The function invoked per property.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.omitBy(object, _.isNumber);
   * // => { 'b': '2' }
   */
  function omitBy(object, predicate) {
    return pickBy(object, negate(baseIteratee(predicate)));
  }

  /**
   * Creates an object composed of the picked `object` properties.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The source object.
   * @param {...(string|string[])} [paths] The property paths to pick.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.pick(object, ['a', 'c']);
   * // => { 'a': 1, 'c': 3 }
   */
  var pick = flatRest(function(object, paths) {
    return object == null ? {} : basePick(object, paths);
  });

  /**
   * Creates an object composed of the `object` properties `predicate` returns
   * truthy for. The predicate is invoked with two arguments: (value, key).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The source object.
   * @param {Function} [predicate=_.identity] The function invoked per property.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.pickBy(object, _.isNumber);
   * // => { 'a': 1, 'c': 3 }
   */
  function pickBy(object, predicate) {
    if (object == null) {
      return {};
    }
    var props = arrayMap(getAllKeysIn(object), function(prop) {
      return [prop];
    });
    predicate = baseIteratee(predicate);
    return basePickBy(object, props, function(value, path) {
      return predicate(value, path[0]);
    });
  }

  /**
   * This method is like `_.get` except that if the resolved value is a
   * function it's invoked with the `this` binding of its parent object and
   * its result is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to resolve.
   * @param {*} [defaultValue] The value returned for `undefined` resolved values.
   * @returns {*} Returns the resolved value.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] };
   *
   * _.result(object, 'a[0].b.c1');
   * // => 3
   *
   * _.result(object, 'a[0].b.c2');
   * // => 4
   *
   * _.result(object, 'a[0].b.c3', 'default');
   * // => 'default'
   *
   * _.result(object, 'a[0].b.c3', _.constant('default'));
   * // => 'default'
   */
  function result(object, path, defaultValue) {
    path = castPath(path, object);

    var index = -1,
        length = path.length;

    // Ensure the loop is entered when path is empty.
    if (!length) {
      length = 1;
      object = undefined;
    }
    while (++index < length) {
      var value = object == null ? undefined : object[toKey(path[index])];
      if (value === undefined) {
        index = length;
        value = defaultValue;
      }
      object = isFunction(value) ? value.call(object) : value;
    }
    return object;
  }

  /**
   * Creates an array of the own enumerable string keyed property values of `object`.
   *
   * **Note:** Non-object values are coerced to objects.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property values.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.values(new Foo);
   * // => [1, 2] (iteration order is not guaranteed)
   *
   * _.values('hi');
   * // => ['h', 'i']
   */
  function values(object) {
    return object == null ? [] : baseValues(object, keys(object));
  }

  /*------------------------------------------------------------------------*/

  /**
   * Clamps `number` within the inclusive `lower` and `upper` bounds.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Number
   * @param {number} number The number to clamp.
   * @param {number} [lower] The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the clamped number.
   * @example
   *
   * _.clamp(-10, -5, 5);
   * // => -5
   *
   * _.clamp(10, -5, 5);
   * // => 5
   */
  function clamp(number, lower, upper) {
    if (upper === undefined) {
      upper = lower;
      lower = undefined;
    }
    if (upper !== undefined) {
      upper = toNumber(upper);
      upper = upper === upper ? upper : 0;
    }
    if (lower !== undefined) {
      lower = toNumber(lower);
      lower = lower === lower ? lower : 0;
    }
    return baseClamp(toNumber(number), lower, upper);
  }

  /**
   * Produces a random number between the inclusive `lower` and `upper` bounds.
   * If only one argument is provided a number between `0` and the given number
   * is returned. If `floating` is `true`, or either `lower` or `upper` are
   * floats, a floating-point number is returned instead of an integer.
   *
   * **Note:** JavaScript follows the IEEE-754 standard for resolving
   * floating-point values which can produce unexpected results.
   *
   * @static
   * @memberOf _
   * @since 0.7.0
   * @category Number
   * @param {number} [lower=0] The lower bound.
   * @param {number} [upper=1] The upper bound.
   * @param {boolean} [floating] Specify returning a floating-point number.
   * @returns {number} Returns the random number.
   * @example
   *
   * _.random(0, 5);
   * // => an integer between 0 and 5
   *
   * _.random(5);
   * // => also an integer between 0 and 5
   *
   * _.random(5, true);
   * // => a floating-point number between 0 and 5
   *
   * _.random(1.2, 5.2);
   * // => a floating-point number between 1.2 and 5.2
   */
  function random(lower, upper, floating) {
    if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) {
      upper = floating = undefined;
    }
    if (floating === undefined) {
      if (typeof upper == 'boolean') {
        floating = upper;
        upper = undefined;
      }
      else if (typeof lower == 'boolean') {
        floating = lower;
        lower = undefined;
      }
    }
    if (lower === undefined && upper === undefined) {
      lower = 0;
      upper = 1;
    }
    else {
      lower = toFinite(lower);
      if (upper === undefined) {
        upper = lower;
        lower = 0;
      } else {
        upper = toFinite(upper);
      }
    }
    if (lower > upper) {
      var temp = lower;
      lower = upper;
      upper = temp;
    }
    if (floating || lower % 1 || upper % 1) {
      var rand = nativeRandom();
      return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper);
    }
    return baseRandom(lower, upper);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Converts the characters "&", "<", ">", '"', and "'" in `string` to their
   * corresponding HTML entities.
   *
   * **Note:** No other characters are escaped. To escape additional
   * characters use a third-party library like [_he_](https://mths.be/he).
   *
   * Though the ">" character is escaped for symmetry, characters like
   * ">" and "/" don't need escaping in HTML and have no special meaning
   * unless they're part of a tag or unquoted attribute value. See
   * [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands)
   * (under "semi-related fun fact") for more details.
   *
   * When working with HTML you should always
   * [quote attribute values](http://wonko.com/post/html-escaping) to reduce
   * XSS vectors.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category String
   * @param {string} [string=''] The string to escape.
   * @returns {string} Returns the escaped string.
   * @example
   *
   * _.escape('fred, barney, & pebbles');
   * // => 'fred, barney, &amp; pebbles'
   */
  function escape(string) {
    string = toString(string);
    return (string && reHasUnescapedHtml.test(string))
      ? string.replace(reUnescapedHtml, escapeHtmlChar)
      : string;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a function that returns `value`.
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Util
   * @param {*} value The value to return from the new function.
   * @returns {Function} Returns the new constant function.
   * @example
   *
   * var objects = _.times(2, _.constant({ 'a': 1 }));
   *
   * console.log(objects);
   * // => [{ 'a': 1 }, { 'a': 1 }]
   *
   * console.log(objects[0] === objects[1]);
   * // => true
   */
  function constant(value) {
    return function() {
      return value;
    };
  }

  /**
   * This method returns the first argument it receives.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {*} value Any value.
   * @returns {*} Returns `value`.
   * @example
   *
   * var object = { 'a': 1 };
   *
   * console.log(_.identity(object) === object);
   * // => true
   */
  function identity(value) {
    return value;
  }

  /**
   * Creates a function that invokes `func` with the arguments of the created
   * function. If `func` is a property name, the created function returns the
   * property value for a given element. If `func` is an array or object, the
   * created function returns `true` for elements that contain the equivalent
   * source properties, otherwise it returns `false`.
   *
   * @static
   * @since 4.0.0
   * @memberOf _
   * @category Util
   * @param {*} [func=_.identity] The value to convert to a callback.
   * @returns {Function} Returns the callback.
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': true },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.filter(users, _.iteratee({ 'user': 'barney', 'active': true }));
   * // => [{ 'user': 'barney', 'age': 36, 'active': true }]
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.filter(users, _.iteratee(['user', 'fred']));
   * // => [{ 'user': 'fred', 'age': 40 }]
   *
   * // The `_.property` iteratee shorthand.
   * _.map(users, _.iteratee('user'));
   * // => ['barney', 'fred']
   *
   * // Create custom iteratee shorthands.
   * _.iteratee = _.wrap(_.iteratee, function(iteratee, func) {
   *   return !_.isRegExp(func) ? iteratee(func) : function(string) {
   *     return func.test(string);
   *   };
   * });
   *
   * _.filter(['abc', 'def'], /ef/);
   * // => ['def']
   */
  function iteratee(func) {
    return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG));
  }

  /**
   * Creates a function that performs a partial deep comparison between a given
   * object and `source`, returning `true` if the given object has equivalent
   * property values, else `false`.
   *
   * **Note:** The created function is equivalent to `_.isMatch` with `source`
   * partially applied.
   *
   * Partial comparisons will match empty array and empty object `source`
   * values against any array or object value, respectively. See `_.isEqual`
   * for a list of supported value comparisons.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Util
   * @param {Object} source The object of property values to match.
   * @returns {Function} Returns the new spec function.
   * @example
   *
   * var objects = [
   *   { 'a': 1, 'b': 2, 'c': 3 },
   *   { 'a': 4, 'b': 5, 'c': 6 }
   * ];
   *
   * _.filter(objects, _.matches({ 'a': 4, 'c': 6 }));
   * // => [{ 'a': 4, 'b': 5, 'c': 6 }]
   */
  function matches(source) {
    return baseMatches(baseClone(source, CLONE_DEEP_FLAG));
  }

  /**
   * Adds all own enumerable string keyed function properties of a source
   * object to the destination object. If `object` is a function, then methods
   * are added to its prototype as well.
   *
   * **Note:** Use `_.runInContext` to create a pristine `lodash` function to
   * avoid conflicts caused by modifying the original.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {Function|Object} [object=lodash] The destination object.
   * @param {Object} source The object of functions to add.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.chain=true] Specify whether mixins are chainable.
   * @returns {Function|Object} Returns `object`.
   * @example
   *
   * function vowels(string) {
   *   return _.filter(string, function(v) {
   *     return /[aeiou]/i.test(v);
   *   });
   * }
   *
   * _.mixin({ 'vowels': vowels });
   * _.vowels('fred');
   * // => ['e']
   *
   * _('fred').vowels().value();
   * // => ['e']
   *
   * _.mixin({ 'vowels': vowels }, { 'chain': false });
   * _('fred').vowels();
   * // => ['e']
   */
  function mixin(object, source, options) {
    var props = keys(source),
        methodNames = baseFunctions(source, props);

    if (options == null &&
        !(isObject(source) && (methodNames.length || !props.length))) {
      options = source;
      source = object;
      object = this;
      methodNames = baseFunctions(source, keys(source));
    }
    var chain = !(isObject(options) && 'chain' in options) || !!options.chain,
        isFunc = isFunction(object);

    arrayEach(methodNames, function(methodName) {
      var func = source[methodName];
      object[methodName] = func;
      if (isFunc) {
        object.prototype[methodName] = function() {
          var chainAll = this.__chain__;
          if (chain || chainAll) {
            var result = object(this.__wrapped__),
                actions = result.__actions__ = copyArray(this.__actions__);

            actions.push({ 'func': func, 'args': arguments, 'thisArg': object });
            result.__chain__ = chainAll;
            return result;
          }
          return func.apply(object, arrayPush([this.value()], arguments));
        };
      }
    });

    return object;
  }

  /**
   * Reverts the `_` variable to its previous value and returns a reference to
   * the `lodash` function.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @returns {Function} Returns the `lodash` function.
   * @example
   *
   * var lodash = _.noConflict();
   */
  function noConflict() {
    if (root._ === this) {
      root._ = oldDash;
    }
    return this;
  }

  /**
   * This method returns `undefined`.
   *
   * @static
   * @memberOf _
   * @since 2.3.0
   * @category Util
   * @example
   *
   * _.times(2, _.noop);
   * // => [undefined, undefined]
   */
  function noop() {
    // No operation performed.
  }

  /**
   * Creates a function that returns the value at `path` of a given object.
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Util
   * @param {Array|string} path The path of the property to get.
   * @returns {Function} Returns the new accessor function.
   * @example
   *
   * var objects = [
   *   { 'a': { 'b': 2 } },
   *   { 'a': { 'b': 1 } }
   * ];
   *
   * _.map(objects, _.property('a.b'));
   * // => [2, 1]
   *
   * _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b');
   * // => [1, 2]
   */
  function property(path) {
    return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path);
  }

  /**
   * Creates an array of numbers (positive and/or negative) progressing from
   * `start` up to, but not including, `end`. A step of `-1` is used if a negative
   * `start` is specified without an `end` or `step`. If `end` is not specified,
   * it's set to `start` with `start` then set to `0`.
   *
   * **Note:** JavaScript follows the IEEE-754 standard for resolving
   * floating-point values which can produce unexpected results.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {number} [start=0] The start of the range.
   * @param {number} end The end of the range.
   * @param {number} [step=1] The value to increment or decrement by.
   * @returns {Array} Returns the range of numbers.
   * @see _.inRange, _.rangeRight
   * @example
   *
   * _.range(4);
   * // => [0, 1, 2, 3]
   *
   * _.range(-4);
   * // => [0, -1, -2, -3]
   *
   * _.range(1, 5);
   * // => [1, 2, 3, 4]
   *
   * _.range(0, 20, 5);
   * // => [0, 5, 10, 15]
   *
   * _.range(0, -4, -1);
   * // => [0, -1, -2, -3]
   *
   * _.range(1, 4, 0);
   * // => [1, 1, 1]
   *
   * _.range(0);
   * // => []
   */
  var range = createRange();

  /**
   * This method returns a new empty array.
   *
   * @static
   * @memberOf _
   * @since 4.13.0
   * @category Util
   * @returns {Array} Returns the new empty array.
   * @example
   *
   * var arrays = _.times(2, _.stubArray);
   *
   * console.log(arrays);
   * // => [[], []]
   *
   * console.log(arrays[0] === arrays[1]);
   * // => false
   */
  function stubArray() {
    return [];
  }

  /**
   * This method returns `false`.
   *
   * @static
   * @memberOf _
   * @since 4.13.0
   * @category Util
   * @returns {boolean} Returns `false`.
   * @example
   *
   * _.times(2, _.stubFalse);
   * // => [false, false]
   */
  function stubFalse() {
    return false;
  }

  /**
   * Generates a unique ID. If `prefix` is given, the ID is appended to it.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {string} [prefix=''] The value to prefix the ID with.
   * @returns {string} Returns the unique ID.
   * @example
   *
   * _.uniqueId('contact_');
   * // => 'contact_104'
   *
   * _.uniqueId();
   * // => '105'
   */
  function uniqueId(prefix) {
    var id = ++idCounter;
    return toString(prefix) + id;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Computes the maximum value of `array`. If `array` is empty or falsey,
   * `undefined` is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Math
   * @param {Array} array The array to iterate over.
   * @returns {*} Returns the maximum value.
   * @example
   *
   * _.max([4, 2, 8, 6]);
   * // => 8
   *
   * _.max([]);
   * // => undefined
   */
  function max(array) {
    return (array && array.length)
      ? baseExtremum(array, identity, baseGt)
      : undefined;
  }

  /**
   * Computes the minimum value of `array`. If `array` is empty or falsey,
   * `undefined` is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Math
   * @param {Array} array The array to iterate over.
   * @returns {*} Returns the minimum value.
   * @example
   *
   * _.min([4, 2, 8, 6]);
   * // => 2
   *
   * _.min([]);
   * // => undefined
   */
  function min(array) {
    return (array && array.length)
      ? baseExtremum(array, identity, baseLt)
      : undefined;
  }

  /*------------------------------------------------------------------------*/

  // Add methods that return wrapped values in chain sequences.
  lodash.assignIn = assignIn;
  lodash.before = before;
  lodash.bind = bind;
  lodash.chain = chain;
  lodash.compact = compact;
  lodash.concat = concat;
  lodash.countBy = countBy;
  lodash.create = create;
  lodash.debounce = debounce;
  lodash.defaults = defaults;
  lodash.defaultsDeep = defaultsDeep;
  lodash.defer = defer;
  lodash.delay = delay;
  lodash.difference = difference;
  lodash.drop = drop;
  lodash.filter = filter;
  lodash.flatten = flatten;
  lodash.flattenDeep = flattenDeep;
  lodash.initial = initial;
  lodash.intersection = intersection;
  lodash.invert = invert;
  lodash.invertBy = invertBy;
  lodash.iteratee = iteratee;
  lodash.keys = keys;
  lodash.map = map;
  lodash.matches = matches;
  lodash.mixin = mixin;
  lodash.negate = negate;
  lodash.omit = omit;
  lodash.omitBy = omitBy;
  lodash.once = once;
  lodash.pick = pick;
  lodash.range = range;
  lodash.reject = reject;
  lodash.rest = rest;
  lodash.slice = slice;
  lodash.sortBy = sortBy;
  lodash.take = take;
  lodash.takeRight = takeRight;
  lodash.tap = tap;
  lodash.throttle = throttle;
  lodash.thru = thru;
  lodash.toArray = toArray;
  lodash.union = union;
  lodash.uniq = uniq;
  lodash.uniqBy = uniqBy;
  lodash.unzip = unzip;
  lodash.values = values;
  lodash.without = without;
  lodash.zip = zip;
  lodash.zipObject = zipObject;

  // Add aliases.
  lodash.extend = assignIn;

  // Add methods to `lodash.prototype`.
  mixin(lodash, lodash);

  /*------------------------------------------------------------------------*/

  // Add methods that return unwrapped values in chain sequences.
  lodash.clamp = clamp;
  lodash.clone = clone;
  lodash.cloneDeep = cloneDeep;
  lodash.escape = escape;
  lodash.every = every;
  lodash.find = find;
  lodash.findIndex = findIndex;
  lodash.findKey = findKey;
  lodash.findLastIndex = findLastIndex;
  lodash.findLastKey = findLastKey;
  lodash.forEach = forEach;
  lodash.get = get;
  lodash.has = has;
  lodash.head = head;
  lodash.identity = identity;
  lodash.indexOf = indexOf;
  lodash.isArguments = isArguments;
  lodash.isArray = isArray;
  lodash.isArrayLike = isArrayLike;
  lodash.isBoolean = isBoolean;
  lodash.isDate = isDate;
  lodash.isEmpty = isEmpty;
  lodash.isEqual = isEqual;
  lodash.isFinite = isFinite;
  lodash.isFunction = isFunction;
  lodash.isNaN = isNaN;
  lodash.isNull = isNull;
  lodash.isNumber = isNumber;
  lodash.isObject = isObject;
  lodash.isPlainObject = isPlainObject;
  lodash.isRegExp = isRegExp;
  lodash.isString = isString;
  lodash.isUndefined = isUndefined;
  lodash.last = last;
  lodash.max = max;
  lodash.min = min;
  lodash.noConflict = noConflict;
  lodash.noop = noop;
  lodash.random = random;
  lodash.reduce = reduce;
  lodash.result = result;
  lodash.size = size;
  lodash.some = some;
  lodash.uniqueId = uniqueId;

  // Add aliases.
  lodash.each = forEach;
  lodash.first = head;

  mixin(lodash, (function() {
    var source = {};
    baseForOwn(lodash, function(func, methodName) {
      if (!hasOwnProperty.call(lodash.prototype, methodName)) {
        source[methodName] = func;
      }
    });
    return source;
  }()), { 'chain': false });

  /*------------------------------------------------------------------------*/

  /**
   * The semantic version number.
   *
   * @static
   * @memberOf _
   * @type {string}
   */
  lodash.VERSION = VERSION;

  // Add `LazyWrapper` methods for `_.drop` and `_.take` variants.
  arrayEach(['drop', 'take'], function(methodName, index) {
    LazyWrapper.prototype[methodName] = function(n) {
      n = n === undefined ? 1 : nativeMax(toInteger(n), 0);

      var result = (this.__filtered__ && !index)
        ? new LazyWrapper(this)
        : this.clone();

      if (result.__filtered__) {
        result.__takeCount__ = nativeMin(n, result.__takeCount__);
      } else {
        result.__views__.push({
          'size': nativeMin(n, MAX_ARRAY_LENGTH),
          'type': methodName + (result.__dir__ < 0 ? 'Right' : '')
        });
      }
      return result;
    };

    LazyWrapper.prototype[methodName + 'Right'] = function(n) {
      return this.reverse()[methodName](n).reverse();
    };
  });

  // Add `LazyWrapper` methods that accept an `iteratee` value.
  arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) {
    var type = index + 1,
        isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG;

    LazyWrapper.prototype[methodName] = function(iteratee) {
      var result = this.clone();
      result.__iteratees__.push({
        'iteratee': getIteratee(iteratee, 3),
        'type': type
      });
      result.__filtered__ = result.__filtered__ || isFilter;
      return result;
    };
  });

  // Add `LazyWrapper` methods for `_.head` and `_.last`.
  arrayEach(['head', 'last'], function(methodName, index) {
    var takeName = 'take' + (index ? 'Right' : '');

    LazyWrapper.prototype[methodName] = function() {
      return this[takeName](1).value()[0];
    };
  });

  // Add `LazyWrapper` methods for `_.initial` and `_.tail`.
  arrayEach(['initial', 'tail'], function(methodName, index) {
    var dropName = 'drop' + (index ? '' : 'Right');

    LazyWrapper.prototype[methodName] = function() {
      return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1);
    };
  });

  LazyWrapper.prototype.compact = function() {
    return this.filter(identity);
  };

  LazyWrapper.prototype.find = function(predicate) {
    return this.filter(predicate).head();
  };

  LazyWrapper.prototype.findLast = function(predicate) {
    return this.reverse().find(predicate);
  };

  LazyWrapper.prototype.invokeMap = baseRest(function(path, args) {
    if (typeof path == 'function') {
      return new LazyWrapper(this);
    }
    return this.map(function(value) {
      return baseInvoke(value, path, args);
    });
  });

  LazyWrapper.prototype.reject = function(predicate) {
    return this.filter(negate(getIteratee(predicate)));
  };

  LazyWrapper.prototype.slice = function(start, end) {
    start = toInteger(start);

    var result = this;
    if (result.__filtered__ && (start > 0 || end < 0)) {
      return new LazyWrapper(result);
    }
    if (start < 0) {
      result = result.takeRight(-start);
    } else if (start) {
      result = result.drop(start);
    }
    if (end !== undefined) {
      end = toInteger(end);
      result = end < 0 ? result.dropRight(-end) : result.take(end - start);
    }
    return result;
  };

  LazyWrapper.prototype.takeRightWhile = function(predicate) {
    return this.reverse().takeWhile(predicate).reverse();
  };

  LazyWrapper.prototype.toArray = function() {
    return this.take(MAX_ARRAY_LENGTH);
  };

  // Add `LazyWrapper` methods to `lodash.prototype`.
  baseForOwn(LazyWrapper.prototype, function(func, methodName) {
    var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName),
        isTaker = /^(?:head|last)$/.test(methodName),
        lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName],
        retUnwrapped = isTaker || /^find/.test(methodName);

    if (!lodashFunc) {
      return;
    }
    lodash.prototype[methodName] = function() {
      var value = this.__wrapped__,
          args = isTaker ? [1] : arguments,
          isLazy = value instanceof LazyWrapper,
          iteratee = args[0],
          useLazy = isLazy || isArray(value);

      var interceptor = function(value) {
        var result = lodashFunc.apply(lodash, arrayPush([value], args));
        return (isTaker && chainAll) ? result[0] : result;
      };

      if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) {
        // Avoid lazy use if the iteratee has a "length" value other than `1`.
        isLazy = useLazy = false;
      }
      var chainAll = this.__chain__,
          isHybrid = !!this.__actions__.length,
          isUnwrapped = retUnwrapped && !chainAll,
          onlyLazy = isLazy && !isHybrid;

      if (!retUnwrapped && useLazy) {
        value = onlyLazy ? value : new LazyWrapper(this);
        var result = func.apply(value, args);
        result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined });
        return new LodashWrapper(result, chainAll);
      }
      if (isUnwrapped && onlyLazy) {
        return func.apply(this, args);
      }
      result = this.thru(interceptor);
      return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result;
    };
  });

  // Add `Array` methods to `lodash.prototype`.
  arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) {
    var func = arrayProto[methodName],
        chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru',
        retUnwrapped = /^(?:pop|shift)$/.test(methodName);

    lodash.prototype[methodName] = function() {
      var args = arguments;
      if (retUnwrapped && !this.__chain__) {
        var value = this.value();
        return func.apply(isArray(value) ? value : [], args);
      }
      return this[chainName](function(value) {
        return func.apply(isArray(value) ? value : [], args);
      });
    };
  });

  // Map minified method names to their real names.
  baseForOwn(LazyWrapper.prototype, function(func, methodName) {
    var lodashFunc = lodash[methodName];
    if (lodashFunc) {
      var key = (lodashFunc.name + ''),
          names = realNames[key] || (realNames[key] = []);

      names.push({ 'name': methodName, 'func': lodashFunc });
    }
  });

  realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{
    'name': 'wrapper',
    'func': undefined
  }];

  // Add methods to `LazyWrapper`.
  LazyWrapper.prototype.clone = lazyClone;
  LazyWrapper.prototype.reverse = lazyReverse;
  LazyWrapper.prototype.value = lazyValue;

  // Add lazy aliases.
  lodash.prototype.first = lodash.prototype.head;

  if (symIterator) {
    lodash.prototype[symIterator] = wrapperToIterator;
  }

  /*--------------------------------------------------------------------------*/

  // Some AMD build optimizers, like r.js, check for condition patterns like:
  if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) {
    // Expose Lodash on the global object to prevent errors when Lodash is
    // loaded by a script tag in the presence of an AMD loader.
    // See http://requirejs.org/docs/errors.html#mismatch for more details.
    // Use `_.noConflict` to remove Lodash from the global object.
    root._ = lodash;

    // Define as an anonymous module so, through path mapping, it can be
    // referenced as the "underscore" module.
    define(function() {
      return lodash;
    });
  }
  // Check for `exports` after `define` in case a build optimizer adds it.
  else if (freeModule) {
    // Export for Node.js.
    (freeModule.exports = lodash)._ = lodash;
    // Export for CommonJS support.
    freeExports._ = lodash;
  }
  else {
    // Export to the global object.
    root._ = lodash;
  }
}.call(this));
/**
 * Created by richie on 15/7/8.
 */
/**
 * 初始化BI对象
 */
if (window.BI == null) {
    window.BI = {};
}/**
 * 常量
 */

_.extend(BI, {
    MAX: 0xfffffffffffffff,
    MIN: -0xfffffffffffffff,
    EVENT_RESPONSE_TIME: 200,
    zIndex_layer: 1e5,
    zIndex_popover: 1e6,
    zIndex_popup: 1e7,
    zIndex_masker: 1e8,
    zIndex_tip: 1e9,
    emptyStr: "",
    emptyFn: function () {
    },
    empty: null,
    Key: {
        48: "0",
        49: "1",
        50: "2",
        51: "3",
        52: "4",
        53: "5",
        54: "6",
        55: "7",
        56: "8",
        57: "9",
        65: "a",
        66: "b",
        67: "c",
        68: "d",
        69: "e",
        70: "f",
        71: "g",
        72: "h",
        73: "i",
        74: "j",
        75: "k",
        76: "l",
        77: "m",
        78: "n",
        79: "o",
        80: "p",
        81: "q",
        82: "r",
        83: "s",
        84: "t",
        85: "u",
        86: "v",
        87: "w",
        88: "x",
        89: "y",
        90: "z",
        96: "0",
        97: "1",
        98: "2",
        99: "3",
        100: "4",
        101: "5",
        102: "6",
        103: "7",
        104: "8",
        105: "9",
        106: "*",
        107: "+",
        109: "-",
        110: ".",
        111: "/"
    },
    KeyCode: {
        BACKSPACE: 8,
        COMMA: 188,
        DELETE: 46,
        DOWN: 40,
        END: 35,
        ENTER: 13,
        ESCAPE: 27,
        HOME: 36,
        LEFT: 37,
        NUMPAD_ADD: 107,
        NUMPAD_DECIMAL: 110,
        NUMPAD_DIVIDE: 111,
        NUMPAD_ENTER: 108,
        NUMPAD_MULTIPLY: 106,
        NUMPAD_SUBTRACT: 109,
        PAGE_DOWN: 34,
        PAGE_UP: 33,
        PERIOD: 190,
        RIGHT: 39,
        SPACE: 32,
        TAB: 9,
        UP: 38
    },
    Status: {
        SUCCESS: 1,
        WRONG: 2,
        START: 3,
        END: 4,
        WAITING: 5,
        READY: 6,
        RUNNING: 7,
        OUTOFBOUNDS: 8,
        NULL: -1
    },
    Direction: {
        Top: "top",
        Bottom: "bottom",
        Left: "left",
        Right: "right",
        Custom: "custom"
    },
    Axis: {
        Vertical: "vertical",
        Horizontal: "horizontal"
    },
    Selection: {
        Default: -2,
        None: -1,
        Single: 0,
        Multi: 1,
        All: 2
    },
    HorizontalAlign: {
        Left: "left",
        Right: "right",
        Center: "center",
        Stretch: "stretch"
    },
    VerticalAlign: {
        Middle: "middle",
        Top: "top",
        Bottom: "bottom",
        Stretch: "stretch"
    }
});/**
 * 对数组对象的扩展
 * @class Array
 */
_.extend(Array.prototype, {
    contains: function (o) {
        return this.indexOf(o) > -1;
    },

    /**
     * 从数组中移除指定的值,如果值不在数组中,则不产生任何效果
     * @param {Object} o 要移除的值
     * @return {Array} 移除制定值后的数组
     */
    remove: function (o) {
        var index = this.indexOf(o);
        if (index !== -1) {
            this.splice(index, 1);
        }
        return this;
    },

    pushArray: function (array) {
        for (var i = 0; i < array.length; i++) {
            this.push(array[i]);
        }
    },
    pushDistinct: function (obj) {
        if (!this.contains(obj)) {
            this.push(obj);
        }
    },
    pushDistinctArray: function (array) {
        for (var i = 0, len = array.length; i < len; i++) {
            this.pushDistinct(array[i]);
        }
    }
});
if (!Number.prototype.toFixed || (0.00008).toFixed(3) !== "0.000" ||
    (0.9).toFixed(0) === "0" || (1.255).toFixed(2) !== "1.25" ||
    (1000000000000000128).toFixed(0) !== "1000000000000000128") {
    (function () {
        var base, size, data, i;
        base = 1e7;
        size = 6;
        data = [0, 0, 0, 0, 0, 0];
        function multiply (n, c) {
            var i = -1;
            while (++i < size) {
                c += n * data[i];
                data[i] = c % base;
                c = Math.floor(c / base);
            }
        }

        function divide (n) {
            var i = size, c = 0;
            while (--i >= 0) {
                c += data[i];
                data[i] = Math.floor(c / n);
                c = (c % n) * base;
            }
        }

        function toString () {
            var i = size;
            var s = "";
            while (--i >= 0) {
                if (s !== "" || i === 0 || data[i] !== 0) {
                    var t = String(data[i]);
                    if (s === "") {
                        s = t;
                    } else {
                        s += "0000000".slice(0, 7 - t.length) + t;
                    }
                }
            }
            return s;
        }

        function pow (x, n, acc) {
            return (n === 0 ? acc : (n % 2 === 1 ? pow(x, n - 1, acc * x)
                : pow(x * x, n / 2, acc)));
        }

        function log (x) {
            var n = 0;
            while (x >= 4096) {
                n += 12;
                x /= 4096;
            }
            while (x >= 2) {
                n += 1;
                x /= 2;
            }
            return n;
        }

        Number.prototype.toFixed = function (fractionDigits) {
            var f, x, s, m, e, z, j, k;
            f = Number(fractionDigits);
            f = f !== f ? 0 : Math.floor(f);

            if (f < 0 || f > 20) {
                throw new RangeError("Number.toFixed called with invalid number of decimals");
            }

            x = Number(this);

            if (x !== x) {
                return "NaN";
            }

            if (x <= -1e21 || x > 1e21) {
                return String(x);
            }

            s = "";

            if (x < 0) {
                s = "-";
                x = -x;
            }

            m = "0";

            if (x > 1e-21) {
                // 1e-21<x<1e21
                // -70<log2(x)<70
                e = log(x * pow(2, 69, 1)) - 69;
                z = (e < 0 ? x * pow(2, -e, 1) : x / pow(2, e, 1));
                z *= 0x10000000000000;// Math.pow(2,52);
                e = 52 - e;

                // -18<e<122
                // x=z/2^e
                if (e > 0) {
                    multiply(0, z);
                    j = f;

                    while (j >= 7) {
                        multiply(1e7, 0);
                        j -= 7;
                    }

                    multiply(pow(10, j, 1), 0);
                    j = e - 1;

                    while (j >= 23) {
                        divide(1 << 23);
                        j -= 23;
                    }
                    divide(1 << j);
                    multiply(1, 1);
                    divide(2);
                    m = toString();
                } else {
                    multiply(0, z);
                    multiply(1 << (-e), 0);
                    m = toString() + "0.00000000000000000000".slice(2, 2 + f);
                }
            }

            if (f > 0) {
                k = m.length;

                if (k <= f) {
                    m = s + "0.0000000000000000000".slice(0, f - k + 2) + m;
                } else {
                    m = s + m.slice(0, k - f) + "." + m.slice(k - f);
                }
            } else {
                m = s + m;
            }

            return m;
        };

    })();
}


/**
 ** 加法函数,用来得到精确的加法结果
 ** 说明:javascript的加法结果会有误差,在两个浮点数相加的时候会比较明显。这个函数返回较为精确的加法结果。
 ** 调用:accAdd(arg1,arg2)
 ** 返回值:arg1加上arg2的精确结果
 **/
function accAdd (arg1, arg2) {
    var r1, r2, m, c;
    try {
        r1 = arg1.toString().split(".")[1].length;
    } catch (e) {
        r1 = 0;
    }
    try {
        r2 = arg2.toString().split(".")[1].length;
    } catch (e) {
        r2 = 0;
    }
    c = Math.abs(r1 - r2);
    m = Math.pow(10, Math.max(r1, r2));
    if (c > 0) {
        var cm = Math.pow(10, c);
        if (r1 > r2) {
            arg1 = Number(arg1.toString().replace(".", ""));
            arg2 = Number(arg2.toString().replace(".", "")) * cm;
        } else {
            arg1 = Number(arg1.toString().replace(".", "")) * cm;
            arg2 = Number(arg2.toString().replace(".", ""));
        }
    } else {
        arg1 = Number(arg1.toString().replace(".", ""));
        arg2 = Number(arg2.toString().replace(".", ""));
    }
    return (arg1 + arg2) / m;
}

// 给Number类型增加一个add方法,调用起来更加方便。
Number.prototype.add = function (arg) {
    return accAdd(arg, this);
};
/**
 ** 减法函数,用来得到精确的减法结果
 ** 说明:javascript的减法结果会有误差,在两个浮点数相减的时候会比较明显。这个函数返回较为精确的减法结果。
 ** 调用:accSub(arg1,arg2)
 ** 返回值:arg1加上arg2的精确结果
 **/
function accSub (arg1, arg2) {
    var r1, r2, m, n;
    try {
        r1 = arg1.toString().split(".")[1].length;
    } catch (e) {
        r1 = 0;
    }
    try {
        r2 = arg2.toString().split(".")[1].length;
    } catch (e) {
        r2 = 0;
    }
    m = Math.pow(10, Math.max(r1, r2)); // last modify by deeka //动态控制精度长度
    n = (r1 >= r2) ? r1 : r2;
    return ((arg1 * m - arg2 * m) / m).toFixed(n);
}

// 给Number类型增加一个mul方法,调用起来更加方便。
Number.prototype.sub = function (arg) {
    return accSub(this, arg);
};
/**
 ** 乘法函数,用来得到精确的乘法结果
 ** 说明:javascript的乘法结果会有误差,在两个浮点数相乘的时候会比较明显。这个函数返回较为精确的乘法结果。
 ** 调用:accMul(arg1,arg2)
 ** 返回值:arg1乘以 arg2的精确结果
 **/
function accMul (arg1, arg2) {
    var m = 0, s1 = arg1.toString(), s2 = arg2.toString();
    try {
        m += s1.split(".")[1].length;
    } catch (e) {
    }
    try {
        m += s2.split(".")[1].length;
    } catch (e) {
    }
    return Number(s1.replace(".", "")) * Number(s2.replace(".", "")) / Math.pow(10, m);
}

// 给Number类型增加一个mul方法,调用起来更加方便。
Number.prototype.mul = function (arg) {
    return accMul(arg, this);
};
/**
 ** 除法函数,用来得到精确的除法结果
 ** 说明:javascript的除法结果会有误差,在两个浮点数相除的时候会比较明显。这个函数返回较为精确的除法结果。
 ** 调用:accDiv(arg1,arg2)
 ** 返回值:arg1除以arg2的精确结果
 **/
function accDiv (arg1, arg2) {
    var t1 = 0, t2 = 0, r1, r2;
    try {
        t1 = arg1.toString().split(".")[1].length;
    } catch (e) {
    }
    try {
        t2 = arg2.toString().split(".")[1].length;
    } catch (e) {
    }
    with (Math) {
        r1 = Number(arg1.toString().replace(".", ""));
        r2 = Number(arg2.toString().replace(".", ""));
        return (t2 > t1) ? (r1 / r2) * pow(10, t2 - t1) : (r1 / r2) / pow(10, t1 - t2);
    }
}

// 给Number类型增加一个div方法,调用起来更加方便。
Number.prototype.div = function (arg) {
    return accDiv(this, arg);
};/**
 * 对字符串对象的扩展
 * @class String
 */
_.extend(String.prototype, {

    /**
     * 判断字符串是否已指定的字符串开始
     * @param {String} startTag   指定的开始字符串
     * @return {Boolean}  如果字符串以指定字符串开始则返回true,否则返回false
     */
    startWith: function (startTag) {
        if (startTag == null || startTag == "" || this.length === 0 || startTag.length > this.length) {
            return false;
        }
        return this.substr(0, startTag.length) == startTag;
    },
    /**
     * 判断字符串是否以指定的字符串结束
     * @param {String} endTag 指定的字符串
     * @return {Boolean}  如果字符串以指定字符串结束则返回true,否则返回false
     */
    endWith: function (endTag) {
        if (endTag == null || endTag == "" || this.length === 0 || endTag.length > this.length) {
            return false;
        }
        return this.substring(this.length - endTag.length) == endTag;
    },

    /**
     * 获取url中指定名字的参数
     * @param {String} name 参数的名字
     * @return {String} 参数的值
     */
    getQuery: function (name) {
        var reg = new RegExp("(^|&)" + name + "=([^&]*)(&|$)");
        var r = this.substr(this.indexOf("?") + 1).match(reg);
        if (r) {
            return unescape(r[2]);
        }
        return null;
    },

    /**
     * 给url加上给定的参数
     * @param {Object} paras 参数对象,是一个键值对对象
     * @return {String} 添加了给定参数的url
     */
    appendQuery: function (paras) {
        if (!paras) {
            return this;
        }
        var src = this;
        // 没有问号说明还没有参数
        if (src.indexOf("?") === -1) {
            src += "?";
        }
        // 如果以问号结尾,说明没有其他参数
        if (src.endWith("?") !== false) {
        } else {
            src += "&";
        }
        _.each(paras, function (value, name) {
            if (typeof(name) === "string") {
                src += name + "=" + value + "&";
            }
        });
        src = src.substr(0, src.length - 1);
        return src;
    },
    /**
     * 将所有符合第一个字符串所表示的字符串替换成为第二个字符串
     * @param {String} s1 要替换的字符串的正则表达式
     * @param {String} s2 替换的结果字符串
     * @returns {String} 替换后的字符串
     */
    replaceAll: function (s1, s2) {
        return this.replace(new RegExp(s1, "gm"), s2);
    },
    /**
     * 总是让字符串以指定的字符开头
     * @param {String} start 指定的字符
     * @returns {String} 以指定字符开头的字符串
     */
    perfectStart: function (start) {
        if (this.startWith(start)) {
            return this;
        }
        return start + this;

    },

    /**
     * 获取字符串中某字符串的所有项位置数组
     * @param {String} sub 子字符串
     * @return {Number[]} 子字符串在父字符串中出现的所有位置组成的数组
     */
    allIndexOf: function (sub) {
        if (typeof sub !== "string") {
            return [];
        }
        var str = this;
        var location = [];
        var offset = 0;
        while (str.length > 0) {
            var loc = str.indexOf(sub);
            if (loc === -1) {
                break;
            }
            location.push(offset + loc);
            str = str.substring(loc + sub.length, str.length);
            offset += loc + sub.length;
        }
        return location;
    }
});
/** Constants used for time computations */
Date.SECOND = 1000;
Date.MINUTE = 60 * Date.SECOND;
Date.HOUR = 60 * Date.MINUTE;
Date.DAY = 24 * Date.HOUR;
Date.WEEK = 7 * Date.DAY;

/**
 * 获取时区
 * @returns {String}
 */
Date.prototype.getTimezone = function () {
    return this.toString().replace(/^.* (?:\((.*)\)|([A-Z]{1,4})(?:[\-+][0-9]{4})?(?: -?\d+)?)$/, "$1$2").replace(/[^A-Z]/g, "");
};

/** Returns the number of days in the current month */
Date.prototype.getMonthDays = function (month) {
    var year = this.getFullYear();
    if (typeof month === "undefined") {
        month = this.getMonth();
    }
    if (((0 == (year % 4)) && ( (0 != (year % 100)) || (0 == (year % 400)))) && month == 1) {
        return 29;
    }
    return Date._MD[month];

};

/**
 * 获取每月的最后一天
 * @returns {Date}
 */
Date.prototype.getLastDateOfMonth = function () {
    return BI.getDate(this.getFullYear(), this.getMonth(), this.getMonthDays());
};

/** Returns the number of day in the year. */
Date.prototype.getDayOfYear = function () {
    var now = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0);
    var then = BI.getDate(this.getFullYear(), 0, 0, 0, 0, 0);
    var time = now - then;
    return Math.floor(time / Date.DAY);
};

/** Returns the number of the week in year, as defined in ISO 8601. */
Date.prototype.getWeekNumber = function () {
    var d = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0);
    // 周一是一周第一天
    var week = d.getDay() === 0 ? 7 : d.getDay();
    // var week = d.getDay();
    if (this.getMonth() === 0 && this.getDate() <= week) {
        return 1;
    }
    d.setDate(this.getDate() - (week - 1));
    var ms = d.valueOf(); // GMT
    d.setMonth(0);
    d.setDate(1);
    var offset = Math.floor((ms - d.valueOf()) / (7 * 864e5)) + 1;
    if (d.getDay() !== 1) {
        offset++;
    }
    return offset;
};

Date.prototype.getQuarter = function () {
    return Math.floor(this.getMonth() / 3) + 1;
};

// 离当前时间多少天的时间
Date.prototype.getOffsetDate = function (offset) {
    return BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()) + offset * 864e5);
};

Date.prototype.getOffsetQuarter = function (n) {
    var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()));
    var day = dt.getDate();
    var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + BI.parseInt(n) * 3, 1).getMonthDays();
    if (day > monthDay) {
        day = monthDay;
    }
    dt.setDate(day);
    dt.setMonth(dt.getMonth() + parseInt(n) * 3);
    return dt;
};

// 得到本季度的起始月份
Date.prototype.getQuarterStartMonth = function () {
    var quarterStartMonth = 0;
    var nowMonth = this.getMonth();
    if (nowMonth < 3) {
        quarterStartMonth = 0;
    }
    if (2 < nowMonth && nowMonth < 6) {
        quarterStartMonth = 3;
    }
    if (5 < nowMonth && nowMonth < 9) {
        quarterStartMonth = 6;
    }
    if (nowMonth > 8) {
        quarterStartMonth = 9;
    }
    return quarterStartMonth;
};
// 获得本季度的起始日期
Date.prototype.getQuarterStartDate = function () {
    return BI.getDate(this.getFullYear(), this.getQuarterStartMonth(), 1);
};
// 得到本季度的结束日期
Date.prototype.getQuarterEndDate = function () {
    var quarterEndMonth = this.getQuarterStartMonth() + 2;
    return BI.getDate(this.getFullYear(), quarterEndMonth, this.getMonthDays(quarterEndMonth));
};

// 指定日期n个月之前或之后的日期
Date.prototype.getOffsetMonth = function (n) {
    var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()));
    var day = dt.getDate();
    var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + parseInt(n), 1).getMonthDays();
    if (day > monthDay) {
        day = monthDay;
    }
    dt.setDate(day);
    dt.setMonth(dt.getMonth() + parseInt(n));
    return dt;
};

// 获得本周的起始日期
Date.prototype.getWeekStartDate = function () {
    var w = this.getDay();
    return this.getOffsetDate(w === 0 ? -6 : 1 - w);
};
// 得到本周的结束日期
Date.prototype.getWeekEndDate = function () {
    var w = this.getDay();
    return this.getOffsetDate(w === 0 ? 0 : 7 - w);
};

/** Checks date and time equality */
Date.prototype.equalsTo = function (date) {
    return ((this.getFullYear() == date.getFullYear()) &&
    (this.getMonth() == date.getMonth()) &&
    (this.getDate() == date.getDate()) &&
    (this.getHours() == date.getHours()) &&
    (this.getMinutes() == date.getMinutes()) &&
    (this.getSeconds() == date.getSeconds()));
};

/** Set only the year, month, date parts (keep existing time) */
Date.prototype.setDateOnly = function (date) {
    var tmp = BI.getDate(date);
    this.setDate(1);
    this.setFullYear(tmp.getFullYear());
    this.setMonth(tmp.getMonth());
    this.setDate(tmp.getDate());
};
/** Prints the date in a string according to the given format. */
Date.prototype.print = function (str) {
    var m = this.getMonth();
    var d = this.getDate();
    var y = this.getFullYear();
    var wn = this.getWeekNumber();
    var qr = this.getQuarter();
    var w = this.getDay();
    var s = {};
    var hr = this.getHours();
    var pm = (hr >= 12);
    var ir = (pm) ? (hr - 12) : hr;
    var dy = this.getDayOfYear();
    if (ir == 0) {
        ir = 12;
    }
    var min = this.getMinutes();
    var sec = this.getSeconds();
    s["%a"] = Date._SDN[w]; // abbreviated weekday name [FIXME: I18N]
    s["%A"] = Date._DN[w]; // full weekday name
    s["%b"] = Date._SMN[m]; // abbreviated month name [FIXME: I18N]
    s["%B"] = Date._MN[m]; // full month name
    // FIXME: %c : preferred date and time representation for the current locale
    s["%C"] = 1 + Math.floor(y / 100); // the century number
    s["%d"] = (d < 10) ? ("0" + d) : d; // the day of the month (range 01 to 31)
    s["%e"] = d; // the day of the month (range 1 to 31)
    // FIXME: %D : american date style: %m/%d/%y
    // FIXME: %E, %F, %G, %g, %h (man strftime)
    s["%H"] = (hr < 10) ? ("0" + hr) : hr; // hour, range 00 to 23 (24h format)
    s["%I"] = (ir < 10) ? ("0" + ir) : ir; // hour, range 01 to 12 (12h format)
    s["%j"] = (dy < 100) ? ((dy < 10) ? ("00" + dy) : ("0" + dy)) : dy; // day of the year (range 001 to 366)
    s["%k"] = hr;		// hour, range 0 to 23 (24h format)
    s["%l"] = ir;		// hour, range 1 to 12 (12h format)
    s["%X"] = (m < 9) ? ("0" + (1 + m)) : (1 + m); // month, range 01 to 12
    s["%x"] = m + 1; // month, range 1 to 12
    s["%M"] = (min < 10) ? ("0" + min) : min; // minute, range 00 to 59
    s["%n"] = "\n";		// a newline character
    s["%p"] = pm ? "PM" : "AM";
    s["%P"] = pm ? "pm" : "am";
    // FIXME: %r : the time in am/pm notation %I:%M:%S %p
    // FIXME: %R : the time in 24-hour notation %H:%M
    s["%s"] = Math.floor(this.getTime() / 1000);
    s["%S"] = (sec < 10) ? ("0" + sec) : sec; // seconds, range 00 to 59
    s["%t"] = "\t";		// a tab character
    // FIXME: %T : the time in 24-hour notation (%H:%M:%S)
    s["%U"] = s["%W"] = s["%V"] = (wn < 10) ? ("0" + wn) : wn;
    s["%u"] = w + 1;	// the day of the week (range 1 to 7, 1 = MON)
    s["%w"] = w;		// the day of the week (range 0 to 6, 0 = SUN)
    // FIXME: %x : preferred date representation for the current locale without the time
    // FIXME: %X : preferred time representation for the current locale without the date
    s["%y"] = ("" + y).substr(2, 2); // year without the century (range 00 to 99)
    s["%Y"] = y;		// year with the century
    s["%%"] = "%";		// a literal '%' character
    s["%Q"] = qr;

    var re = /%./g;
    if (!BI.isKhtml()) {
        return str.replace(re, function (par) {
            return s[par] || par;
        });
    }

    var a = str.match(re);
    for (var i = 0; i < a.length; i++) {
        var tmp = s[a[i]];
        if (tmp) {
            re = new RegExp(a[i], "g");
            str = str.replace(re, tmp);
        }
    }

    return str;
};
Function.prototype.before = function (func) {
    var __self = this;
    return function () {
        if (func.apply(this, arguments) === false) {
            return false;
        }
        return __self.apply(this, arguments);
    };
};

Function.prototype.after = function (func) {
    var __self = this;
    return function () {
        var ret = __self.apply(this, arguments);
        if (ret === false) {
            return false;
        }
        func.apply(this, arguments);
        return ret;
    };
};/**
 * 基本函数
 * Create By GUY 2014\11\17
 *
 */

if (!window.BI) {
    window.BI = {};
}

!(function (undefined) {
    var traverse = function (func, context) {
        return function (value, key, obj) {
            return func.call(context, key, value, obj);
        };
    };
    var _apply = function (name) {
        return function () {
            return _[name].apply(_, arguments);
        };
    };
    var _applyFunc = function (name) {
        return function () {
            var args = Array.prototype.slice.call(arguments, 0);
            args[1] = _.isFunction(args[1]) ? traverse(args[1], args[2]) : args[1];
            return _[name].apply(_, args);
        };
    };

    // Utility
    _.extend(BI, {
        i18nText: function (key) {
            var localeText = (BI.i18n && BI.i18n[key]) || "";
            if (!localeText) {
                localeText = key;
            }
            var len = arguments.length;
            if (len > 1) {
                for (var i = 1; i < len; i++) {
                    var key = "{R" + i + "}";
                    localeText = localeText.replaceAll(key, arguments[i] + "");
                }
            }
            return localeText;
        },

        assert: function (v, is) {
            if (this.isFunction(is)) {
                if (!is(v)) {
                    throw new Error(v + " error");
                } else {
                    return true;
                }
            }
            if (!this.isArray(is)) {
                is = [is];
            }
            if (!this.deepContains(is, v)) {
                throw new Error(v + " error");
            }
        },

        warn: function (message) {
            console.warn(message);
        },

        UUID: function () {
            var f = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"];
            var str = "";
            for (var i = 0; i < 16; i++) {
                var r = parseInt(f.length * Math.random(), 10);
                str += f[r];
            }
            return str;
        },

        isWidget: function (widget) {
            return widget instanceof BI.Widget || (BI.View && widget instanceof BI.View);
        },

        createWidgets: function (items, options, context) {
            if (!BI.isArray(items)) {
                throw new Error("cannot create Widgets");
            }
            if (BI.isWidget(options)) {
                context = options;
                options = {};
            } else {
                options || (options = {});
            }
            return BI.map(BI.flatten(items), function (i, item) {
                return BI.createWidget(item, BI.deepClone(options));
            });
        },

        createItems: function (data, innerAttr, outerAttr) {
            innerAttr = BI.isArray(innerAttr) ? innerAttr : BI.makeArray(BI.flatten(data).length, innerAttr);
            outerAttr = BI.isArray(outerAttr) ? outerAttr : BI.makeArray(BI.flatten(data).length, outerAttr);
            return BI.map(data, function (i, item) {
                if (BI.isArray(item)) {
                    return BI.createItems(item, innerAttr, outerAttr);
                }
                if (item instanceof BI.Widget) {
                    return BI.extend({}, innerAttr.shift(), outerAttr.shift(), {
                        type: null,
                        el: item
                    });
                }
                if (innerAttr[0] instanceof BI.Widget) {
                    outerAttr.shift();
                    return BI.extend({}, item, {
                        el: innerAttr.shift()
                    });
                }
                if (item.el instanceof BI.Widget || (BI.View && item.el instanceof BI.View)) {
                    innerAttr.shift();
                    return BI.extend({}, outerAttr.shift(), {type: null}, item);
                }
                if (item.el) {
                    return BI.extend({}, outerAttr.shift(), item, {
                        el: BI.extend({}, innerAttr.shift(), item.el)
                    });
                }
                return BI.extend({}, outerAttr.shift(), {
                    el: BI.extend({}, innerAttr.shift(), item)
                });
            });
        },

        // 用容器包装items
        packageItems: function (items, layouts) {
            for (var i = layouts.length - 1; i >= 0; i--) {
                items = BI.map(items, function (k, it) {
                    return BI.extend({}, layouts[i], {
                        items: [
                            BI.extend({}, layouts[i].el, {
                                el: it
                            })
                        ]
                    });
                });
            }
            return items;
        },

        formatEL: function (obj) {
            if (obj && !obj.type && obj.el) {
                return obj;
            }
            return {
                el: obj
            };
        },

        // 剥开EL
        stripEL: function (obj) {
            return obj.type && obj || obj.el || obj;
        },

        trans2Element: function (widgets) {
            return BI.map(widgets, function (i, wi) {
                return wi.element;
            });
        }
    });

    // 集合相关方法
    _.each(["where", "findWhere", "invoke", "pluck", "shuffle", "sample", "toArray", "size"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["get", "each", "map", "reduce", "reduceRight", "find", "filter", "reject", "every", "all", "some", "any", "max", "min",
        "sortBy", "groupBy", "indexBy", "countBy", "partition", "clamp"], function (name) {
        if (name === "any") {
            BI[name] = _applyFunc("some");
        } else {
            BI[name] = _applyFunc(name);
        }
    });
    _.extend(BI, {
        // 数数
        count: function (from, to, predicate) {
            var t;
            if (predicate) {
                for (t = from; t < to; t++) {
                    predicate(t);
                }
            }
            return to - from;
        },

        // 倒数
        inverse: function (from, to, predicate) {
            return BI.count(to, from, predicate);
        },

        firstKey: function (obj) {
            var res = undefined;
            BI.any(obj, function (key, value) {
                res = key;
                return true;
            });
            return res;
        },

        lastKey: function (obj) {
            var res = undefined;
            BI.each(obj, function (key, value) {
                res = key;
                return true;
            });
            return res;
        },

        firstObject: function (obj) {
            var res = undefined;
            BI.any(obj, function (key, value) {
                res = value;
                return true;
            });
            return res;
        },

        lastObject: function (obj) {
            var res = undefined;
            BI.each(obj, function (key, value) {
                res = value;
                return true;
            });
            return res;
        },

        concat: function (obj1, obj2) {
            if (BI.isKey(obj1)) {
                return obj1 + "" + obj2;
            }
            if (BI.isArray(obj1)) {
                return obj1.concat(obj2);
            }
            if (BI.isObject(obj1)) {
                return _.extend({}, obj1, obj2);
            }
        },

        backEach: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                predicate(index, obj[index], obj);
            }
            return false;
        },

        backAny: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                if (predicate(index, obj[index], obj)) {
                    return true;
                }
            }
            return false;
        },

        backEvery: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                if (!predicate(index, obj[index], obj)) {
                    return false;
                }
            }
            return true;
        },

        backFindKey: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            var keys = _.keys(obj), key;
            for (var i = keys.length - 1; i >= 0; i--) {
                key = keys[i];
                if (predicate(obj[key], key, obj)) {
                    return key;
                }
            }
        },

        backFind: function (obj, predicate, context) {
            var key;
            if (BI.isArray(obj)) {
                key = BI.findLastIndex(obj, predicate, context);
            } else {
                key = BI.backFindKey(obj, predicate, context);
            }
            if (key !== void 0 && key !== -1) {
                return obj[key];
            }
        },

        remove: function (obj, target, context) {
            var isFunction = BI.isFunction(target);
            target = isFunction || BI.isArray(target) ? target : [target];
            var i;
            if (BI.isArray(obj)) {
                for (i = 0; i < obj.length; i++) {
                    if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) {
                        obj.splice(i--, 1);
                    }
                }
            } else {
                BI.each(obj, function (i, v) {
                    if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) {
                        delete obj[i];
                    }
                });
            }
        },

        removeAt: function (obj, index) {
            index = BI.isArray(index) ? index : [index];
            var isArray = BI.isArray(obj), i;
            for (i = 0; i < index.length; i++) {
                if (isArray) {
                    obj[index[i]] = "$deleteIndex";
                } else {
                    delete obj[index[i]];
                }
            }
            if (isArray) {
                BI.remove(obj, "$deleteIndex");
            }
        },

        string2Array: function (str) {
            return str.split("&-&");
        },

        array2String: function (array) {
            return array.join("&-&");
        },

        abc2Int: function (str) {
            var idx = 0, start = "A", str = str.toUpperCase();
            for (var i = 0, len = str.length; i < len; ++i) {
                idx = str.charAt(i).charCodeAt(0) - start.charCodeAt(0) + 26 * idx + 1;
                if (idx > (2147483646 - str.charAt(i).charCodeAt(0) + start.charCodeAt(0)) / 26) {
                    return 0;
                }
            }
            return idx;
        },

        int2Abc: function (num) {
            var DIGITS = ["A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z"];
            var idx = num, str = "";
            if (num === 0) {
                return "";
            }
            while (idx !== 0) {
                var t = idx % 26;
                if (t === 0) {
                    t = 26;
                }
                str = DIGITS[t - 1] + str;
                idx = (idx - t) / 26;
            }
            return str;
        }
    });

    // 数组相关的方法
    _.each(["first", "initial", "last", "rest", "compact", "flatten", "without", "union", "intersection",
        "difference", "zip", "unzip", "object", "indexOf", "lastIndexOf", "sortedIndex", "range", "take", "takeRight"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["findIndex", "findLastIndex"], function (name) {
        BI[name] = _applyFunc(name);
    });
    _.extend(BI, {
        // 构建一个长度为length的数组
        makeArray: function (length, value) {
            var res = [];
            for (var i = 0; i < length; i++) {
                if (BI.isNull(value)) {
                    res.push(i);
                } else {
                    res.push(BI.deepClone(value));
                }
            }
            return res;
        },

        makeObject: function (array, value) {
            var map = {};
            for (var i = 0; i < array.length; i++) {
                if (BI.isNull(value)) {
                    map[array[i]] = array[i];
                } else {
                    map[array[i]] = BI.deepClone(value);
                }
            }
            return map;
        },

        makeArrayByArray: function (array, value) {
            var res = [];
            if (!array) {
                return res;
            }
            for (var i = 0, len = array.length; i < len; i++) {
                if (BI.isArray(array[i])) {
                    res.push(arguments.callee(array[i], value));
                } else {
                    res.push(BI.deepClone(value));
                }
            }
            return res;
        },

        uniq: function (array, isSorted, iteratee, context) {
            if (array == null) {
                return [];
            }
            if (!_.isBoolean(isSorted)) {
                context = iteratee;
                iteratee = isSorted;
                isSorted = false;
            }
            iteratee && (iteratee = traverse(iteratee, context));
            return _.uniq.call(_, array, isSorted, iteratee, context);
        }
    });

    // 对象相关方法
    _.each(["keys", "allKeys", "values", "pairs", "invert", "create", "functions", "extend", "extendOwn",
        "defaults", "clone", "property", "propertyOf", "matcher", "isEqual", "isMatch", "isEmpty",
        "isElement", "isNumber", "isString", "isArray", "isObject", "isPlainObject", "isArguments", "isFunction", "isFinite",
        "isBoolean", "isDate", "isRegExp", "isError", "isNaN", "isUndefined", "zipObject", "cloneDeep"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["mapObject", "findKey", "pick", "omit", "tap"], function (name) {
        BI[name] = _applyFunc(name);
    });
    _.extend(BI, {

        inherit: function (sb, sp, overrides) {
            if (typeof sp === "object") {
                overrides = sp;
                sp = sb;
                sb = function () {
                    return sp.apply(this, arguments);
                };
            }
            var F = function () {
            }, spp = sp.prototype;
            F.prototype = spp;
            sb.prototype = new F();
            sb.superclass = spp;
            _.extend(sb.prototype, overrides, {
                superclass: sp
            });
            return sb;
        },

        has: function (obj, keys) {
            if (BI.isArray(keys)) {
                if (keys.length === 0) {
                    return false;
                }
                return BI.every(keys, function (i, key) {
                    return _.has(obj, key);
                });
            }
            return _.has.apply(_, arguments);
        },

        // 数字和字符串可以作为key
        isKey: function (key) {
            return BI.isNumber(key) || (BI.isString(key) && key.length > 0);
        },

        // 忽略大小写的等于
        isCapitalEqual: function (a, b) {
            a = BI.isNull(a) ? a : ("" + a).toLowerCase();
            b = BI.isNull(b) ? b : ("" + b).toLowerCase();
            return BI.isEqual(a, b);
        },

        isWidthOrHeight: function (w) {
            if (typeof w === "number") {
                return w >= 0;
            } else if (typeof w === "string") {
                return /^\d{1,3}%$/.exec(w) || w == "auto" || /^\d+px$/.exec(w);
            }
        },

        isNotNull: function (obj) {
            return !BI.isNull(obj);
        },

        isNull: function (obj) {
            return typeof  obj === "undefined" || obj === null;
        },

        isEmptyArray: function (arr) {
            return BI.isArray(arr) && BI.isEmpty(arr);
        },

        isNotEmptyArray: function (arr) {
            return BI.isArray(arr) && !BI.isEmpty(arr);
        },

        isEmptyObject: function (obj) {
            return BI.isEqual(obj, {});
        },

        isNotEmptyObject: function (obj) {
            return BI.isPlainObject(obj) && !BI.isEmptyObject(obj);
        },

        isEmptyString: function (obj) {
            return BI.isString(obj) && obj.length === 0;
        },

        isNotEmptyString: function (obj) {
            return BI.isString(obj) && !BI.isEmptyString(obj);
        },

        isWindow: function () {
            return $.isWindow.apply($, arguments);
        }
    });

    // deep方法
    _.extend(BI, {
        deepClone: _.cloneDeep,

        isDeepMatch: function (object, attrs) {
            var keys = BI.keys(attrs), length = keys.length;
            if (object == null) {
                return !length;
            }
            var obj = Object(object);
            for (var i = 0; i < length; i++) {
                var key = keys[i];
                if (!BI.isEqual(attrs[key], obj[key]) || !(key in obj)) {
                    return false;
                }
            }
            return true;
        },

        contains: function (obj, target, fromIndex) {
            if (!_.isArrayLike(obj)) obj = _.values(obj);
            return _.indexOf(obj, target, typeof fromIndex === "number" && fromIndex) >= 0;
        },

        deepContains: function (obj, copy) {
            if (BI.isObject(copy)) {
                return BI.any(obj, function (i, v) {
                    if (BI.isEqual(v, copy)) {
                        return true;
                    }
                });
            }
            return BI.contains(obj, copy);
        },

        deepIndexOf: function (obj, target) {
            for (var i = 0; i < obj.length; i++) {
                if (BI.isEqual(target, obj[i])) {
                    return i;
                }
            }
            return -1;
        },

        deepRemove: function (obj, target) {
            var done = false;
            var i;
            if (BI.isArray(obj)) {
                for (i = 0; i < obj.length; i++) {
                    if (BI.isEqual(target, obj[i])) {
                        obj.splice(i--, 1);
                        done = true;
                    }
                }
            } else {
                BI.each(obj, function (i, v) {
                    if (BI.isEqual(target, obj[i])) {
                        delete obj[i];
                        done = true;
                    }
                });
            }
            return done;
        },

        deepWithout: function (obj, target) {
            if (BI.isArray(obj)) {
                var result = [];
                for (var i = 0; i < obj.length; i++) {
                    if (!BI.isEqual(target, obj[i])) {
                        result.push(obj[i]);
                    }
                }
                return result;
            }
            var result = {};
            BI.each(obj, function (i, v) {
                if (!BI.isEqual(target, obj[i])) {
                    result[i] = v;
                }
            });
            return result;

        },

        deepUnique: function (array) {
            var result = [];
            BI.each(array, function (i, item) {
                if (!BI.deepContains(result, item)) {
                    result.push(item);
                }
            });
            return result;
        },

        // 比较两个对象得出不一样的key值
        deepDiff: function (object, other) {
            object || (object = {});
            other || (other = {});
            var result = [];
            var used = [];
            for (var b in object) {
                if (this.has(object, b)) {
                    if (!this.isEqual(object[b], other[b])) {
                        result.push(b);
                    }
                    used.push(b);
                }
            }
            for (var b in other) {
                if (this.has(other, b) && !used.contains(b)) {
                    result.push(b);
                }
            }
            return result;
        },

        deepExtend: function () {
            var args = [].slice.call(arguments);
            args.unshift(true);
            return $.extend.apply($, args);
        }
    });

    // 通用方法
    _.each(["uniqueId", "result", "chain", "iteratee", "escape", "unescape"], function (name) {
        BI[name] = function () {
            return _[name].apply(_, arguments);
        };
    });

    // 事件相关方法
    _.each(["bind", "once", "partial", "debounce", "throttle", "delay", "defer", "wrap"], function (name) {
        BI[name] = function () {
            return _[name].apply(_, arguments);
        };
    });

    _.extend(BI, {
        nextTick: (function () {
            var callbacks = [];
            var pending = false;
            var timerFunc;

            function nextTickHandler () {
                pending = false;
                var copies = callbacks.slice(0);
                callbacks = [];
                for (var i = 0; i < copies.length; i++) {
                    copies[i]();
                }
            }

            if (typeof Promise !== "undefined") {
                var p = Promise.resolve();
                timerFunc = function () {
                    p.then(nextTickHandler);
                };
            } else

            /* istanbul ignore if */
            if (typeof MutationObserver !== "undefined") {
                var counter = 1;
                var observer = new MutationObserver(nextTickHandler);
                var textNode = document.createTextNode(counter + "");
                observer.observe(textNode, {
                    characterData: true
                });
                timerFunc = function () {
                    counter = (counter + 1) % 2;
                    textNode.data = counter + "";
                };
            } else {
                timerFunc = function () {
                    setTimeout(nextTickHandler, 0);
                };
            }
            return function queueNextTick (cb) {
                var _resolve;
                var args = [].slice.call(arguments, 1);
                callbacks.push(function () {
                    if (cb) {
                        cb.apply(null, args);
                    }
                    if (_resolve) {
                        _resolve.apply(null, args);
                    }
                });
                if (!pending) {
                    pending = true;
                    timerFunc();
                }
                if (!cb && typeof Promise !== "undefined") {
                    return new Promise(function (resolve) {
                        _resolve = resolve;
                    });
                }
            };
        })()
    });

    // 数字相关方法
    _.each(["random"], function (name) {
        BI[name] = _apply(name);
    });
    _.extend(BI, {
        getTime: function () {
            if (window.performance && window.performance.now) {
                return window.performance.now();
            }
            if (window.performance && window.performance.webkitNow) {
                return window.performance.webkitNow();
            }
            if (Date.now) {
                return Date.now();
            }
            return BI.getDate().getTime();


        },

        parseInt: function (number) {
            var radix = 10;
            if (/^0x/g.test(number)) {
                radix = 16;
            }
            try {
                return parseInt(number, radix);
            } catch (e) {
                throw new Error(number + "parse int error");
                return NaN;
            }
        },

        parseSafeInt: function (value) {
            var MAX_SAFE_INTEGER = 9007199254740991;
            return value
                ? this.clamp(this.parseInt(value), -MAX_SAFE_INTEGER, MAX_SAFE_INTEGER)
                : (value === 0 ? value : 0);
        },

        parseFloat: function (number) {
            try {
                return parseFloat(number);
            } catch (e) {
                throw new Error(number + "parse float error");
                return NaN;
            }
        },

        isNaturalNumber: function (number) {
            if (/^\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isPositiveInteger: function (number) {
            if (/^\+?[1-9][0-9]*$/.test(number)) {
                return true;
            }
            return false;
        },

        isNegativeInteger: function (number) {
            if (/^\-[1-9][0-9]*$/.test(number)) {
                return true;
            }
            return false;
        },

        isInteger: function (number) {
            if (/^\-?\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isNumeric: function (number) {
            return $.isNumeric(number);
        },

        isFloat: function (number) {
            if (/^([+-]?)\\d*\\.\\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isOdd: function (number) {
            if (!BI.isInteger(number)) {
                return false;
            }
            return number & 1 === 1;
        },

        isEven: function (number) {
            if (!BI.isInteger(number)) {
                return false;
            }
            return number & 1 === 0;
        },

        sum: function (array, iteratee, context) {
            var sum = 0;
            BI.each(array, function (i, item) {
                if (iteratee) {
                    sum += Number(iteratee.apply(context, [i, item]));
                } else {
                    sum += Number(item);
                }
            });
            return sum;
        },

        average: function (array, iteratee, context) {
            var sum = BI.sum(array, iteratee, context);
            return sum / array.length;
        }
    });

    // 字符串相关方法
    _.extend(BI, {
        trim: function () {
            return $.trim.apply($, arguments);
        },

        toUpperCase: function (string) {
            return (string + "").toLocaleUpperCase();
        },

        toLowerCase: function (string) {
            return (string + "").toLocaleLowerCase();
        },

        isEndWithBlank: function (string) {
            return /(\s|\u00A0)$/.test(string);
        },

        isLiteral: function (exp) {
            var literalValueRE = /^\s?(true|false|-?[\d\.]+|'[^']*'|"[^"]*")\s?$/;
            return literalValueRE.test(exp);
        },

        stripQuotes: function (str) {
            var a = str.charCodeAt(0);
            var b = str.charCodeAt(str.length - 1);
            return a === b && (a === 0x22 || a === 0x27)
                ? str.slice(1, -1)
                : str;
        },

        // background-color => backgroundColor
        camelize: function (str) {
            return str.replace(/-(.)/g, function (_, character) {
                return character.toUpperCase();
            });
        },

        // backgroundColor => background-color
        hyphenate: function (str) {
            return str.replace(/([A-Z])/g, "-$1").toLowerCase();
        },

        isNotEmptyString: function (str) {
            return BI.isString(str) && !BI.isEmpty(str);
        },

        isEmptyString: function (str) {
            return BI.isString(str) && BI.isEmpty(str);
        },

        /**
         * 对字符串进行加密 {@link #decrypt}
         * @static
         * @param str 原始字符�?
         * @param keyt 密钥
         * @returns {String} 加密后的字符�?
         */
        encrypt: function (str, keyt) {
            if (str == "") {
                return "";
            }
            str = escape(str);
            if (!keyt || keyt == "") {
                keyt = "655";
            }
            keyt = escape(keyt);
            if (keyt == null || keyt.length <= 0) {
                alert("Please enter a password with which to encrypt the message.");
                return null;
            }
            var prand = "";
            for (var i = 0; i < keyt.length; i++) {
                prand += keyt.charCodeAt(i).toString();
            }
            var sPos = Math.floor(prand.length / 5);
            var mult = parseInt(prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4) + prand.charAt(sPos * 5));

            var incr = Math.ceil(keyt.length / 2);
            var modu = Math.pow(2, 31) - 1;
            if (mult < 2) {
                alert("Algorithm cannot find a suitable hash. Please choose a different password. \nPossible considerations are to choose a more complex or longer password.");
                return null;
            }
            //        var salt = Math.round(Math.random() * 1000000000) % 100000000;
            var salt = 101;
            prand += salt;
            while (prand.length > 10) {
                prand = (parseInt(prand.substring(0, 10)) + parseInt(prand.substring(10, prand.length), 10)).toString();
            }
            prand = (mult * prand + incr) % modu;
            var enc_chr = "";
            var enc_str = "";
            for (var i = 0; i < str.length; i++) {
                enc_chr = parseInt(str.charCodeAt(i) ^ Math.floor((prand / modu) * 255));
                if (enc_chr < 16) {
                    enc_str += "0" + enc_chr.toString(16);
                } else {
                    enc_str += enc_chr.toString(16);
                }
                prand = (mult * prand + incr) % modu;
            }
            salt = salt.toString(16);
            while (salt.length < 8) {
                salt = "0" + salt;
            }
            enc_str += salt;
            return enc_str;
        },

        /**
         * 对加密后的字符串解密 {@link #encrypt}
         * @static
         * @param str 加密过的字符�?
         * @param keyt 密钥
         * @returns {String} 解密后的字符�?
         */
        decrypt: function (str, keyt) {
            if (str == "") {
                return "";
            }
            if (!keyt || keyt == "") {
                keyt = "655";
            }
            keyt = escape(keyt);
            if (str == null || str.length < 8) {
                return;
            }
            if (keyt == null || keyt.length <= 0) {
                return;
            }
            var prand = "";
            for (var i = 0; i < keyt.length; i++) {
                prand += keyt.charCodeAt(i).toString();
            }
            var sPos = Math.floor(prand.length / 5);
            var tempmult = prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4);
            if (sPos * 5 < prand.length) {
                tempmult += prand.charAt(sPos * 5);
            }
            var mult = parseInt(tempmult);
            var incr = Math.round(keyt.length / 2);
            var modu = Math.pow(2, 31) - 1;
            var salt = parseInt(str.substring(str.length - 8, str.length), 16);
            str = str.substring(0, str.length - 8);
            prand += salt;
            while (prand.length > 10) {
                prand = (parseInt(prand.substring(0, 10), 10) + parseInt(prand.substring(10, prand.length), 10)).toString();
            }
            prand = (mult * prand + incr) % modu;
            var enc_chr = "";
            var enc_str = "";
            for (var i = 0; i < str.length; i += 2) {
                enc_chr = parseInt(parseInt(str.substring(i, i + 2), 16) ^ Math.floor((prand / modu) * 255));
                enc_str += String.fromCharCode(enc_chr);
                prand = (mult * prand + incr) % modu;
            }
            return unescape(enc_str);
        },

        /**
         * 对字符串中的'和\做编码处理
         * @static
         * @param {String} string 要做编码处理的字符串
         * @return {String} 编码后的字符串
         */
        escape: function (string) {
            return string.replace(/('|\\)/g, "\\$1");
        },

        /**
         * 让字符串通过指定字符做补齐的函数
         *
         *      var s = BI.leftPad('123', 5, '0');//s的值为:'00123'
         *
         * @static
         * @param {String} val 原始值
         * @param {Number} size 总共需要的位数
         * @param {String} ch 用于补齐的字符
         * @return {String}  补齐后的字符串
         */
        leftPad: function (val, size, ch) {
            var result = String(val);
            if (!ch) {
                ch = " ";
            }
            while (result.length < size) {
                result = ch + result;
            }
            return result.toString();
        },

        /**
         * 对字符串做替换的函数
         *
         *      var cls = 'my-class', text = 'Some text';
         *      var res = BI.format('<div class="{0}>{1}</div>"', cls, text);
         *      //res的值为:'<div class="my-class">Some text</div>';
         *
         * @static
         * @param {String} format 要做替换的字符串,替换字符串1,替换字符串2...
         * @return {String} 做了替换后的字符串
         */
        format: function (format) {
            var args = Array.prototype.slice.call(arguments, 1);
            return format.replace(/\{(\d+)\}/g, function (m, i) {
                return args[i];
            });
        }
    });

    // 日期相关方法
    _.extend(BI, {
        /**
         * 是否是闰年
         * @param year
         * @returns {boolean}
         */
        isLeapYear: function (year) {
            return (year % 4 === 0 && year % 100 !== 0) || year % 400 === 0;
        },

        /**
         * 检测是否在有效期
         *
         * @param YY 年
         * @param MM 月
         * @param DD 日
         * @param minDate '1900-01-01'
         * @param maxDate '2099-12-31'
         * @returns {Array} 若无效返回无效状态
         */
        checkDateVoid: function (YY, MM, DD, minDate, maxDate) {
            var back = [];
            YY = YY | 0;
            MM = MM | 0;
            DD = DD | 0;
            minDate = BI.isString(minDate) ? minDate.match(/\d+/g) : minDate;
            maxDate = BI.isString(maxDate) ? maxDate.match(/\d+/g) : maxDate;
            if (YY < minDate[0]) {
                back = ["y"];
            } else if (YY > maxDate[0]) {
                back = ["y", 1];
            } else if (YY >= minDate[0] && YY <= maxDate[0]) {
                if (YY == minDate[0]) {
                    if (MM < minDate[1]) {
                        back = ["m"];
                    } else if (MM == minDate[1]) {
                        if (DD < minDate[2]) {
                            back = ["d"];
                        }
                    }
                }
                if (YY == maxDate[0]) {
                    if (MM > maxDate[1]) {
                        back = ["m", 1];
                    } else if (MM == maxDate[1]) {
                        if (DD > maxDate[2]) {
                            back = ["d", 1];
                        }
                    }
                }
            }
            return back;
        },

        checkDateLegal: function (str) {
            var ar = str.match(/\d+/g);
            var YY = ar[0] | 0, MM = ar[1] | 0, DD = ar[2] | 0;
            if (ar.length <= 1) {
                return true;
            }
            if (ar.length <= 2) {
                return MM >= 1 && MM <= 12;
            }
            var MD = Date._MD.slice(0);
            MD[1] = BI.isLeapYear(YY) ? 29 : 28;
            return MM >= 1 && MM <= 12 && DD <= MD[MM - 1];
        },

        parseDateTime: function (str, fmt) {
            var today = BI.getDate();
            var y = 0;
            var m = 0;
            var d = 1;
            // wei : 对于fmt为‘YYYYMM’或者‘YYYYMMdd’的格式,str的值为类似'201111'的形式,因为年月之间没有分隔符,所以正则表达式分割无效,导致bug7376。
            var a = str.split(/\W+/);
            if (fmt.toLowerCase() == "%y%x" || fmt.toLowerCase() == "%y%x%d") {
                var yearlength = 4;
                var otherlength = 2;
                a[0] = str.substring(0, yearlength);
                a[1] = str.substring(yearlength, yearlength + otherlength);
                a[2] = str.substring(yearlength + otherlength, yearlength + otherlength * 2);
            }
            var b = fmt.match(/%./g);
            var i = 0, j = 0;
            var hr = 0;
            var min = 0;
            var sec = 0;
            for (i = 0; i < a.length; ++i) {
                switch (b[i]) {
                    case "%d":
                    case "%e":
                        d = parseInt(a[i], 10);
                        break;

                    case "%X":
                        m = parseInt(a[i], 10) - 1;
                        break;
                    case "%x":
                        m = parseInt(a[i], 10) - 1;
                        break;

                    case "%Y":
                    case "%y":
                        y = parseInt(a[i], 10);
                        (y < 100) && (y += (y > 29) ? 1900 : 2000);
                        break;

                    case "%b":
                    case "%B":
                        for (j = 0; j < 12; ++j) {
                            if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) {
                                m = j;
                                break;
                            }
                        }
                        break;

                    case "%H":
                    case "%I":
                    case "%k":
                    case "%l":
                        hr = parseInt(a[i], 10);
                        break;

                    case "%P":
                    case "%p":
                        if (/pm/i.test(a[i]) && hr < 12) {
                            hr += 12;
                        } else if (/am/i.test(a[i]) && hr >= 12) {
                            hr -= 12;
                        }
                        break;

                    case "%M":
                        min = parseInt(a[i], 10);
                    case "%S":
                        sec = parseInt(a[i], 10);
                        break;
                }
            }
            //    if (!a[i]) {
            //        continue;
            //	}
            if (isNaN(y)) {
                y = today.getFullYear();
            }
            if (isNaN(m)) {
                m = today.getMonth();
            }
            if (isNaN(d)) {
                d = today.getDate();
            }
            if (isNaN(hr)) {
                hr = today.getHours();
            }
            if (isNaN(min)) {
                min = today.getMinutes();
            }
            if (isNaN(sec)) {
                sec = today.getSeconds();
            }
            if (y != 0) {
                return BI.getDate(y, m, d, hr, min, sec);
            }
            y = 0;
            m = -1;
            d = 0;
            for (i = 0; i < a.length; ++i) {
                if (a[i].search(/[a-zA-Z]+/) != -1) {
                    var t = -1;
                    for (j = 0; j < 12; ++j) {
                        if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) {
                            t = j;
                            break;
                        }
                    }
                    if (t != -1) {
                        if (m != -1) {
                            d = m + 1;
                        }
                        m = t;
                    }
                } else if (parseInt(a[i], 10) <= 12 && m == -1) {
                    m = a[i] - 1;
                } else if (parseInt(a[i], 10) > 31 && y == 0) {
                    y = parseInt(a[i], 10);
                    (y < 100) && (y += (y > 29) ? 1900 : 2000);
                } else if (d == 0) {
                    d = a[i];
                }
            }
            if (y == 0) {
                y = today.getFullYear();
            }
            if (m != -1 && d != 0) {
                return BI.getDate(y, m, d, hr, min, sec);
            }
            return today;
        },

        getDate: function () {
            var length = arguments.length;
            var args = arguments;
            var dt;
            switch (length) {
                // new Date()
                case 0:
                    dt = new Date();
                    break;
                // new Date(long)
                case 1:
                    dt = new Date(args[0]);
                    break;
                // new Date(year, month)
                case 2:
                    dt = new Date(args[0], args[1]);
                    break;
                // new Date(year, month, day)
                case 3:
                    dt = new Date(args[0], args[1], args[2]);
                    break;
                // new Date(year, month, day, hour)
                case 4:
                    dt = new Date(args[0], args[1], args[2], args[3]);
                    break;
                // new Date(year, month, day, hour, minute)
                case 5:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4]);
                    break;
                // new Date(year, month, day, hour, minute, second)
                case 6:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]);
                    break;
                // new Date(year, month, day, hour, minute, second, millisecond)
                case 7:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
                    break;
                default:
                    dt = new Date();
                    break;
            }
            if (BI.isNotNull(Date.timeZone) && (arguments.length === 0 || (arguments.length === 1 && BI.isNumber(arguments[0])))) {
                var localTime = dt.getTime();
                var localOffset = dt.getTimezoneOffset() * 60000; // 获得当地时间偏移的毫秒数
                var utc = localTime + localOffset; // utc即GMT时间标准时区
                return new Date(utc + Date.timeZone);// + Pool.timeZone.offset);
            }
            return dt;

        },

        getTime: function () {
            var length = arguments.length;
            var args = arguments;
            var dt;
            switch (length) {
                // new Date()
                case 0:
                    dt = new Date();
                    break;
                // new Date(long)
                case 1:
                    dt = new Date(args[0]);
                    break;
                // new Date(year, month)
                case 2:
                    dt = new Date(args[0], args[1]);
                    break;
                // new Date(year, month, day)
                case 3:
                    dt = new Date(args[0], args[1], args[2]);
                    break;
                // new Date(year, month, day, hour)
                case 4:
                    dt = new Date(args[0], args[1], args[2], args[3]);
                    break;
                // new Date(year, month, day, hour, minute)
                case 5:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4]);
                    break;
                // new Date(year, month, day, hour, minute, second)
                case 6:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]);
                    break;
                // new Date(year, month, day, hour, minute, second, millisecond)
                case 7:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
                    break;
                default:
                    dt = new Date();
                    break;
            }
            if (BI.isNotNull(Date.timeZone)) {
                return dt.getTime() - Date.timeZone - dt.getTimezoneOffset() * 60000;
            }
            return dt.getTime();

        }
    });

    // 浏览器相关方法
    _.extend(BI, {
        isIE: function () {
            if (this.__isIE == null) {
                this.__isIE = /(msie|trident)/i.test(navigator.userAgent.toLowerCase());
            }
            return this.__isIE;
        },

        getIEVersion: function () {
            if (this.__IEVersion != null) {
                return this.__IEVersion;
            }
            var version = 0;
            var agent = navigator.userAgent.toLowerCase();
            var v1 = agent.match(/(?:msie\s([\w.]+))/);
            var v2 = agent.match(/(?:trident.*rv:([\w.]+))/);
            if (v1 && v2 && v1[1] && v2[1]) {
                version = Math.max(v1[1] * 1, v2[1] * 1);
            } else if (v1 && v1[1]) {
                version = v1[1] * 1;
            } else if (v2 && v2[1]) {
                version = v2[1] * 1;
            } else {
                version = 0;
            }
            return this.__IEVersion = version;
        },

        isIE9Below: function () {
            if (!BI.isIE()) {
                return false;
            }
            return this.getIEVersion() < 9;
        },

        isEdge: function () {
            return /edge/i.test(navigator.userAgent.toLowerCase());
        },

        isChrome: function () {
            return /chrome/i.test(navigator.userAgent.toLowerCase());
        },

        isFireFox: function () {
            return /firefox/i.test(navigator.userAgent.toLowerCase());
        },

        isOpera: function () {
            return /opera/i.test(navigator.userAgent.toLowerCase());
        },

        isSafari: function () {
            return /safari/i.test(navigator.userAgent.toLowerCase());
        },

        isKhtml: function () {
            return /Konqueror|Safari|KHTML/i.test(navigator.userAgent);
        },

        isMac: function () {
            return /macintosh|mac os x/i.test(navigator.userAgent);
        },

        isWindows: function () {
            return /windows|win32/i.test(navigator.userAgent);
        },

        isSupportCss3: function (style) {
            var prefix = ["webkit", "Moz", "ms", "o"],
                i, len,
                humpString = [],
                htmlStyle = document.documentElement.style,
                _toHumb = function (string) {
                    return string.replace(/-(\w)/g, function ($0, $1) {
                        return $1.toUpperCase();
                    });
                };

            for (i in prefix) {
                humpString.push(_toHumb(prefix[i] + "-" + style));
            }
            humpString.push(_toHumb(style));

            for (i = 0, len = humpString.length; i < len; i++) {
                if (humpString[i] in htmlStyle) {
                    return true;
                }
            }
            return false;
        }
    });
    // BI请求
    _.extend(BI, {

        ajax: function (option) {
            option || (option = {});
            var async = option.async;
            option.data = BI.cjkEncodeDO(option.data || {});

            $.ajax({
                url: option.url,
                type: "POST",
                data: option.data,
                async: async,
                error: option.error,
                complete: function (res, status) {
                    if (BI.isFunction(option.complete)) {
                        option.complete(BI.jsonDecode(res.responseText), status);
                    }
                }
            });
        }
    });
})();/**
 * 客户端观察者,主要处理事件的添加、删除、执行等
 * @class BI.OB
 * @abstract
 */
BI.OB = function (config) {
    var props = this.props;
    if (BI.isFunction(this.props)) {
        props = this.props(config);
    }
    this.options = (window.$ || window._).extend(this._defaultConfig(config), props, config);
    this._init();
    this._initRef();
};
_.extend(BI.OB.prototype, {
    props: {},
    init: null,
    destroyed: null,

    _defaultConfig: function (config) {
        return {};
    },

    _init: function () {
        this._initListeners();
        this.init && this.init();
    },

    _initListeners: function () {
        var self = this;
        if (this.options.listeners != null) {
            _.each(this.options.listeners, function (lis) {
                (lis.target ? lis.target : self)[lis.once ? "once" : "on"]
                (lis.eventName, _.bind(lis.action, self));
            });
            delete this.options.listeners;
        }
    },

    // 获得一个当前对象的引用
    _initRef: function () {
        if (this.options.ref) {
            this.options.ref.call(this, this);
        }
    },

    //释放当前对象
    _purgeRef: function(){
        if (this.options.ref) {
            this.options.ref.call(null);
        }
    },

    _getEvents: function () {
        if (!_.isArray(this.events)) {
            this.events = [];
        }
        return this.events;
    },

    /**
     * 给观察者绑定一个事件
     * @param {String} eventName 事件的名字
     * @param {Function} fn 事件对应的执行函数
     */
    on: function (eventName, fn) {
        eventName = eventName.toLowerCase();
        var fns = this._getEvents()[eventName];
        if (!_.isArray(fns)) {
            fns = [];
            this._getEvents()[eventName] = fns;
        }
        fns.push(fn);
    },

    /**
     * 给观察者绑定一个只执行一次的事件
     * @param {String} eventName 事件的名字
     * @param {Function} fn 事件对应的执行函数
     */
    once: function (eventName, fn) {
        var proxy = function () {
            fn.apply(this, arguments);
            this.un(eventName, proxy);
        };
        this.on(eventName, proxy);
    },
    /**
     * 解除观察者绑定的指定事件
     * @param {String} eventName 要解除绑定事件的名字
     * @param {Function} fn 事件对应的执行函数,该参数是可选的,没有该参数时,将解除绑定所有同名字的事件
     */
    un: function (eventName, fn) {
        eventName = eventName.toLowerCase();

        /* alex:如果fn是null,就是把eventName上面所有方法都un掉*/
        if (fn == null) {
            delete this._getEvents()[eventName];
        } else {
            var fns = this._getEvents()[eventName];
            if (_.isArray(fns)) {
                var newFns = [];
                _.each(fns, function (ifn) {
                    if (ifn != fn) {
                        newFns.push(ifn);
                    }
                });
                this._getEvents()[eventName] = newFns;
            }
        }
    },
    /**
     * 清除观察者的所有事件绑定
     */
    purgeListeners: function () {
        /* alex:清空events*/
        this.events = [];
    },
    /**
     * 触发绑定过的事件
     *
     * @param {String} eventName 要触发的事件的名字
     * @returns {Boolean} 如果事件函数返回false,则返回false并中断其他同名事件的执行,否则执行所有的同名事件并返回true
     */
    fireEvent: function () {
        var eventName = arguments[0].toLowerCase();
        var fns = this._getEvents()[eventName];
        if (BI.isArray(fns)) {
            if (BI.isArguments(arguments[1])) {
                for (var i = 0; i < fns.length; i++) {
                    if (fns[i].apply(this, arguments[1]) === false) {
                        return false;
                    }
                }
            } else {
                var args = Array.prototype.slice.call(arguments, 1);
                for (var i = 0; i < fns.length; i++) {
                    if (fns[i].apply(this, args) === false) {
                        return false;
                    }
                }
            }
        }
        return true;
    },

    destroy: function () {
        this.destroyed && this.destroyed();
        this._purgeRef();
        this.purgeListeners();
    }
});(function () {
    if (!window.BI) {
        window.BI = {};
    }

    function isEmpty (value) {
        // 判断是否为空值
        var result = value === "" || value === null || value === undefined;
        return result;
    }

    // 判断是否是无效的日期
    function isInvalidDate (date) {
        return date == "Invalid Date" || date == "NaN";
    }

    /**
     * 科学计数格式
     */
    function _eFormat (text, fmt) {
        var e = fmt.indexOf("E");
        var eleft = fmt.substr(0, e), eright = fmt.substr(e + 1);
        if (/^[0\.-]+$/.test(text)) {
            text = BI._numberFormat(0.0, eleft) + "E" + BI._numberFormat(0, eright);
        } else {
            var isNegative = text < 0;
            if (isNegative) {
                text = text.substr(1);
            }
            var elvl = (eleft.split(".")[0] || "").length;
            var point = text.indexOf(".");
            if (point < 0) {
                point = text.length;
            }
            var i = 0; // 第一个不为0的数的位置
            text = text.replace(".", "");
            for (var len = text.length; i < len; i++) {
                var ech = text.charAt(i);
                if (ech <= "9" && ech >= "1") {
                    break;
                }
            }
            var right = point - i - elvl;
            var left = text.substr(i, elvl);
            var dis = i + elvl - text.length;
            if (dis > 0) {
                // 末位补全0
                for (var k = 0; k < dis; k++) {
                    left += "0";
                }
            } else {
                left += "." + text.substr(i + elvl);
            }
            left = left.replace(/^[0]+/, "");
            if (right < 0 && eright.indexOf("-") < 0) {
                eright += ";-" + eright;
            }
            text = BI._numberFormat(left, eleft) + "E" + BI._numberFormat(right, eright);
            if (isNegative) {
                text = "-" + text;
            }
        }
        return text;
    }

    /**
     * 数字格式
     */
    function _numberFormat (text, format) {
        var text = text + "";
        // 数字格式,区分正负数
        var numMod = format.indexOf(";");
        if (numMod > -1) {
            if (text >= 0) {
                return _numberFormat(text + "", format.substring(0, numMod));
            }
            return _numberFormat((-text) + "", format.substr(numMod + 1));

        }
        // 兼容格式处理负数的情况(copy:fr-jquery.format.js)
        if (+text < 0 && format.charAt(0) !== "-") {
            return _numberFormat((-text) + "", "-" + format);
        }

        var tp = text.split("."), fp = format.split("."),
            tleft = tp[0] || "", fleft = fp[0] || "",
            tright = tp[1] || "", fright = fp[1] || "";
        // 百分比,千分比的小数点移位处理
        if (/[%‰]$/.test(format)) {
            var paddingZero = /[%]$/.test(format) ? "00" : "000";
            tright += paddingZero;
            tleft += tright.substr(0, paddingZero.length);
            tleft = tleft.replace(/^0+/gi, "");
            tright = tright.substr(paddingZero.length).replace(/0+$/gi, "");
        }
        var right = _dealWithRight(tright, fright);
        if (right.leftPlus) {
            // 小数点后有进位
            tleft = parseInt(tleft) + 1 + "";

            tleft = isNaN(tleft) ? "1" : tleft;
        }
        right = right.num;
        var left = _dealWithLeft(tleft, fleft);
        if (!(/[0-9]/.test(left))) {
            left = left + "0";
        }
        if (!(/[0-9]/.test(right))) {
            return left + right;
        }
        return left + "." + right;

    }

    /**
     * 处理小数点右边小数部分
     * @param tright 右边内容
     * @param fright 右边格式
     * @returns {JSON} 返回处理结果和整数部分是否需要进位
     * @private
     */
    function _dealWithRight (tright, fright) {
        var right = "", j = 0, i = 0;
        for (var len = fright.length; i < len; i++) {
            var ch = fright.charAt(i);
            var c = tright.charAt(j);
            switch (ch) {
                case "0":
                    if (isEmpty(c)) {
                        c = "0";
                    }
                    right += c;
                    j++;
                    break;
                case "#":
                    right += c;
                    j++;
                    break;
                default :
                    right += ch;
                    break;
            }
        }
        var rll = tright.substr(j);
        var result = {};
        if (!isEmpty(rll) && rll.charAt(0) > 4) {
            // 有多余字符,需要四舍五入
            result.leftPlus = true;
            var numReg = right.match(/^[0-9]+/);
            if (numReg) {
                var num = numReg[0];
                var orilen = num.length;
                var newnum = parseInt(num) + 1 + "";
                // 进位到整数部分
                if (newnum.length > orilen) {
                    newnum = newnum.substr(1);
                } else {
                    newnum = BI.leftPad(newnum, orilen, "0");
                    result.leftPlus = false;
                }
                right = right.replace(/^[0-9]+/, newnum);
            }
        }
        result.num = right;
        return result;
    }

    /**
     * 处理小数点左边整数部分
     * @param tleft 左边内容
     * @param fleft 左边格式
     * @returns {string} 返回处理结果
     * @private
     */
    function _dealWithLeft (tleft, fleft) {
        var left = "";
        var j = tleft.length - 1;
        var combo = -1, last = -1;
        var i = fleft.length - 1;
        for (; i >= 0; i--) {
            var ch = fleft.charAt(i);
            var c = tleft.charAt(j);
            switch (ch) {
                case "0":
                    if (isEmpty(c)) {
                        c = "0";
                    }
                    last = -1;
                    left = c + left;
                    j--;
                    break;
                case "#":
                    last = i;
                    left = c + left;
                    j--;
                    break;
                case ",":
                    if (!isEmpty(c)) {
                        // 计算一个,分隔区间的长度
                        var com = fleft.match(/,[#0]+/);
                        if (com) {
                            combo = com[0].length - 1;
                        }
                        left = "," + left;
                    }
                    break;
                default :
                    left = ch + left;
                    break;
            }
        }
        if (last > -1) {
            // 处理剩余字符
            var tll = tleft.substr(0, j + 1);
            left = left.substr(0, last) + tll + left.substr(last);
        }
        if (combo > 0) {
            // 处理,分隔区间
            var res = left.match(/[0-9]+,/);
            if (res) {
                res = res[0];
                var newstr = "", n = res.length - 1 - combo;
                for (; n >= 0; n = n - combo) {
                    newstr = res.substr(n, combo) + "," + newstr;
                }
                var lres = res.substr(0, n + combo);
                if (!isEmpty(lres)) {
                    newstr = lres + "," + newstr;
                }
            }
            left = left.replace(/[0-9]+,/, newstr);
        }
        return left;
    }

    BI.cjkEncode = function (text) {
        // alex:如果非字符串,返回其本身(cjkEncode(234) 返回 ""是不对的)
        if (typeof text !== "string") {
            return text;
        }

        var newText = "";
        for (var i = 0; i < text.length; i++) {
            var code = text.charCodeAt(i);
            if (code >= 128 || code === 91 || code === 93) {// 91 is "[", 93 is "]".
                newText += "[" + code.toString(16) + "]";
            } else {
                newText += text.charAt(i);
            }
        }

        return newText;
    };

    /**
     * 将cjkEncode处理过的字符串转化为原始字符串
     *
     * @static
     * @param text 需要做解码的字符串
     * @return {String} 解码后的字符串
     */
    BI.cjkDecode = function (text) {
        if (text == null) {
            return "";
        }
        // 查找没有 "[", 直接返回.  kunsnat:数字的时候, 不支持indexOf方法, 也是直接返回.
        if (!isNaN(text) || text.indexOf("[") == -1) {
            return text;
        }

        var newText = "";
        for (var i = 0; i < text.length; i++) {
            var ch = text.charAt(i);
            if (ch == "[") {
                var rightIdx = text.indexOf("]", i + 1);
                if (rightIdx > i + 1) {
                    var subText = text.substring(i + 1, rightIdx);
                    // james:主要是考虑[CDATA[]]这样的值的出现
                    if (subText.length > 0) {
                        ch = String.fromCharCode(eval("0x" + subText));
                    }

                    i = rightIdx;
                }
            }

            newText += ch;
        }

        return newText;
    };

    // replace the html special tags
    BI.htmlEncode = function (text) {
        return (text == null) ? "" : String(text).replace(/&/g, "&amp;").replace(/\"/g, "&quot;").replace(/</g, "&lt;").replace(/>/g, "&gt;").replace(/\s/g, "&nbsp;");
    };
    // html decode
    BI.htmlDecode = function (text) {
        return (text == null) ? "" : String(text).replace(/&amp;/g, "&").replace(/&quot;/g, "\"").replace(/&lt;/g, "<").replace(/&gt;/g, ">").replace(/&nbsp;/g, " ");
    };

    BI.cjkEncodeDO = function (o) {
        if (BI.isPlainObject(o)) {
            var result = {};
            _.each(o, function (v, k) {
                if (!(typeof v === "string")) {
                    v = BI.jsonEncode(v);
                }
                // wei:bug 43338,如果key是中文,cjkencode后o的长度就加了1,ie9以下版本死循环,所以新建对象result。
                k = BI.cjkEncode(k);
                result[k] = BI.cjkEncode(v);
            });
            return result;
        }
        return o;
    };

    BI.jsonEncode = function (o) {
        // james:这个Encode是抄的EXT的
        var useHasOwn = !!{}.hasOwnProperty;

        // crashes Safari in some instances
        // var validRE = /^("(\\.|[^"\\\n\r])*?"|[,:{}\[\]0-9.\-+Eaeflnr-u \n\r\t])+?$/;

        var m = {
            "\b": "\\b",
            "\t": "\\t",
            "\n": "\\n",
            "\f": "\\f",
            "\r": "\\r",
            "\"": "\\\"",
            "\\": "\\\\"
        };

        var encodeString = function (s) {
            if (/["\\\x00-\x1f]/.test(s)) {
                return "\"" + s.replace(/([\x00-\x1f\\"])/g, function (a, b) {
                    var c = m[b];
                    if (c) {
                        return c;
                    }
                    c = b.charCodeAt();
                    return "\\u00" +
                        Math.floor(c / 16).toString(16) +
                        (c % 16).toString(16);
                }) + "\"";
            }
            return "\"" + s + "\"";
        };

        var encodeArray = function (o) {
            var a = ["["], b, i, l = o.length, v;
            for (i = 0; i < l; i += 1) {
                v = o[i];
                switch (typeof v) {
                    case "undefined":
                    case "function":
                    case "unknown":
                        break;
                    default:
                        if (b) {
                            a.push(",");
                        }
                        a.push(v === null ? "null" : BI.jsonEncode(v));
                        b = true;
                }
            }
            a.push("]");
            return a.join("");
        };

        if (typeof o === "undefined" || o === null) {
            return "null";
        } else if (BI.isArray(o)) {
            return encodeArray(o);
        } else if (o instanceof Date) {
            /*
             * alex:原来只是把年月日时分秒简单地拼成一个String,无法decode
             * 现在这么处理就可以decode了,但是JS.jsonDecode和Java.JSONObject也要跟着改一下
             */
            return BI.jsonEncode({
                __time__: o.getTime()
            });
        } else if (typeof o === "string") {
            return encodeString(o);
        } else if (typeof o === "number") {
            return isFinite(o) ? String(o) : "null";
        } else if (typeof o === "boolean") {
            return String(o);
        } else if (BI.isFunction(o)) {
            return String(o);
        }
        var a = ["{"], b, i, v;
        for (i in o) {
            if (!useHasOwn || o.hasOwnProperty(i)) {
                v = o[i];
                switch (typeof v) {
                    case "undefined":
                    case "unknown":
                        break;
                    default:
                        if (b) {
                            a.push(",");
                        }
                        a.push(BI.jsonEncode(i), ":",
                            v === null ? "null" : BI.jsonEncode(v));
                        b = true;
                }
            }
        }
        a.push("}");
        return a.join("");

    };

    BI.jsonDecode = function (text) {

        try {
            // 注意0啊
            // var jo = $.parseJSON(text) || {};
            var jo = $ ? $.parseJSON(text) : window.JSON.parse(text);
            if (jo == null) {
                jo = {};
            }
        } catch (e) {
            /*
             * richie:浏览器只支持标准的JSON字符串转换,而jQuery会默认调用浏览器的window.JSON.parse()函数进行解析
             * 比如:var str = "{'a':'b'}",这种形式的字符串转换为JSON就会抛异常
             */
            try {
                jo = new Function("return " + text)() || {};
            } catch (e) {
                // do nothing
            }
            if (jo == null) {
                jo = [];
            }
        }
        if (!_hasDateInJson(text)) {
            return jo;
        }

        function _hasDateInJson (json) {
            if (!json || typeof json !== "string") {
                return false;
            }
            return json.indexOf("__time__") != -1;
        }

        return (function (o) {
            if (typeof o === "string") {
                return o;
            }
            if (o && o.__time__ != null) {
                return new Date(o.__time__);
            }
            for (var a in o) {
                if (o[a] == o || typeof o[a] === "object" || _.isFunction(o[a])) {
                    break;
                }
                o[a] = arguments.callee(o[a]);
            }

            return o;
        })(jo);
    };

    BI.contentFormat = function (cv, fmt) {
        if (isEmpty(cv)) {
            // 原值为空,返回空字符
            return "";
        }
        var text = cv.toString();
        if (isEmpty(fmt)) {
            // 格式为空,返回原字符
            return text;
        }
        if (fmt.match(/^T/)) {
            // T - 文本格式
            return text;
        } else if (fmt.match(/^D/)) {
            // D - 日期(时间)格式
            if (!(cv instanceof Date)) {
                if (typeof cv === "number") {
                    // 毫秒数类型
                    cv = new Date(cv);
                } else {
                    // 字符串类型,如yyyyMMdd、MMddyyyy等这样无分隔符的结构
                    cv = Date.parseDate(cv + "", Date.patterns.ISO8601Long);
                }
            }
            if (!BI.isNull(cv)) {
                var needTrim = fmt.match(/^DT/);
                text = BI.date2Str(cv, fmt.substring(needTrim ? 2 : 1));
            }
        } else if (fmt.match(/E/)) {
            // 科学计数格式
            text = _eFormat(text, fmt);
        } else {
            // 数字格式
            var s = [];
            BI.clamp(s);
            text = _numberFormat(text, fmt);
        }
        // ¤ - 货币格式
        text = text.replace(/¤/g, "¥");
        return text;
    };

    /**
     * 将Java提供的日期格式字符串装换为JS识别的日期格式字符串
     * @class FR.parseFmt
     * @param fmt 日期格式
     * @returns {String}
     */
    BI.parseFmt = function (fmt) {
        if (!fmt) {
            return "";
        }
        //日期
        fmt = String(fmt)
        //年
            .replace(/y{4,}/g, "%Y")//yyyy的时候替换为Y
            .replace(/y{2}/g, "%y")//yy的时候替换为y
            //月
            .replace(/M{4,}/g, "%b")//MMMM的时候替换为b,八
            .replace(/M{3}/g, "%B")//MMM的时候替换为M,八月
            .replace(/M{2}/g, "%X")//MM的时候替换为X,08
            .replace(/M{1}/g, "%x")//M的时候替换为x,8
            .replace(/a{1}/g, "%p");
        //天
        if (new RegExp("d{2,}", "g").test(fmt)) {
            fmt = fmt.replace(/d{2,}/g, "%d");//dd的时候替换为d
        } else {
            fmt = fmt.replace(/d{1}/g, "%e");//d的时候替换为j
        }
        //时
        if (new RegExp("h{2,}", "g").test(fmt)) {//12小时制
            fmt = fmt.replace(/h{2,}/g, "%I");
        } else {
            fmt = fmt.replace(/h{1}/g, "%I");
        }
        if (new RegExp("H{2,}", "g").test(fmt)) {//24小时制
            fmt = fmt.replace(/H{2,}/g, "%H");
        } else {
            fmt = fmt.replace(/H{1}/g, "%H");
        }
        fmt = fmt.replace(/m{2,}/g, "%M")//分
        //秒
            .replace(/s{2,}/g, "%S");

        return fmt;
    };

    /**
     * 把字符串按照对应的格式转化成日期对象
     *
     *      @example
     *      var result = FR.str2Date('2013-12-12', 'yyyy-MM-dd');//Thu Dec 12 2013 00:00:00 GMT+0800
     *
     * @class FR.str2Date
     * @param str 字符串
     * @param format 日期格式
     * @returns {*}
     */
    BI.str2Date = function (str, format) {
        if (typeof str != "string" || typeof format != "string") {
            return null;
        }
        var fmt = BI.parseFmt(format);
        return BI.parseDateTime(str, fmt);
    };

    /**
     * 把日期对象按照指定格式转化成字符串
     *
     *      @example
     *      var date = new Date('Thu Dec 12 2013 00:00:00 GMT+0800');
     *      var result = BI.date2Str(date, 'yyyy-MM-dd');//2013-12-12
     *
     * @class BI.date2Str
     * @param date 日期
     * @param format 日期格式
     * @returns {String}
     */
    BI.date2Str = function (date, format) {
        if (!date) {
            return "";
        }
        // O(len(format))
        var len = format.length, result = "";
        if (len > 0) {
            var flagch = format.charAt(0), start = 0, str = flagch;
            for (var i = 1; i < len; i++) {
                var ch = format.charAt(i);
                if (flagch !== ch) {
                    result += compileJFmt({
                        char: flagch,
                        str: str,
                        len: i - start
                    }, date);
                    flagch = ch;
                    start = i;
                    str = flagch;
                } else {
                    str += ch;
                }
            }
            result += compileJFmt({
                char: flagch,
                str: str,
                len: len - start
            }, date);
        }
        return result;

        function compileJFmt (jfmt, date) {
            var str = jfmt.str, len = jfmt.len, ch = jfmt["char"];
            switch (ch) {
                case "E": // 星期
                    str = Date._DN[date.getDay()];
                    break;
                case "y": // 年
                    if (len <= 3) {
                        str = (date.getFullYear() + "").slice(2, 4);
                    } else {
                        str = date.getFullYear();
                    }
                    break;
                case "M": // 月
                    if (len > 2) {
                        str = Date._MN[date.getMonth()];
                    } else if (len < 2) {
                        str = date.getMonth() + 1;
                    } else {
                        str = BI.leftPad(date.getMonth() + 1 + "", 2, "0");
                    }
                    break;
                case "d": // 日
                    if (len > 1) {
                        str = BI.leftPad(date.getDate() + "", 2, "0");
                    } else {
                        str = date.getDate();
                    }
                    break;
                case "h": // 时(12)
                    var hour = date.getHours() % 12;
                    if (hour === 0) {
                        hour = 12;
                    }
                    if (len > 1) {
                        str = BI.leftPad(hour + "", 2, "0");
                    } else {
                        str = hour;
                    }
                    break;
                case "H": // 时(24)
                    if (len > 1) {
                        str = BI.leftPad(date.getHours() + "", 2, "0");
                    } else {
                        str = date.getHours();
                    }
                    break;
                case "m":
                    if (len > 1) {
                        str = BI.leftPad(date.getMinutes() + "", 2, "0");
                    } else {
                        str = date.getMinutes();
                    }
                    break;
                case "s":
                    if (len > 1) {
                        str = BI.leftPad(date.getSeconds() + "", 2, "0");
                    } else {
                        str = date.getSeconds();
                    }
                    break;
                case "a":
                    str = date.getHours() < 12 ? "am" : "pm";
                    break;
                case "z":
                    str = date.getTimezone();
                    break;
                default:
                    str = jfmt.str;
                    break;
            }
            return str;
        }
    };

    BI.object2Number = function (value) {
        if (value == null) {
            return 0;
        }
        if (typeof value === "number") {
            return value;
        }
        var str = value + "";
        if (str.indexOf(".") === -1) {
            return parseInt(str);
        }
        return parseFloat(str);
    };

    BI.object2Date = function (obj) {
        if (obj == null) {
            return new Date();
        }
        if (obj instanceof Date) {
            return obj;
        } else if (typeof obj === "number") {
            return new Date(obj);
        }
        var str = obj + "";
        str = str.replace(/-/g, "/");
        var dt = new Date(str);
        if (!isInvalidDate(dt)) {
            return dt;
        }

        return new Date();

    };

    BI.object2Time = function (obj) {
        if (obj == null) {
            return new Date();
        }
        if (obj instanceof Date) {
            return obj;
        }
        var str = obj + "";
        str = str.replace(/-/g, "/");
        var dt = new Date(str);
        if (!isInvalidDate(dt)) {
            return dt;
        }
        if (str.indexOf("/") === -1 && str.indexOf(":") !== -1) {
            dt = new Date("1970/01/01 " + str);
            if (!isInvalidDate(dt)) {
                return dt;
            }
        }
        dt = BI.parseDateTime(str, "HH:mm:ss");
        if (!isInvalidDate(dt)) {
            return dt;
        }
        return new Date();

    };
})();
(function () {
    var constantInjection = {};
    BI.constant = function (xtype, cls) {
        if (constantInjection[xtype] != null) {
            console.error("constant:[" + xtype + "] has been registed");
        }
        constantInjection[xtype] = cls;
    };

    var modelInjection = {};
    BI.model = function (xtype, cls) {
        if (modelInjection[xtype] != null) {
            console.error("model:[" + xtype + "] has been registed");
        }
        modelInjection[xtype] = cls;
    };

    var storeInjection = {};
    BI.store = function (xtype, cls) {
        if (storeInjection[xtype] != null) {
            console.error("store:[" + xtype + "] has been registed");
        }
        storeInjection[xtype] = cls;
    };

    var serviceInjection = {};
    BI.service = function (xtype, cls) {
        if (serviceInjection[xtype] != null) {
            console.error("service:[" + xtype + "] has been registed");
        }
        serviceInjection[xtype] = cls;
    };

    var providerInjection = {};
    BI.provider = function (xtype, cls) {
        if (providerInjection[xtype] != null) {
            console.error("provider:[" + xtype + "] has been registed");
        }
        providerInjection[xtype] = cls;
    };

    BI.config = function (type, configFn) {
        if (constantInjection[type]) {
            return constantInjection[type] = configFn(constantInjection[type]);
        }
        if (providerInjection[type]) {
            if (!providers[type]) {
                providers[type] = new providerInjection[type]();
            }
            return configFn(providers[type]);
        }
        BI.Plugin.configWidget(type, configFn);
    };

    var actions = {};
    var globalAction = [];
    BI.action = function (type, actionFn) {
        if (BI.isFunction(type)) {
            globalAction.push(type);
            return function () {
                BI.remove(globalAction, actionFn);
            };
        }
        if (!actions[type]) {
            actions[type] = [];
        }
        actions[type].push(actionFn);
        return function () {
            actions[type].remove(actionFn);
            if (actions[type].length === 0) {
                delete actions[type];
            }
        };
    };

    var points = {};
    BI.point = function (type, action, pointFn, after) {
        if (!points[type]) {
            points[type] = {};
        }
        if (!points[type][action]) {
            points[type][action] = {};
        }
        if (!points[type][action][after ? "after" : "before"]) {
            points[type][action][after ? "after" : "before"] = [];
        }
        points[type][action][after ? "after" : "before"].push(pointFn);
    };

    BI.Constants = {
        getConstant: function (type) {
            return constantInjection[type];
        }
    };

    var callPoint = function (inst, type) {
        if (points[type]) {
            for (var action in points[type]) {
                var bfns = points[type][action].before;
                if (bfns) {
                    BI.aspect.before(inst, action, function (bfns) {
                        return function () {
                            for (var i = 0, len = bfns.length; i < len; i++) {
                                try {
                                    bfns[i].apply(inst, arguments);
                                } catch (e) {
                                    console.error(e);
                                }
                            }
                        };
                    }(bfns));
                }
                var afns = points[type][action].after;
                if (afns) {
                    BI.aspect.after(inst, action, function (afns) {
                        return function () {
                            for (var i = 0, len = afns.length; i < len; i++) {
                                try {
                                    afns[i].apply(inst, arguments);
                                } catch (e) {
                                    console.error(e);
                                }
                            }
                        };
                    }(afns));
                }
            }
        }
    };

    BI.Models = {
        getModel: function (type, config) {
            var inst = new modelInjection[type](config);
            callPoint(inst, type);
            return inst;
        }
    };

    var stores = {};

    BI.Stores = {
        getStore: function (type, config) {
            if (stores[type]) {
                return stores[type];
            }
            stores[type] = new storeInjection[type](config);
            callPoint(stores[type], type);
            return stores[type];
        }
    };

    var services = {};

    BI.Services = {
        getService: function (type, config) {
            if (services[type]) {
                return services[type];
            }
            services[type] = new serviceInjection[type](config);
            callPoint(services[type], type);
            return services[type];
        }
    };

    var providers = {}, providerInstance = {};

    BI.Providers = {
        getProvider: function (type, config) {
            if (!providers[type]) {
                providers[type] = new providerInjection[type]();
            }
            if (!providerInstance[type]) {
                providerInstance[type] = new providers[type].$get()(config);
            }
            return providerInstance[type];
        }
    };

    BI.Actions = {
        runAction: function (type, config) {
            BI.each(actions[type], function (i, act) {
                try {
                    act(config);
                } catch (e) {
                    console.error(e);
                }
            });
        },
        runGlobalAction: function () {
            var args = [].slice.call(arguments);
            BI.each(globalAction, function (i, act) {
                try {
                    act.apply(null, args);
                } catch (e) {
                    console.error(e);
                }
            });
        }
    };
})();
(function (window, undefined) {
    function aspect (type) {
        return function (target, methodName, advice) {
            var exist = target[methodName],
                dispatcher;

            if (!exist || exist.target != target) {
                dispatcher = target[methodName] = function () {
                    // before methods
                    var beforeArr = dispatcher.before;
                    var args = arguments, next;
                    for (var l = beforeArr.length; l--;) {
                        next = beforeArr[l].advice.apply(this, args);
                        if (next === false) {
                            return false;
                        }
                        args = next || args;
                    }
                    // target method
                    var rs = dispatcher.method.apply(this, args);
                    // after methods
                    var afterArr = dispatcher.after;
                    for (var i = 0, ii = afterArr.length; i < ii; i++) {
                        next = afterArr[i].advice.call(this, rs, args);
                        if (rs === false) {
                            return false;
                        }
                        args = next || args;
                    }
                    return rs;
                };

                dispatcher.before = [];
                dispatcher.after = [];

                if (exist) {
                    dispatcher.method = exist;
                }
                dispatcher.target = target;
            }

            var aspectArr = (dispatcher || exist)[type];
            var obj = {
                advice: advice,
                _index: aspectArr.length,
                remove: function () {
                    aspectArr.splice(this._index, 1);
                }
            };
            aspectArr.push(obj);

            return obj;
        };
    }

    BI.aspect = {
        before: aspect("before"),
        after: aspect("after")
    };

    return BI.aspect;

})(window);
!(function () {

    var _keyStr = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=";


    // private method for UTF-8 encoding
    var _utf8_encode = function (string) {
        string = string.replace(/\r\n/g, "\n");
        var utftext = "";

        for (var n = 0; n < string.length; n++) {

            var c = string.charCodeAt(n);

            if (c < 128) {
                utftext += String.fromCharCode(c);
            } else if ((c > 127) && (c < 2048)) {
                utftext += String.fromCharCode((c >> 6) | 192);
                utftext += String.fromCharCode((c & 63) | 128);
            } else {
                utftext += String.fromCharCode((c >> 12) | 224);
                utftext += String.fromCharCode(((c >> 6) & 63) | 128);
                utftext += String.fromCharCode((c & 63) | 128);
            }

        }

        return utftext;
    };

    // private method for UTF-8 decoding
    var _utf8_decode = function (utftext) {
        var string = "";
        var i = 0;
        var c = 0, c3 = 0, c2 = 0;

        while (i < utftext.length) {

            c = utftext.charCodeAt(i);

            if (c < 128) {
                string += String.fromCharCode(c);
                i++;
            } else if ((c > 191) && (c < 224)) {
                c2 = utftext.charCodeAt(i + 1);
                string += String.fromCharCode(((c & 31) << 6) | (c2 & 63));
                i += 2;
            } else {
                c2 = utftext.charCodeAt(i + 1);
                c3 = utftext.charCodeAt(i + 2);
                string += String.fromCharCode(((c & 15) << 12) | ((c2 & 63) << 6) | (c3 & 63));
                i += 3;
            }

        }
        return string;
    };

    _.extend(BI, {

        encode: function (input) {
            var output = "";
            var chr1, chr2, chr3, enc1, enc2, enc3, enc4;
            var i = 0;

            input = _utf8_encode(input);

            while (i < input.length) {

                chr1 = input.charCodeAt(i++);
                chr2 = input.charCodeAt(i++);
                chr3 = input.charCodeAt(i++);

                enc1 = chr1 >> 2;
                enc2 = ((chr1 & 3) << 4) | (chr2 >> 4);
                enc3 = ((chr2 & 15) << 2) | (chr3 >> 6);
                enc4 = chr3 & 63;

                if (isNaN(chr2)) {
                    enc3 = enc4 = 64;
                } else if (isNaN(chr3)) {
                    enc4 = 64;
                }

                output = output + _keyStr.charAt(enc1) + _keyStr.charAt(enc2) + _keyStr.charAt(enc3) + _keyStr.charAt(enc4);

            }

            return output;
        },

        // public method for decoding
        decode: function (input) {
            var output = "";
            var chr1, chr2, chr3;
            var enc1, enc2, enc3, enc4;
            var i = 0;

            input = input.replace(/[^A-Za-z0-9\+\/\=]/g, "");

            while (i < input.length) {

                enc1 = _keyStr.indexOf(input.charAt(i++));
                enc2 = _keyStr.indexOf(input.charAt(i++));
                enc3 = _keyStr.indexOf(input.charAt(i++));
                enc4 = _keyStr.indexOf(input.charAt(i++));

                chr1 = (enc1 << 2) | (enc2 >> 4);
                chr2 = ((enc2 & 15) << 4) | (enc3 >> 2);
                chr3 = ((enc3 & 3) << 6) | enc4;

                output = output + String.fromCharCode(chr1);

                if (enc3 != 64) {
                    output = output + String.fromCharCode(chr2);
                }
                if (enc4 != 64) {
                    output = output + String.fromCharCode(chr3);
                }

            }

            output = _utf8_decode(output);

            return output;

        }
    });
})();
BI.Cache = {
    _prefix: "bi",
    setUsername: function (username) {
        localStorage.setItem(BI.Cache._prefix + ".username", (username + "" || "").toUpperCase());
    },
    getUsername: function () {
        return localStorage.getItem(BI.Cache._prefix + ".username") || "";
    },
    _getKeyPrefix: function () {
        return BI.Cache.getUsername() + "." + BI.Cache._prefix + ".";
    },
    _generateKey: function (key) {
        return BI.Cache._getKeyPrefix() + (key || "");
    },
    getItem: function (key) {
        return localStorage.getItem(BI.Cache._generateKey(key));
    },
    setItem: function (key, value) {
        localStorage.setItem(BI.Cache._generateKey(key), value);
    },
    removeItem: function (key) {
        localStorage.removeItem(BI.Cache._generateKey(key));
    },
    clear: function () {
        for (var i = localStorage.length; i >= 0; i--) {
            var key = localStorage.key(i);
            if (key) {
                if (key.indexOf(BI.Cache._getKeyPrefix()) === 0) {
                    localStorage.removeItem(key);
                }
            }
        }
    },
    keys: function () {
        var result = [];
        for (var i = localStorage.length; i >= 0; i--) {
            var key = localStorage.key(i);
            if (key) {
                var prefix = BI.Cache._getKeyPrefix();
                if (key.indexOf(prefix) === 0) {
                    result[result.length] = key.substring(prefix.length);
                }
            }
        }
        return result;
    },

    addCookie: function (name, value, path, expiresHours) {
        var cookieString = name + "=" + escape(value);
        // 判断是否设置过期时间
        if (expiresHours && expiresHours > 0) {
            var date = new Date();
            date.setTime(BI.getTime() + expiresHours * 3600 * 1000);
            cookieString = cookieString + "; expires=" + date.toGMTString();
        }
        if (path) {
            cookieString = cookieString + "; path=" + path;
        }
        document.cookie = cookieString;
    },
    getCookie: function (name) {
        var arr, reg = new RegExp("(^| )" + name + "=([^;]*)(;|$)");
        if (arr = document.cookie.match(reg)) {return unescape(arr[2]);}
        return null;
    },
    deleteCookie: function (name, path) {
        var date = new Date();
        date.setTime(BI.getTime() - 10000);
        var cookieString = name + "=v; expires=" + date.toGMTString();
        if (path) {
            cookieString = cookieString + "; path=" + path;
        }
        document.cookie = cookieString;
    }
};BI.CellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize) {
    this._cellSizeGetter = cellSizeGetter;
    this._cellCount = cellCount;
    this._estimatedCellSize = estimatedCellSize;
    this._cellSizeAndPositionData = {};
    this._lastMeasuredIndex = -1;
};

BI.CellSizeAndPositionManager.prototype = {
    constructor: BI.CellSizeAndPositionManager,
    configure: function (cellCount, estimatedCellSize) {
        this._cellCount = cellCount;
        this._estimatedCellSize = estimatedCellSize;
    },

    getCellCount: function () {
        return this._cellCount;
    },

    getEstimatedCellSize: function () {
        return this._estimatedCellSize;
    },

    getLastMeasuredIndex: function () {
        return this._lastMeasuredIndex;
    },

    getSizeAndPositionOfCell: function (index) {
        if (index < 0 || index >= this._cellCount) {
            return;
        }
        if (index > this._lastMeasuredIndex) {
            var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
            var offset = lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size;

            for (var i = this._lastMeasuredIndex + 1; i <= index; i++) {
                var size = this._cellSizeGetter(i);

                if (size == null || isNaN(size)) {
                    continue;
                }

                this._cellSizeAndPositionData[i] = {
                    offset: offset,
                    size: size
                };

                offset += size;
            }

            this._lastMeasuredIndex = index;
        }
        return this._cellSizeAndPositionData[index];
    },

    getSizeAndPositionOfLastMeasuredCell: function () {
        return this._lastMeasuredIndex >= 0
            ? this._cellSizeAndPositionData[this._lastMeasuredIndex]
            : {
                offset: 0,
                size: 0
            };
    },

    getTotalSize: function () {
        var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
        return lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size + (this._cellCount - this._lastMeasuredIndex - 1) * this._estimatedCellSize;
    },

    getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) {
        var datum = this.getSizeAndPositionOfCell(targetIndex);
        var maxOffset = datum.offset;
        var minOffset = maxOffset - containerSize + datum.size;

        var idealOffset;

        switch (align) {
            case "start":
                idealOffset = maxOffset;
                break;
            case "end":
                idealOffset = minOffset;
                break;
            case "center":
                idealOffset = maxOffset - ((containerSize - datum.size) / 2);
                break;
            default:
                idealOffset = Math.max(minOffset, Math.min(maxOffset, currentOffset));
                break;
        }

        var totalSize = this.getTotalSize();

        return Math.max(0, Math.min(totalSize - containerSize, idealOffset));
    },

    getVisibleCellRange: function (containerSize, offset) {
        var totalSize = this.getTotalSize();

        if (totalSize === 0) {
            return {};
        }

        var maxOffset = offset + containerSize;
        var start = this._findNearestCell(offset);

        var datum = this.getSizeAndPositionOfCell(start);
        offset = datum.offset + datum.size;

        var stop = start;

        while (offset < maxOffset && stop < this._cellCount - 1) {
            stop++;
            offset += this.getSizeAndPositionOfCell(stop).size;
        }

        return {
            start: start,
            stop: stop
        };
    },

    resetCell: function (index) {
        this._lastMeasuredIndex = Math.min(this._lastMeasuredIndex, index - 1);
    },

    _binarySearch: function (high, low, offset) {
        var middle;
        var currentOffset;

        while (low <= high) {
            middle = low + Math.floor((high - low) / 2);
            currentOffset = this.getSizeAndPositionOfCell(middle).offset;

            if (currentOffset === offset) {
                return middle;
            } else if (currentOffset < offset) {
                low = middle + 1;
            } else if (currentOffset > offset) {
                high = middle - 1;
            }
        }

        if (low > 0) {
            return low - 1;
        }
    },

    _exponentialSearch: function (index, offset) {
        var interval = 1;

        while (index < this._cellCount && this.getSizeAndPositionOfCell(index).offset < offset) {
            index += interval;
            interval *= 2;
        }

        return this._binarySearch(Math.min(index, this._cellCount - 1), Math.floor(index / 2), offset);
    },

    _findNearestCell: function (offset) {
        if (isNaN(offset)) {
            return;
        }

        offset = Math.max(0, offset);

        var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
        var lastMeasuredIndex = Math.max(0, this._lastMeasuredIndex);

        if (lastMeasuredCellSizeAndPosition.offset >= offset) {
            return this._binarySearch(lastMeasuredIndex, 0, offset);
        }
        return this._exponentialSearch(lastMeasuredIndex, offset);
        
    }
};

BI.ScalingCellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize, maxScrollSize) {
    this._cellSizeAndPositionManager = new BI.CellSizeAndPositionManager(cellCount, cellSizeGetter, estimatedCellSize);
    this._maxScrollSize = maxScrollSize || 10000000;
};

BI.ScalingCellSizeAndPositionManager.prototype = {
    constructor: BI.ScalingCellSizeAndPositionManager,

    configure: function () {
        this._cellSizeAndPositionManager.configure.apply(this._cellSizeAndPositionManager, arguments);
    },

    getCellCount: function () {
        return this._cellSizeAndPositionManager.getCellCount();
    },

    getEstimatedCellSize: function () {
        return this._cellSizeAndPositionManager.getEstimatedCellSize();
    },

    getLastMeasuredIndex: function () {
        return this._cellSizeAndPositionManager.getLastMeasuredIndex();
    },

    getOffsetAdjustment: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize);

        return Math.round(offsetPercentage * (safeTotalSize - totalSize));
    },

    getSizeAndPositionOfCell: function (index) {
        return this._cellSizeAndPositionManager.getSizeAndPositionOfCell(index);
    },

    getSizeAndPositionOfLastMeasuredCell: function () {
        return this._cellSizeAndPositionManager.getSizeAndPositionOfLastMeasuredCell();
    },

    getTotalSize: function () {
        return Math.min(this._maxScrollSize, this._cellSizeAndPositionManager.getTotalSize());
    },

    getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) {
        currentOffset = this._safeOffsetToOffset(containerSize, currentOffset);

        var offset = this._cellSizeAndPositionManager.getUpdatedOffsetForIndex(align, containerSize, currentOffset, targetIndex);

        return this._offsetToSafeOffset(containerSize, offset);
    },

    getVisibleCellRange: function (containerSize, offset) {
        offset = this._safeOffsetToOffset(containerSize, offset);

        return this._cellSizeAndPositionManager.getVisibleCellRange(containerSize, offset);
    },

    resetCell: function (index) {
        this._cellSizeAndPositionManager.resetCell(index);
    },

    _getOffsetPercentage: function (containerSize, offset, totalSize) {
        return totalSize <= containerSize
            ? 0
            : offset / (totalSize - containerSize);
    },

    _offsetToSafeOffset: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();

        if (totalSize === safeTotalSize) {
            return offset;
        }
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, totalSize);

        return Math.round(offsetPercentage * (safeTotalSize - containerSize));
        
    },

    _safeOffsetToOffset: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();

        if (totalSize === safeTotalSize) {
            return offset;
        }
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize);

        return Math.round(offsetPercentage * (totalSize - containerSize));
        
    }
};/**
 * 汉字拼音索引
 */

!(function () {
    var _ChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY";

    // 此处收录了375个多音字,数据来自于http://www.51window.net/page/pinyin
    var oMultiDiff = {
        19969: "DZ",
        19975: "WM",
        19988: "QJ",
        20048: "YL",
        20056: "SC",
        20060: "NM",
        20094: "QG",
        20127: "QJ",
        20167: "QC",
        20193: "YG",
        20250: "KH",
        20256: "ZC",
        20282: "SC",
        20285: "QJG",
        20291: "TD",
        20314: "YD",
        20315: "BF",
        20340: "NE",
        20375: "TD",
        20389: "YJ",
        20391: "CZ",
        20415: "PB",
        20446: "YS",
        20447: "SQ",
        20504: "TC",
        20608: "KG",
        20854: "QJ",
        20857: "ZC",
        20911: "PF",
        20985: "AW",
        21032: "PB",
        21048: "XQ",
        21049: "SC",
        21089: "YS",
        21119: "JC",
        21242: "SB",
        21273: "SC",
        21305: "YP",
        21306: "QO",
        21330: "ZC",
        21333: "SDC",
        21345: "QK",
        21378: "CA",
        21397: "SC",
        21414: "XS",
        21442: "SC",
        21477: "JG",
        21480: "TD",
        21484: "ZS",
        21494: "YX",
        21505: "YX",
        21512: "HG",
        21523: "XH",
        21537: "PB",
        21542: "PF",
        21549: "KH",
        21571: "E",
        21574: "DA",
        21588: "TD",
        21589: "O",
        21618: "ZC",
        21621: "KHA",
        21632: "ZJ",
        21654: "KG",
        21679: "LKG",
        21683: "KH",
        21710: "A",
        21719: "YH",
        21734: "WOE",
        21769: "A",
        21780: "WN",
        21804: "XH",
        21834: "A",
        21899: "ZD",
        21903: "RN",
        21908: "WO",
        21939: "ZC",
        21956: "SA",
        21964: "YA",
        21970: "TD",
        22003: "A",
        22031: "JG",
        22040: "XS",
        22060: "ZC",
        22066: "ZC",
        22079: "MH",
        22129: "XJ",
        22179: "XA",
        22237: "NJ",
        22244: "TD",
        22280: "JQ",
        22300: "YH",
        22313: "XW",
        22331: "YQ",
        22343: "YJ",
        22351: "PH",
        22395: "DC",
        22412: "TD",
        22484: "PB",
        22500: "PB",
        22534: "ZD",
        22549: "DH",
        22561: "PB",
        22612: "TD",
        22771: "KQ",
        22831: "HB",
        22841: "JG",
        22855: "QJ",
        22865: "XQ",
        23013: "ML",
        23081: "WM",
        23487: "SX",
        23558: "QJ",
        23561: "YW",
        23586: "YW",
        23614: "YW",
        23615: "SN",
        23631: "PB",
        23646: "ZS",
        23663: "ZT",
        23673: "YG",
        23762: "TD",
        23769: "ZS",
        23780: "QJ",
        23884: "QK",
        24055: "XH",
        24113: "DC",
        24162: "ZC",
        24191: "GA",
        24273: "QJ",
        24324: "NL",
        24377: "TD",
        24378: "QJ",
        24439: "PF",
        24554: "ZS",
        24683: "TD",
        24694: "WE",
        24733: "LK",
        24925: "TN",
        25094: "ZG",
        25100: "XQ",
        25103: "XH",
        25153: "PB",
        25170: "PB",
        25179: "KG",
        25203: "PB",
        25240: "ZS",
        25282: "FB",
        25303: "NA",
        25324: "KG",
        25341: "ZY",
        25373: "WZ",
        25375: "XJ",
        25384: "A",
        25457: "A",
        25528: "SD",
        25530: "SC",
        25552: "TD",
        25774: "ZC",
        25874: "ZC",
        26044: "YW",
        26080: "WM",
        26292: "PB",
        26333: "PB",
        26355: "ZY",
        26366: "CZ",
        26397: "ZC",
        26399: "QJ",
        26415: "ZS",
        26451: "SB",
        26526: "ZC",
        26552: "JG",
        26561: "TD",
        26588: "JG",
        26597: "CZ",
        26629: "ZS",
        26638: "YL",
        26646: "XQ",
        26653: "KG",
        26657: "XJ",
        26727: "HG",
        26894: "ZC",
        26937: "ZS",
        26946: "ZC",
        26999: "KJ",
        27099: "KJ",
        27449: "YQ",
        27481: "XS",
        27542: "ZS",
        27663: "ZS",
        27748: "TS",
        27784: "SC",
        27788: "ZD",
        27795: "TD",
        27812: "O",
        27850: "PB",
        27852: "MB",
        27895: "SL",
        27898: "PL",
        27973: "QJ",
        27981: "KH",
        27986: "HX",
        27994: "XJ",
        28044: "YC",
        28065: "WG",
        28177: "SM",
        28267: "QJ",
        28291: "KH",
        28337: "ZQ",
        28463: "TL",
        28548: "DC",
        28601: "TD",
        28689: "PB",
        28805: "JG",
        28820: "QG",
        28846: "PB",
        28952: "TD",
        28975: "ZC",
        29100: "A",
        29325: "QJ",
        29575: "SL",
        29602: "FB",
        30010: "TD",
        30044: "CX",
        30058: "PF",
        30091: "YSP",
        30111: "YN",
        30229: "XJ",
        30427: "SC",
        30465: "SX",
        30631: "YQ",
        30655: "QJ",
        30684: "QJG",
        30707: "SD",
        30729: "XH",
        30796: "LG",
        30917: "PB",
        31074: "NM",
        31085: "JZ",
        31109: "SC",
        31181: "ZC",
        31192: "MLB",
        31293: "JQ",
        31400: "YX",
        31584: "YJ",
        31896: "ZN",
        31909: "ZY",
        31995: "XJ",
        32321: "PF",
        32327: "ZY",
        32418: "HG",
        32420: "XQ",
        32421: "HG",
        32438: "LG",
        32473: "GJ",
        32488: "TD",
        32521: "QJ",
        32527: "PB",
        32562: "ZSQ",
        32564: "JZ",
        32735: "ZD",
        32793: "PB",
        33071: "PF",
        33098: "XL",
        33100: "YA",
        33152: "PB",
        33261: "CX",
        33324: "BP",
        33333: "TD",
        33406: "YA",
        33426: "WM",
        33432: "PB",
        33445: "JG",
        33486: "ZN",
        33493: "TS",
        33507: "QJ",
        33540: "QJ",
        33544: "ZC",
        33564: "XQ",
        33617: "YT",
        33632: "QJ",
        33636: "XH",
        33637: "YX",
        33694: "WG",
        33705: "PF",
        33728: "YW",
        33882: "SR",
        34067: "WM",
        34074: "YW",
        34121: "QJ",
        34255: "ZC",
        34259: "XL",
        34425: "JH",
        34430: "XH",
        34485: "KH",
        34503: "YS",
        34532: "HG",
        34552: "XS",
        34558: "YE",
        34593: "ZL",
        34660: "YQ",
        34892: "XH",
        34928: "SC",
        34999: "QJ",
        35048: "PB",
        35059: "SC",
        35098: "ZC",
        35203: "TQ",
        35265: "JX",
        35299: "JX",
        35782: "SZ",
        35828: "YS",
        35830: "E",
        35843: "TD",
        35895: "YG",
        35977: "MH",
        36158: "JG",
        36228: "QJ",
        36426: "XQ",
        36466: "DC",
        36710: "JC",
        36711: "ZYG",
        36767: "PB",
        36866: "SK",
        36951: "YW",
        37034: "YX",
        37063: "XH",
        37218: "ZC",
        37325: "ZC",
        38063: "PB",
        38079: "TD",
        38085: "QY",
        38107: "DC",
        38116: "TD",
        38123: "YD",
        38224: "HG",
        38241: "XTC",
        38271: "ZC",
        38415: "YE",
        38426: "KH",
        38461: "YD",
        38463: "AE",
        38466: "PB",
        38477: "XJ",
        38518: "YT",
        38551: "WK",
        38585: "ZC",
        38704: "XS",
        38739: "LJ",
        38761: "GJ",
        38808: "SQ",
        39048: "JG",
        39049: "XJ",
        39052: "HG",
        39076: "CZ",
        39271: "XT",
        39534: "TD",
        39552: "TD",
        39584: "PB",
        39647: "SB",
        39730: "LG",
        39748: "TPB",
        40109: "ZQ",
        40479: "ND",
        40516: "HG",
        40536: "HG",
        40583: "QJ",
        40765: "YQ",
        40784: "QJ",
        40840: "YK",
        40863: "QJG"
    };

    var _checkPYCh = function (ch) {
        var uni = ch.charCodeAt(0);
        // 如果不在汉字处理范围之内,返回原字符,也可以调用自己的处理函数
        if (uni > 40869 || uni < 19968) {return ch;} // dealWithOthers(ch);
        return (oMultiDiff[uni] ? oMultiDiff[uni] : (_ChineseFirstPY.charAt(uni - 19968)));
    };

    var _mkPYRslt = function (arr) {
        var arrRslt = [""], k;
        for (var i = 0, len = arr.length; i < len; i++) {
            var str = arr[i];
            var strlen = str.length;
            if (strlen == 1) {
                for (k = 0; k < arrRslt.length; k++) {
                    arrRslt[k] += str;
                }
            } else {
                var tmpArr = arrRslt.slice(0);
                arrRslt = [];
                for (k = 0; k < strlen; k++) {
                    // 复制一个相同的arrRslt
                    var tmp = tmpArr.slice(0);
                    // 把当前字符str[k]添加到每个元素末尾
                    for (var j = 0; j < tmp.length; j++) {
                        tmp[j] += str.charAt(k);
                    }
                    // 把复制并修改后的数组连接到arrRslt上
                    arrRslt = arrRslt.concat(tmp);
                }
            }
        }
        return arrRslt.join("").toLowerCase();
    };

    _.extend(BI, {
        makeFirstPY: function (str) {
            if (typeof (str) !== "string") {return "" + str;}
            var arrResult = []; // 保存中间结果的数组
            for (var i = 0, len = str.length; i < len; i++) {
                // 获得unicode码
                var ch = str.charAt(i);
                // 检查该unicode码是否在处理范围之内,在则返回该码对映汉字的拼音首字母,不在则调用其它函数处理
                arrResult.push(_checkPYCh(ch));
            }
            // 处理arrResult,返回所有可能的拼音首字母串数组
            return _mkPYRslt(arrResult);
        }
    });
})();/**
 * Detect Element Resize.
 * Forked in order to guard against unsafe 'window' and 'document' references.
 *
 * https://github.com/sdecima/javascript-detect-element-resize
 * Sebastian Decima
 *
 * version: 0.5.3
 **/
!(function () {
    // Check `document` and `window` in case of server-side rendering
    var _window;
    if (typeof window !== "undefined") {
        _window = window;
    } else if (typeof self !== "undefined") {
        _window = self;
    } else {
        _window = this;
    }

    var addEventListener = typeof document !== "undefined" && document.addEventListener;
    var stylesCreated = false;

    if (addEventListener) {
        var requestFrame = (function () {
            var raf = _window.requestAnimationFrame || _window.mozRequestAnimationFrame || _window.webkitRequestAnimationFrame ||
                function (fn) {
                    return _window.setTimeout(fn, 20);
                };
            return function (fn) {
                return raf(fn);
            };
        })();

        var cancelFrame = (function () {
            var cancel = _window.cancelAnimationFrame || _window.mozCancelAnimationFrame || _window.webkitCancelAnimationFrame ||
                _window.clearTimeout;
            return function (id) {
                return cancel(id);
            };
        })();

        var resetTriggers = function (element) {
            var triggers = element.__resizeTriggers__,
                expand = triggers.firstElementChild,
                contract = triggers.lastElementChild,
                expandChild = expand.firstElementChild;
            contract.scrollLeft = contract.scrollWidth;
            contract.scrollTop = contract.scrollHeight;
            expandChild.style.width = expand.offsetWidth + 1 + "px";
            expandChild.style.height = expand.offsetHeight + 1 + "px";
            expand.scrollLeft = expand.scrollWidth;
            expand.scrollTop = expand.scrollHeight;
        };

        var checkTriggers = function (element) {
            return element.offsetWidth !== element.__resizeLast__.width ||
                element.offsetHeight !== element.__resizeLast__.height;
        };

        var scrollListener = function (e) {
            var element = this;
            resetTriggers(this);
            if (this.__resizeRAF__) cancelFrame(this.__resizeRAF__);
            this.__resizeRAF__ = requestFrame(function () {
                if (checkTriggers(element)) {
                    element.__resizeLast__.width = element.offsetWidth;
                    element.__resizeLast__.height = element.offsetHeight;
                    element.__resizeListeners__.forEach(function (fn) {
                        fn.call(element, e);
                    });
                }
            });
        };

        /* Detect CSS Animations support to detect element display/re-attach */
        var animation = false,
            animationstring = "animation",
            keyframeprefix = "",
            animationstartevent = "animationstart",
            domPrefixes = "Webkit Moz O ms".split(" "),
            startEvents = "webkitAnimationStart animationstart oAnimationStart MSAnimationStart".split(" "),
            pfx = "";
        {
            var elm = document.createElement("fakeelement");
            if (elm.style.animationName !== undefined) {
                animation = true;
            }

            if (animation === false) {
                for (var i = 0; i < domPrefixes.length; i++) {
                    if (elm.style[domPrefixes[i] + "AnimationName"] !== undefined) {
                        pfx = domPrefixes[i];
                        animationstring = pfx + "Animation";
                        keyframeprefix = "-" + pfx.toLowerCase() + "-";
                        animationstartevent = startEvents[i];
                        animation = true;
                        break;
                    }
                }
            }
        }

        var animationName = "resizeanim";
        var animationKeyframes = "@" + keyframeprefix + "keyframes " + animationName + " { from { opacity: 0; } to { opacity: 0; } } ";
        var animationStyle = keyframeprefix + "animation: 1ms " + animationName + "; ";
    }

    var createStyles = function () {
        if (!stylesCreated) {
            // opacity:0 works around a chrome bug https://code.google.com/p/chromium/issues/detail?id=286360
            var css = (animationKeyframes ? animationKeyframes : "") +
                    ".resize-triggers { " + (animationStyle ? animationStyle : "") + "visibility: hidden; opacity: 0; } " +
                    ".resize-triggers, .resize-triggers > div, .contract-trigger:before { content: \" \"; display: block; position: absolute; top: 0; left: 0; height: 100%; width: 100%; overflow: hidden; } .resize-triggers > div { background: #eee; overflow: auto; } .contract-trigger:before { width: 200%; height: 200%; }",
                head = document.head || document.getElementsByTagName("head")[0],
                style = document.createElement("style");

            style.type = "text/css";
            if (style.styleSheet) {
                style.styleSheet.cssText = css;
            } else {
                style.appendChild(document.createTextNode(css));
            }

            head.appendChild(style);
            stylesCreated = true;
        }
    };

    var addResizeListener = function (element, fn) {
        if (addEventListener) {
            if (!element.__resizeTriggers__) {
                if (getComputedStyle(element).position === "static") element.style.position = "relative";
                createStyles();
                element.__resizeLast__ = {};
                element.__resizeListeners__ = [];
                (element.__resizeTriggers__ = document.createElement("div")).className = "resize-triggers";
                element.__resizeTriggers__.innerHTML = "<div class=\"expand-trigger\"><div></div></div>" +
                    "<div class=\"contract-trigger\"></div>";
                element.appendChild(element.__resizeTriggers__);
                resetTriggers(element);
                element.addEventListener("scroll", scrollListener, true);

                /* Listen for a css animation to detect element display/re-attach */
                animationstartevent && element.__resizeTriggers__.addEventListener(animationstartevent, function (e) {
                    if (e.animationName === animationName) {resetTriggers(element);}
                });
            }
            element.__resizeListeners__.push(fn);

        } else {
            element.attachEvent("onresize", fn);
        }
    };

    var removeResizeListener = function (element, fn) {
        if (addEventListener) {
            element.__resizeListeners__.splice(element.__resizeListeners__.indexOf(fn), 1);
            if (!element.__resizeListeners__.length) {
                element.removeEventListener("scroll", scrollListener, true);
                element.__resizeTriggers__ = !element.removeChild(element.__resizeTriggers__);
            }
        } else {
            element.detachEvent("onresize", fn);
        }
    };

    BI.ResizeDetector = {
        addResizeListener: function (widget, fn) {
            addResizeListener(widget.element[0], fn);
            return function () {
                removeResizeListener(widget.element[0], fn);
            };
        },
        removeResizeListener: function (widget, fn) {
            removeResizeListener(widget.element[0], fn);
        }
    };
}());

(function () {
    function defaultComparator (a, b) {
        return a < b;
    }

    BI.Heap = function (items, comparator) {
        this._items = items || [];
        this._size = this._items.length;
        this._comparator = comparator || defaultComparator;
        this._heapify();
    };

    BI.Heap.prototype = {
        constructor: BI.Heap,
        empty: function () {
            return this._size === 0;
        },

        pop: function () {
            if (this._size === 0) {
                return;
            }

            var elt = this._items[0];

            var lastElt = this._items.pop();
            this._size--;

            if (this._size > 0) {
                this._items[0] = lastElt;
                this._sinkDown(0);
            }

            return elt;
        },

        push: function (item) {
            this._items[this._size++] = item;
            this._bubbleUp(this._size - 1);
        },

        size: function () {
            return this._size;
        },

        peek: function () {
            if (this._size === 0) {
                return;
            }

            return this._items[0];
        },

        _heapify: function () {
            for (var index = Math.floor((this._size + 1) / 2); index >= 0; index--) {
                this._sinkDown(index);
            }
        },

        _bubbleUp: function (index) {
            var elt = this._items[index];
            while (index > 0) {
                var parentIndex = Math.floor((index + 1) / 2) - 1;
                var parentElt = this._items[parentIndex];

                // if parentElt < elt, stop
                if (this._comparator(parentElt, elt)) {
                    return;
                }

                // swap
                this._items[parentIndex] = elt;
                this._items[index] = parentElt;
                index = parentIndex;
            }
        },

        _sinkDown: function (index) {
            var elt = this._items[index];

            while (true) {
                var leftChildIndex = 2 * (index + 1) - 1;
                var rightChildIndex = 2 * (index + 1);
                var swapIndex = -1;

                if (leftChildIndex < this._size) {
                    var leftChild = this._items[leftChildIndex];
                    if (this._comparator(leftChild, elt)) {
                        swapIndex = leftChildIndex;
                    }
                }

                if (rightChildIndex < this._size) {
                    var rightChild = this._items[rightChildIndex];
                    if (this._comparator(rightChild, elt)) {
                        if (swapIndex === -1 ||
                            this._comparator(rightChild, this._items[swapIndex])) {
                            swapIndex = rightChildIndex;
                        }
                    }
                }

                // if we don't have a swap, stop
                if (swapIndex === -1) {
                    return;
                }

                this._items[index] = this._items[swapIndex];
                this._items[swapIndex] = elt;
                index = swapIndex;
            }
        }
    };
})();
(function () {
    var clamp = function (min, value, max) {
        if (value < min) {
            return min;
        }
        if (value > max) {
            return max;
        }
        return value;
    };

    var BUFFER_ROWS = 5;
    var NO_ROWS_SCROLL_RESULT = {
        index: 0,
        offset: 0,
        position: 0,
        contentHeight: 0
    };

    BI.TableScrollHelper = function (rowCount,
        defaultRowHeight,
        viewportHeight,
        rowHeightGetter) {
        this._rowOffsets = BI.PrefixIntervalTree.uniform(rowCount, defaultRowHeight);
        this._storedHeights = new Array(rowCount);
        for (var i = 0; i < rowCount; ++i) {
            this._storedHeights[i] = defaultRowHeight;
        }
        this._rowCount = rowCount;
        this._position = 0;
        this._contentHeight = rowCount * defaultRowHeight;
        this._defaultRowHeight = defaultRowHeight;
        this._rowHeightGetter = rowHeightGetter ?
            rowHeightGetter : function () {
                return defaultRowHeight;
            };
        this._viewportHeight = viewportHeight;

        this._updateHeightsInViewport(0, 0);
    };

    BI.TableScrollHelper.prototype = {
        constructor: BI.TableScrollHelper,
        setRowHeightGetter: function (rowHeightGetter) {
            this._rowHeightGetter = rowHeightGetter;
        },

        setViewportHeight: function (viewportHeight) {
            this._viewportHeight = viewportHeight;
        },

        getContentHeight: function () {
            return this._contentHeight;
        },

        _updateHeightsInViewport: function (firstRowIndex,
            firstRowOffset) {
            var top = firstRowOffset;
            var index = firstRowIndex;
            while (top <= this._viewportHeight && index < this._rowCount) {
                this._updateRowHeight(index);
                top += this._storedHeights[index];
                index++;
            }
        },

        _updateHeightsAboveViewport: function (firstRowIndex) {
            var index = firstRowIndex - 1;
            while (index >= 0 && index >= firstRowIndex - BUFFER_ROWS) {
                var delta = this._updateRowHeight(index);
                this._position += delta;
                index--;
            }
        },

        _updateRowHeight: function (rowIndex) {
            if (rowIndex < 0 || rowIndex >= this._rowCount) {
                return 0;
            }
            var newHeight = this._rowHeightGetter(rowIndex);
            if (newHeight !== this._storedHeights[rowIndex]) {
                var change = newHeight - this._storedHeights[rowIndex];
                this._rowOffsets.set(rowIndex, newHeight);
                this._storedHeights[rowIndex] = newHeight;
                this._contentHeight += change;
                return change;
            }
            return 0;
        },

        getRowPosition: function (rowIndex) {
            this._updateRowHeight(rowIndex);
            return this._rowOffsets.sumUntil(rowIndex);
        },

        scrollBy: function (delta) {
            if (this._rowCount === 0) {
                return NO_ROWS_SCROLL_RESULT;
            }
            var firstRow = this._rowOffsets.greatestLowerBound(this._position);
            firstRow = clamp(firstRow, 0, Math.max(this._rowCount - 1, 0));
            var firstRowPosition = this._rowOffsets.sumUntil(firstRow);
            var rowIndex = firstRow;
            var position = this._position;

            var rowHeightChange = this._updateRowHeight(rowIndex);
            if (firstRowPosition !== 0) {
                position += rowHeightChange;
            }
            var visibleRowHeight = this._storedHeights[rowIndex] -
                (position - firstRowPosition);

            if (delta >= 0) {

                while (delta > 0 && rowIndex < this._rowCount) {
                    if (delta < visibleRowHeight) {
                        position += delta;
                        delta = 0;
                    } else {
                        delta -= visibleRowHeight;
                        position += visibleRowHeight;
                        rowIndex++;
                    }
                    if (rowIndex < this._rowCount) {
                        this._updateRowHeight(rowIndex);
                        visibleRowHeight = this._storedHeights[rowIndex];
                    }
                }
            } else if (delta < 0) {
                delta = -delta;
                var invisibleRowHeight = this._storedHeights[rowIndex] - visibleRowHeight;

                while (delta > 0 && rowIndex >= 0) {
                    if (delta < invisibleRowHeight) {
                        position -= delta;
                        delta = 0;
                    } else {
                        position -= invisibleRowHeight;
                        delta -= invisibleRowHeight;
                        rowIndex--;
                    }
                    if (rowIndex >= 0) {
                        var change = this._updateRowHeight(rowIndex);
                        invisibleRowHeight = this._storedHeights[rowIndex];
                        position += change;
                    }
                }
            }

            var maxPosition = this._contentHeight - this._viewportHeight;
            position = clamp(position, 0, maxPosition);
            this._position = position;
            var firstRowIndex = this._rowOffsets.greatestLowerBound(position);
            firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0));
            firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex);
            var firstRowOffset = firstRowPosition - position;

            this._updateHeightsInViewport(firstRowIndex, firstRowOffset);
            this._updateHeightsAboveViewport(firstRowIndex);

            return {
                index: firstRowIndex,
                offset: firstRowOffset,
                position: this._position,
                contentHeight: this._contentHeight
            };
        },

        _getRowAtEndPosition: function (rowIndex) {
            // We need to update enough rows above the selected one to be sure that when
            // we scroll to selected position all rows between first shown and selected
            // one have most recent heights computed and will not resize
            this._updateRowHeight(rowIndex);
            var currentRowIndex = rowIndex;
            var top = this._storedHeights[currentRowIndex];
            while (top < this._viewportHeight && currentRowIndex >= 0) {
                currentRowIndex--;
                if (currentRowIndex >= 0) {
                    this._updateRowHeight(currentRowIndex);
                    top += this._storedHeights[currentRowIndex];
                }
            }
            var position = this._rowOffsets.sumTo(rowIndex) - this._viewportHeight;
            if (position < 0) {
                position = 0;
            }
            return position;
        },

        scrollTo: function (position) {
            if (this._rowCount === 0) {
                return NO_ROWS_SCROLL_RESULT;
            }
            if (position <= 0) {
                // If position less than or equal to 0 first row should be fully visible
                // on top
                this._position = 0;
                this._updateHeightsInViewport(0, 0);

                return {
                    index: 0,
                    offset: 0,
                    position: this._position,
                    contentHeight: this._contentHeight
                };
            } else if (position >= this._contentHeight - this._viewportHeight) {
                // If position is equal to or greater than max scroll value, we need
                // to make sure to have bottom border of last row visible.
                var rowIndex = this._rowCount - 1;
                position = this._getRowAtEndPosition(rowIndex);
            }
            this._position = position;

            var firstRowIndex = this._rowOffsets.greatestLowerBound(position);
            firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0));
            var firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex);
            var firstRowOffset = firstRowPosition - position;

            this._updateHeightsInViewport(firstRowIndex, firstRowOffset);
            this._updateHeightsAboveViewport(firstRowIndex);

            return {
                index: firstRowIndex,
                offset: firstRowOffset,
                position: this._position,
                contentHeight: this._contentHeight
            };
        },

        /**
         * Allows to scroll to selected row with specified offset. It always
         * brings that row to top of viewport with that offset
         */
        scrollToRow: function (rowIndex, offset) {
            rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0));
            offset = clamp(offset, -this._storedHeights[rowIndex], 0);
            var firstRow = this._rowOffsets.sumUntil(rowIndex);
            return this.scrollTo(firstRow - offset);
        },

        /**
         * Allows to scroll to selected row by bringing it to viewport with minimal
         * scrolling. This that if row is fully visible, scroll will not be changed.
         * If top border of row is above top of viewport it will be scrolled to be
         * fully visible on the top of viewport. If the bottom border of row is
         * below end of viewport, it will be scrolled up to be fully visible on the
         * bottom of viewport.
         */
        scrollRowIntoView: function (rowIndex) {
            rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0));
            var rowBegin = this._rowOffsets.sumUntil(rowIndex);
            var rowEnd = rowBegin + this._storedHeights[rowIndex];
            if (rowBegin < this._position) {
                return this.scrollTo(rowBegin);
            } else if (this._position + this._viewportHeight < rowEnd) {
                var position = this._getRowAtEndPosition(rowIndex);
                return this.scrollTo(position);
            }
            return this.scrollTo(this._position);
        }
    };

})();
// Data structure that allows to store values and assign positions to them
// in a way to minimize changing positions of stored values when new ones are
// added or when some values are replaced. Stored elements are alwasy assigned
// a consecutive set of positoins startin from 0 up to count of elements less 1
// Following actions can be executed
// * get position assigned to given value (null if value is not stored)
// * create new entry for new value and get assigned position back
// * replace value that is furthest from specified value range with new value
//   and get it's position back
// All operations take amortized log(n) time where n is number of elements in
// the set.
BI.IntegerBufferSet = function () {
    this._valueToPositionMap = {};
    this._size = 0;
    this._smallValues = new BI.Heap(
        [], // Initial data in the heap
        this._smallerComparator
    );
    this._largeValues = new BI.Heap(
        [], // Initial data in the heap
        this._greaterComparator
    );

};

BI.IntegerBufferSet.prototype = {
    constructor: BI.IntegerBufferSet,
    getSize: function () /* number*/ {
        return this._size;
    },

    getValuePosition: function (/* number*/ value) /* ?number*/ {
        if (this._valueToPositionMap[value] === undefined) {
            return null;
        }
        return this._valueToPositionMap[value];
    },

    getNewPositionForValue: function (/* number*/ value) /* number*/ {
        var newPosition = this._size;
        this._size++;
        this._pushToHeaps(newPosition, value);
        this._valueToPositionMap[value] = newPosition;
        return newPosition;
    },

    replaceFurthestValuePosition: function (/* number*/ lowValue,
        /* number*/ highValue,
        /* number*/ newValue) /* ?number*/ {
        this._cleanHeaps();
        if (this._smallValues.empty() || this._largeValues.empty()) {
            // Threre are currently no values stored. We will have to create new
            // position for this value.
            return null;
        }

        var minValue = this._smallValues.peek().value;
        var maxValue = this._largeValues.peek().value;
        if (minValue >= lowValue && maxValue <= highValue) {
            // All values currently stored are necessary, we can't reuse any of them.
            return null;
        }

        var valueToReplace;
        if (lowValue - minValue > maxValue - highValue) {
            // minValue is further from provided range. We will reuse it's position.
            valueToReplace = minValue;
            this._smallValues.pop();
        } else {
            valueToReplace = maxValue;
            this._largeValues.pop();
        }
        var position = this._valueToPositionMap[valueToReplace];
        delete this._valueToPositionMap[valueToReplace];
        this._valueToPositionMap[newValue] = position;
        this._pushToHeaps(position, newValue);

        return position;
    },

    _pushToHeaps: function (/* number*/ position, /* number*/ value) {
        var element = {
            position: position,
            value: value
        };
        // We can reuse the same object in both heaps, because we don't mutate them
        this._smallValues.push(element);
        this._largeValues.push(element);
    },

    _cleanHeaps: function () {
        // We not usually only remove object from one heap while moving value.
        // Here we make sure that there is no stale data on top of heaps.
        this._cleanHeap(this._smallValues);
        this._cleanHeap(this._largeValues);
        var minHeapSize =
            Math.min(this._smallValues.size(), this._largeValues.size());
        var maxHeapSize =
            Math.max(this._smallValues.size(), this._largeValues.size());
        if (maxHeapSize > 10 * minHeapSize) {
            // There are many old values in one of heaps. We nned to get rid of them
            // to not use too avoid memory leaks
            this._recreateHeaps();
        }
    },

    _recreateHeaps: function () {
        var sourceHeap = this._smallValues.size() < this._largeValues.size() ?
            this._smallValues :
            this._largeValues;
        var newSmallValues = new Heap(
            [], // Initial data in the heap
            this._smallerComparator
        );
        var newLargeValues = new Heap(
            [], // Initial datat in the heap
            this._greaterComparator
        );
        while (!sourceHeap.empty()) {
            var element = sourceHeap.pop();
            // Push all stil valid elements to new heaps
            if (this._valueToPositionMap[element.value] !== undefined) {
                newSmallValues.push(element);
                newLargeValues.push(element);
            }
        }
        this._smallValues = newSmallValues;
        this._largeValues = newLargeValues;
    },

    _cleanHeap: function (/* object*/ heap) {
        while (!heap.empty() &&
        this._valueToPositionMap[heap.peek().value] === undefined) {
            heap.pop();
        }
    },

    _smallerComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ {
        return lhs.value < rhs.value;
    },

    _greaterComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ {
        return lhs.value > rhs.value;
    }
};

!(function () {
    BI.LinkHashMap = function () {
        this.array = [];
        this.map = {};
    };
    BI.LinkHashMap.prototype = {
        constructor: BI.LinkHashMap,
        has: function (key) {
            if (key in this.map) {
                return true;
            }
            return false;
        },

        add: function (key, value) {
            if (typeof key === "undefined") {
                return;
            }
            if (key in this.map) {
                this.map[key] = value;
            } else {
                this.array.push(key);
                this.map[key] = value;
            }
        },

        remove: function (key) {
            if (key in this.map) {
                delete this.map[key];
                for (var i = 0; i < this.array.length; i++) {
                    if (this.array[i] == key) {
                        this.array.splice(i, 1);
                        break;
                    }
                }
            }
        },

        size: function () {
            return this.array.length;
        },

        each: function (fn, scope) {
            var scope = scope || window;
            var fn = fn || null;
            if (fn == null || typeof (fn) !== "function") {
                return;
            }
            for (var i = 0; i < this.array.length; i++) {
                var key = this.array[i];
                var value = this.map[key];
                var re = fn.call(scope, key, value, i, this.array, this.map);
                if (re == false) {
                    break;
                }
            }
        },

        get: function (key) {
            return this.map[key];
        },

        toArray: function () {
            var array = [];
            this.each(function (key, value) {
                array.push(value);
            });
            return array;
        }
    };
})();_.extend(BI, {
    $import: function () {
        var _LOADED = {}; // alex:保存加载过的
        function loadReady (src, must) {
            var $scripts = $("head script, body script");
            $.each($scripts, function (i, item) {
                if (item.src.indexOf(src) != -1) {
                    _LOADED[src] = true;
                }
            });
            var $links = $("head link");
            $.each($links, function (i, item) {
                if (item.href.indexOf(src) != -1 && must) {
                    _LOADED[src] = false;
                    $(item).remove();
                }
            });
        }

        // must=true 强行加载
        return function (src, ext, must) {
            loadReady(src, must);
            // alex:如果已经加载过了的,直接return
            if (_LOADED[src] === true) {
                return;
            }
            if (ext === "css") {
                var link = document.createElement("link");
                link.rel = "stylesheet";
                link.type = "text/css";
                link.href = src;
                var head = document.getElementsByTagName("head")[0];
                head.appendChild(link);
                _LOADED[src] = true;
            } else {
                // alex:这里用同步调用的方式,必须等待ajax完成
                $.ajax({
                    url: src,
                    dataType: "script", // alex:指定dataType为script,jquery会帮忙做globalEval的事情
                    async: false,
                    cache: true,
                    complete: function (res, status) {
                        /*
                         * alex:发现jquery会很智能地判断一下返回的数据类型是不是script,然后做一个globalEval
                         * 所以当status为success时就不需要再把其中的内容加到script里面去了
                         */
                        if (status == "success") {
                            _LOADED[src] = true;
                        }
                    }
                });
            }
        };
    }()
});
!(function () {
    BI.LRU = function (limit) {
        this.size = 0;
        this.limit = limit;
        this.head = this.tail = undefined;
        this._keymap = {};
    };

    var p = BI.LRU.prototype;

    p.put = function (key, value) {
        var removed;
        if (this.size === this.limit) {
            removed = this.shift();
        }

        var entry = this.get(key, true);
        if (!entry) {
            entry = {
                key: key
            };
            this._keymap[key] = entry;
            if (this.tail) {
                this.tail.newer = entry;
                entry.older = this.tail;
            } else {
                this.head = entry;
            }
            this.tail = entry;
            this.size++;
        }
        entry.value = value;

        return removed;
    };

    p.shift = function () {
        var entry = this.head;
        if (entry) {
            this.head = this.head.newer;
            this.head.older = undefined;
            entry.newer = entry.older = undefined;
            this._keymap[entry.key] = undefined;
            this.size--;
        }
        return entry;
    };


    p.get = function (key, returnEntry) {
        var entry = this._keymap[key];
        if (entry === undefined) return;
        if (entry === this.tail) {
            return returnEntry
                ? entry
                : entry.value;
        }
        // HEAD--------------TAIL
        //   <.older   .newer>
        //  <--- add direction --
        //   A  B  C  <D>  E
        if (entry.newer) {
            if (entry === this.head) {
                this.head = entry.newer;
            }
            entry.newer.older = entry.older; // C <-- E.
        }
        if (entry.older) {
            entry.older.newer = entry.newer; // C. --> E
        }
        entry.newer = undefined; // D --x
        entry.older = this.tail; // D. --> E
        if (this.tail) {
            this.tail.newer = entry; // E. <-- D
        }
        this.tail = entry;
        return returnEntry
            ? entry
            : entry.value;
    };

    p.has = function (key) {
        return this._keymap[key] != null;
    };
})();
!(function () {
    var MD5 = function (hexcase) {
        this.hexcase = !hexcase ? 0 : 1;
        /* hex output format. 0 - lowercase; 1 - uppercase */
        this.b64pad = "";
        /* base-64 pad character. "=" for strict RFC compliance */
        this.chrsz = 8;
        /* bits per input character. 8 - ASCII; 16 - Unicode */
    };

    /*
     * These are the functions you'll usually want to call
     * They take string arguments and return either hex or base-64 encoded strings
     */
    MD5.prototype.hex_md5 = function (s) {
        return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.hex_md5_salt = function (s) {
        var md5ed = this.hex_md5(s);

        var items1 = [];
        var items2 = [];
        for (var i = 0; i < md5ed.length; i++) {
            if (i % 2 === 0) {
                items1.push(md5ed.charAt(i));
            } else {
                items2.push(md5ed.charAt(i));
            }
        }
        var result = ":" + items1.join("") + items2.join("");
        return result;
    };

    MD5.prototype.b64_md5 = function (s) {
        return this.binl2b64(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.hex_hmac_md5 = function (key, data) {
        return this.binl2hex(this.core_hmac_md5(key, data));
    };

    MD5.prototype.b64_hmac_md5 = function (key, data) {
        return this.binl2b64(this.core_hmac_md5(key, data));
    };

    /* Backwards compatibility - same as hex_md5() */
    MD5.prototype.calcMD5 = function (s) {
        return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.core_md5 = function (x, len) {
        /* append padding */
        x[len >> 5] |= 0x80 << ((len) % 32);
        x[(((len + 64) >>> 9) << 4) + 14] = len;

        var a = 1732584193;
        var b = -271733879;
        var c = -1732584194;
        var d = 271733878;

        for (var i = 0; i < x.length; i += 16) {
            var olda = a;
            var oldb = b;
            var oldc = c;
            var oldd = d;

            a = this.md5_ff(a, b, c, d, x[i + 0], 7, -680876936);
            d = this.md5_ff(d, a, b, c, x[i + 1], 12, -389564586);
            c = this.md5_ff(c, d, a, b, x[i + 2], 17, 606105819);
            b = this.md5_ff(b, c, d, a, x[i + 3], 22, -1044525330);
            a = this.md5_ff(a, b, c, d, x[i + 4], 7, -176418897);
            d = this.md5_ff(d, a, b, c, x[i + 5], 12, 1200080426);
            c = this.md5_ff(c, d, a, b, x[i + 6], 17, -1473231341);
            b = this.md5_ff(b, c, d, a, x[i + 7], 22, -45705983);
            a = this.md5_ff(a, b, c, d, x[i + 8], 7, 1770035416);
            d = this.md5_ff(d, a, b, c, x[i + 9], 12, -1958414417);
            c = this.md5_ff(c, d, a, b, x[i + 10], 17, -42063);
            b = this.md5_ff(b, c, d, a, x[i + 11], 22, -1990404162);
            a = this.md5_ff(a, b, c, d, x[i + 12], 7, 1804603682);
            d = this.md5_ff(d, a, b, c, x[i + 13], 12, -40341101);
            c = this.md5_ff(c, d, a, b, x[i + 14], 17, -1502002290);
            b = this.md5_ff(b, c, d, a, x[i + 15], 22, 1236535329);

            a = this.md5_gg(a, b, c, d, x[i + 1], 5, -165796510);
            d = this.md5_gg(d, a, b, c, x[i + 6], 9, -1069501632);
            c = this.md5_gg(c, d, a, b, x[i + 11], 14, 643717713);
            b = this.md5_gg(b, c, d, a, x[i + 0], 20, -373897302);
            a = this.md5_gg(a, b, c, d, x[i + 5], 5, -701558691);
            d = this.md5_gg(d, a, b, c, x[i + 10], 9, 38016083);
            c = this.md5_gg(c, d, a, b, x[i + 15], 14, -660478335);
            b = this.md5_gg(b, c, d, a, x[i + 4], 20, -405537848);
            a = this.md5_gg(a, b, c, d, x[i + 9], 5, 568446438);
            d = this.md5_gg(d, a, b, c, x[i + 14], 9, -1019803690);
            c = this.md5_gg(c, d, a, b, x[i + 3], 14, -187363961);
            b = this.md5_gg(b, c, d, a, x[i + 8], 20, 1163531501);
            a = this.md5_gg(a, b, c, d, x[i + 13], 5, -1444681467);
            d = this.md5_gg(d, a, b, c, x[i + 2], 9, -51403784);
            c = this.md5_gg(c, d, a, b, x[i + 7], 14, 1735328473);
            b = this.md5_gg(b, c, d, a, x[i + 12], 20, -1926607734);

            a = this.md5_hh(a, b, c, d, x[i + 5], 4, -378558);
            d = this.md5_hh(d, a, b, c, x[i + 8], 11, -2022574463);
            c = this.md5_hh(c, d, a, b, x[i + 11], 16, 1839030562);
            b = this.md5_hh(b, c, d, a, x[i + 14], 23, -35309556);
            a = this.md5_hh(a, b, c, d, x[i + 1], 4, -1530992060);
            d = this.md5_hh(d, a, b, c, x[i + 4], 11, 1272893353);
            c = this.md5_hh(c, d, a, b, x[i + 7], 16, -155497632);
            b = this.md5_hh(b, c, d, a, x[i + 10], 23, -1094730640);
            a = this.md5_hh(a, b, c, d, x[i + 13], 4, 681279174);
            d = this.md5_hh(d, a, b, c, x[i + 0], 11, -358537222);
            c = this.md5_hh(c, d, a, b, x[i + 3], 16, -722521979);
            b = this.md5_hh(b, c, d, a, x[i + 6], 23, 76029189);
            a = this.md5_hh(a, b, c, d, x[i + 9], 4, -640364487);
            d = this.md5_hh(d, a, b, c, x[i + 12], 11, -421815835);
            c = this.md5_hh(c, d, a, b, x[i + 15], 16, 530742520);
            b = this.md5_hh(b, c, d, a, x[i + 2], 23, -995338651);

            a = this.md5_ii(a, b, c, d, x[i + 0], 6, -198630844);
            d = this.md5_ii(d, a, b, c, x[i + 7], 10, 1126891415);
            c = this.md5_ii(c, d, a, b, x[i + 14], 15, -1416354905);
            b = this.md5_ii(b, c, d, a, x[i + 5], 21, -57434055);
            a = this.md5_ii(a, b, c, d, x[i + 12], 6, 1700485571);
            d = this.md5_ii(d, a, b, c, x[i + 3], 10, -1894986606);
            c = this.md5_ii(c, d, a, b, x[i + 10], 15, -1051523);
            b = this.md5_ii(b, c, d, a, x[i + 1], 21, -2054922799);
            a = this.md5_ii(a, b, c, d, x[i + 8], 6, 1873313359);
            d = this.md5_ii(d, a, b, c, x[i + 15], 10, -30611744);
            c = this.md5_ii(c, d, a, b, x[i + 6], 15, -1560198380);
            b = this.md5_ii(b, c, d, a, x[i + 13], 21, 1309151649);
            a = this.md5_ii(a, b, c, d, x[i + 4], 6, -145523070);
            d = this.md5_ii(d, a, b, c, x[i + 11], 10, -1120210379);
            c = this.md5_ii(c, d, a, b, x[i + 2], 15, 718787259);
            b = this.md5_ii(b, c, d, a, x[i + 9], 21, -343485551);

            a = this.safe_add(a, olda);
            b = this.safe_add(b, oldb);
            c = this.safe_add(c, oldc);
            d = this.safe_add(d, oldd);
        }
        return Array(a, b, c, d);

    };

    /*
     * These functions implement the four basic operations the algorithm uses.
     */
    MD5.prototype.md5_cmn = function (q, a, b, x, s, t) {
        return this.safe_add(this.bit_rol(this.safe_add(this.safe_add(a, q), this.safe_add(x, t)), s), b);
    };
    MD5.prototype.md5_ff = function (a, b, c, d, x, s, t) {
        return this.md5_cmn((b & c) | ((~b) & d), a, b, x, s, t);
    };
    MD5.prototype.md5_gg = function (a, b, c, d, x, s, t) {
        return this.md5_cmn((b & d) | (c & (~d)), a, b, x, s, t);
    };
    MD5.prototype.md5_hh = function (a, b, c, d, x, s, t) {
        return this.md5_cmn(b ^ c ^ d, a, b, x, s, t);
    };
    MD5.prototype.md5_ii = function (a, b, c, d, x, s, t) {
        return this.md5_cmn(c ^ (b | (~d)), a, b, x, s, t);
    };

    /*
     * Calculate the HMAC-MD5, of a key and some data
     */
    MD5.prototype.core_hmac_md5 = function (key, data) {
        var bkey = this.str2binl(key);
        if (bkey.length > 16) {bkey = this.core_md5(bkey, key.length * this.chrsz);}

        var ipad = Array(16), opad = Array(16);
        for (var i = 0; i < 16; i++) {
            ipad[i] = bkey[i] ^ 0x36363636;
            opad[i] = bkey[i] ^ 0x5C5C5C5C;
        }

        var hash = this.core_md5(ipad.concat(this.str2binl(data)), 512 + data.length * this.chrsz);
        return this.core_md5(opad.concat(hash), 512 + 128);
    };

    /*
     * Add integers, wrapping at 2^32. This uses 16-bit operations internally
     * to work around bugs in some JS interpreters.
     */
    MD5.prototype.safe_add = function (x, y) {
        var lsw = (x & 0xFFFF) + (y & 0xFFFF);
        var msw = (x >> 16) + (y >> 16) + (lsw >> 16);
        return (msw << 16) | (lsw & 0xFFFF);
    };

    /*
     * Bitwise rotate a 32-bit number to the left.
     */
    MD5.prototype.bit_rol = function (num, cnt) {
        return (num << cnt) | (num >>> (32 - cnt));
    };

    /*
     * Convert a string to an array of little-endian words
     * If chrsz is ASCII, characters >255 have their hi-byte silently ignored.
     */
    MD5.prototype.str2binl = function (str) {
        var bin = Array();
        var mask = (1 << this.chrsz) - 1;
        for (var i = 0; i < str.length * this.chrsz; i += this.chrsz) {bin[i >> 5] |= (str.charCodeAt(i / this.chrsz) & mask) << (i % 32);}
        return bin;
    };

    /*
     * Convert an array of little-endian words to a hex string.
     */
    MD5.prototype.binl2hex = function (binarray) {
        var hex_tab = this.hexcase ? "0123456789ABCDEF" : "0123456789abcdef";
        var str = "";
        for (var i = 0; i < binarray.length * 4; i++) {
            str += hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8 + 4)) & 0xF)
                + hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8)) & 0xF);
        }
        return str;
    };

    /*
     * Convert an array of little-endian words to a base-64 string
     */
    MD5.prototype.binl2b64 = function (binarray) {
        var tab = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/";
        var str = "";
        for (var i = 0; i < binarray.length * 4; i += 3) {
            var triplet = (((binarray[i >> 2] >> 8 * (i % 4)) & 0xFF) << 16)
                | (((binarray[i + 1 >> 2] >> 8 * ((i + 1) % 4)) & 0xFF) << 8)
                | ((binarray[i + 2 >> 2] >> 8 * ((i + 2) % 4)) & 0xFF);
            for (var j = 0; j < 4; j++) {
                if (i * 8 + j * 6 > binarray.length * 32) {str += this.b64pad;} else {str += tab.charAt((triplet >> 6 * (3 - j)) & 0x3F);}
            }
        }
        return str;
    };
    BI.MD5 = new MD5();
})();// 线段树
(function () {
    var parent = function (node) {
        return Math.floor(node / 2);
    };

    var Int32Array = window.Int32Array || function (size) {
        var xs = [];
        for (var i = size - 1; i >= 0; --i) {
            xs[i] = 0;
        }
        return xs;
    };

    var ceilLog2 = function (x) {
        var y = 1;
        while (y < x) {
            y *= 2;
        }
        return y;
    };

    BI.PrefixIntervalTree = function (xs) {
        this._size = xs.length;
        this._half = ceilLog2(this._size);
        this._heap = new Int32Array(2 * this._half);

        var i;
        for (i = 0; i < this._size; ++i) {
            this._heap[this._half + i] = xs[i];
        }

        for (i = this._half - 1; i > 0; --i) {
            this._heap[i] = this._heap[2 * i] + this._heap[2 * i + 1];
        }
    };

    BI.PrefixIntervalTree.prototype = {
        constructor: BI.PrefixIntervalTree,
        set: function (index, value) {
            var node = this._half + index;
            this._heap[node] = value;

            node = parent(node);
            for (; node !== 0; node = parent(node)) {
                this._heap[node] =
                    this._heap[2 * node] + this._heap[2 * node + 1];
            }
        },

        get: function (index) {
            var node = this._half + index;
            return this._heap[node];
        },

        getSize: function () {
            return this._size;
        },

        /**
         * get(0) + get(1) + ... + get(end - 1).
         */
        sumUntil: function (end) {
            if (end === 0) {
                return 0;
            }

            var node = this._half + end - 1;
            var sum = this._heap[node];
            for (; node !== 1; node = parent(node)) {
                if (node % 2 === 1) {
                    sum += this._heap[node - 1];
                }
            }

            return sum;
        },

        /**
         * get(0) + get(1) + ... + get(inclusiveEnd).
         */
        sumTo: function (inclusiveEnd) {
            return this.sumUntil(inclusiveEnd + 1);
        },

        /**
         * sum get(begin) + get(begin + 1) + ... + get(end - 1).
         */
        sum: function (begin, end) {
            return this.sumUntil(end) - this.sumUntil(begin);
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and sumUntil(i) <= t, or
         * -1 if no such i exists.
         */
        greatestLowerBound: function (t) {
            if (t < 0) {
                return -1;
            }

            var node = 1;
            if (this._heap[node] <= t) {
                return this._size;
            }

            while (node < this._half) {
                var leftSum = this._heap[2 * node];
                if (t < leftSum) {
                    node = 2 * node;
                } else {
                    node = 2 * node + 1;
                    t -= leftSum;
                }
            }

            return node - this._half;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and sumUntil(i) < t, or
         * -1 if no such i exists.
         */
        greatestStrictLowerBound: function (t) {
            if (t <= 0) {
                return -1;
            }

            var node = 1;
            if (this._heap[node] < t) {
                return this._size;
            }

            while (node < this._half) {
                var leftSum = this._heap[2 * node];
                if (t <= leftSum) {
                    node = 2 * node;
                } else {
                    node = 2 * node + 1;
                    t -= leftSum;
                }
            }

            return node - this._half;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and t <= sumUntil(i), or
         * size + 1 if no such i exists.
         */
        leastUpperBound: function (t) {
            return this.greatestStrictLowerBound(t) + 1;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and t < sumUntil(i), or
         * size + 1 if no such i exists.
         */
        leastStrictUpperBound: function (t) {
            return this.greatestLowerBound(t) + 1;
        }
    };

    BI.PrefixIntervalTree.uniform = function (size, initialValue) {
        var xs = [];
        for (var i = size - 1; i >= 0; --i) {
            xs[i] = initialValue;
        }

        return new BI.PrefixIntervalTree(xs);
    };

    BI.PrefixIntervalTree.empty = function (size) {
        return BI.PrefixIntervalTree.uniform(size, 0);
    };

})();

!(function () {
    BI.Queue = function (capacity) {
        this.capacity = capacity;
        this.array = [];
    };
    BI.Queue.prototype = {
        constructor: BI.Queue,

        contains: function (v) {
            return this.array.contains(v);
        },

        indexOf: function (v) {
            return this.array.contains(v);
        },

        getElementByIndex: function (index) {
            return this.array[index];
        },

        push: function (v) {
            this.array.push(v);
            if (this.capacity && this.array.length > this.capacity) {
                this.array.shift();
            }
        },

        pop: function () {
            this.array.pop();
        },

        shift: function () {
            this.array.shift();
        },

        unshift: function (v) {
            this.array.unshift(v);
            if (this.capacity && this.array.length > this.capacity) {
                this.array.pop();
            }
        },

        remove: function (v) {
            this.array.remove(v);
        },
        
        splice: function () {
            this.array.splice.apply(this.array, arguments);
        },
        
        slice: function () {
            this.array.slice.apply(this.array, arguments);
        },
        
        size: function () {
            return this.array.length;
        },

        each: function (fn, scope) {
            var scope = scope || window;
            var fn = fn || null;
            if (fn == null || typeof (fn) !== "function") {
                return;
            }
            for (var i = 0; i < this.array.length; i++) {
                var re = fn.call(scope, i, this.array[i], this.array);
                if (re == false) {
                    break;
                }
            }
        },

        toArray: function () {
            return this.array;
        },

        fromArray: function (array) {
            var self = this;
            BI.each(array, function (i, v) {
                self.push(v);
            });
        },

        clear: function () {
            this.array.clear();
        }
    };
})();!(function () {
    var Section = function (height, width, x, y) {
        this.height = height;
        this.width = width;
        this.x = x;
        this.y = y;

        this._indexMap = {};
        this._indices = [];
    };

    Section.prototype = {
        constructor: Section,
        addCellIndex: function (index) {
            if (!this._indexMap[index]) {
                this._indexMap[index] = true;
                this._indices.push(index);
            }
        },

        getCellIndices: function () {
            return this._indices;
        }
    };

    var SECTION_SIZE = 100;
    BI.SectionManager = function (sectionSize) {
        this._sectionSize = sectionSize || SECTION_SIZE;
        this._cellMetadata = [];
        this._sections = {};
    };

    BI.SectionManager.prototype = {
        constructor: BI.SectionManager,
        getCellIndices: function (height, width, x, y) {
            var indices = {};

            BI.each(this.getSections(height, width, x, y), function (i, section) {
                BI.each(section.getCellIndices(), function (j, index) {
                    indices[index] = index;
                });
            });

            return BI.map(BI.keys(indices), function (i, index) {
                return indices[index];
            });
        },

        getCellMetadata: function (index) {
            return this._cellMetadata[index];
        },

        getSections: function (height, width, x, y) {
            var sectionXStart = Math.floor(x / this._sectionSize);
            var sectionXStop = Math.floor((x + width - 1) / this._sectionSize);
            var sectionYStart = Math.floor(y / this._sectionSize);
            var sectionYStop = Math.floor((y + height - 1) / this._sectionSize);

            var sections = [];

            for (var sectionX = sectionXStart; sectionX <= sectionXStop; sectionX++) {
                for (var sectionY = sectionYStart; sectionY <= sectionYStop; sectionY++) {
                    var key = sectionX + "." + sectionY;

                    if (!this._sections[key]) {
                        this._sections[key] = new Section(this._sectionSize, this._sectionSize, sectionX * this._sectionSize, sectionY * this._sectionSize);
                    }

                    sections.push(this._sections[key]);
                }
            }

            return sections;
        },

        getTotalSectionCount: function () {
            return BI.size(this._sections);
        },

        registerCell: function (cellMetadatum, index) {
            this._cellMetadata[index] = cellMetadatum;

            BI.each(this.getSections(cellMetadatum.height, cellMetadatum.width, cellMetadatum.x, cellMetadatum.y), function (i, section) {
                section.addCellIndex(index);
            });
        }
    };
})();
(function () {
    var clamp = function (value, min, max) {
        if (value < min) {
            return min;
        }
        if (value > max) {
            return max;
        }
        return value;
    };
    var MIN_BUFFER_ROWS = 6;
    var MAX_BUFFER_ROWS = 10;

    BI.TableRowBuffer = function (rowsCount,
        defaultRowHeight,
        viewportHeight,
        rowHeightGetter) {
        this._bufferSet = new BI.IntegerBufferSet();
        this._defaultRowHeight = defaultRowHeight;
        this._viewportRowsBegin = 0;
        this._viewportRowsEnd = 0;
        this._maxVisibleRowCount = Math.ceil(viewportHeight / defaultRowHeight) + 1;
        // this._bufferRowsCount = Math.floor(this._maxVisibleRowCount / 2);
        this._bufferRowsCount = clamp(
            Math.floor(this._maxVisibleRowCount / 2),
            MIN_BUFFER_ROWS,
            MAX_BUFFER_ROWS
        );
        this._rowsCount = rowsCount;
        this._rowHeightGetter = rowHeightGetter;
        this._rows = [];
        this._viewportHeight = viewportHeight;

    };
    BI.TableRowBuffer.prototype = {
        constructor: BI.TableRowBuffer,

        getRowsWithUpdatedBuffer: function () {
            var remainingBufferRows = 2 * this._bufferRowsCount;
            var bufferRowIndex =
                Math.max(this._viewportRowsBegin - this._bufferRowsCount, 0);
            while (bufferRowIndex < this._viewportRowsBegin) {
                this._addRowToBuffer(
                    bufferRowIndex,
                    this._viewportRowsBegin,
                    this._viewportRowsEnd - 1
                );
                bufferRowIndex++;
                remainingBufferRows--;
            }
            bufferRowIndex = this._viewportRowsEnd;
            while (bufferRowIndex < this._rowsCount && remainingBufferRows > 0) {
                this._addRowToBuffer(
                    bufferRowIndex,
                    this._viewportRowsBegin,
                    this._viewportRowsEnd - 1
                );
                bufferRowIndex++;
                remainingBufferRows--;
            }
            return this._rows;
        },

        getRows: function (firstRowIndex,
            firstRowOffset) {
            var top = firstRowOffset;
            var totalHeight = top;
            var rowIndex = firstRowIndex;
            var endIndex =
                Math.min(firstRowIndex + this._maxVisibleRowCount, this._rowsCount);

            this._viewportRowsBegin = firstRowIndex;
            while (rowIndex < endIndex ||
            (totalHeight < this._viewportHeight && rowIndex < this._rowsCount)) {
                this._addRowToBuffer(
                    rowIndex,
                    firstRowIndex,
                    endIndex - 1
                );
                totalHeight += this._rowHeightGetter(rowIndex);
                ++rowIndex;
                // Store index after the last viewport row as end, to be able to
                // distinguish when there are no rows rendered in viewport
                this._viewportRowsEnd = rowIndex;
            }

            return this._rows;
        },

        _addRowToBuffer: function (rowIndex,
            firstViewportRowIndex,
            lastViewportRowIndex) {
            var rowPosition = this._bufferSet.getValuePosition(rowIndex);
            var viewportRowsCount = lastViewportRowIndex - firstViewportRowIndex + 1;
            var allowedRowsCount = viewportRowsCount + this._bufferRowsCount * 2;
            if (rowPosition === null &&
                this._bufferSet.getSize() >= allowedRowsCount) {
                rowPosition =
                    this._bufferSet.replaceFurthestValuePosition(
                        firstViewportRowIndex,
                        lastViewportRowIndex,
                        rowIndex
                    );
            }
            if (rowPosition === null) {
                // We can't reuse any of existing positions for this row. We have to
                // create new position
                rowPosition = this._bufferSet.getNewPositionForValue(rowIndex);
                this._rows[rowPosition] = rowIndex;
            } else {
                // This row already is in the table with rowPosition position or it
                // can replace row that is in that position
                this._rows[rowPosition] = rowIndex;
            }
        }
    };

})();

(function () {
    BI.Tree = function () {
        this.root = new BI.Node(BI.UUID());
    };

    BI.Tree.prototype = {
        constructor: BI.Tree,
        addNode: function (node, newNode, index) {
            if (BI.isNull(newNode)) {
                this.root.addChild(node, index);
            } else if (BI.isNull(node)) {
                this.root.addChild(newNode, index);
            } else {
                node.addChild(newNode, index);
            }
        },

        isRoot: function (node) {
            return node === this.root;
        },

        getRoot: function () {
            return this.root;
        },

        clear: function () {
            this.root.clear();
        },

        initTree: function (nodes) {
            var self = this;
            this.clear();
            var queue = [];
            BI.each(nodes, function (i, node) {
                var n = new BI.Node(node);
                n.set("data", node);
                self.addNode(n);
                queue.push(n);
            });
            while (!BI.isEmpty(queue)) {
                var parent = queue.shift();
                var node = parent.get("data");
                BI.each(node.children, function (i, child) {
                    var n = new BI.Node(child);
                    n.set("data", child);
                    queue.push(n);
                    self.addNode(parent, n);
                });
            }
        },

        _toJSON: function (node) {
            var self = this;
            var children = [];
            BI.each(node.getChildren(), function (i, child) {
                children.push(self._toJSON(child));
            });
            return BI.extend({
                id: node.id
            }, BI.deepClone(node.get("data")), (children.length > 0 ? {
                    children: children
                } : {}));
        },

        toJSON: function (node) {
            var self = this, result = [];
            BI.each((node || this.root).getChildren(), function (i, child) {
                result.push(self._toJSON(child));
            });
            return result;
        },

        _toJSONWithNode: function (node) {
            var self = this;
            var children = [];
            BI.each(node.getChildren(), function (i, child) {
                children.push(self._toJSONWithNode(child));
            });
            return BI.extend({
                id: node.id
            }, BI.deepClone(node.get("data")), {
                node: node
            }, (children.length > 0 ? {
                    children: children
                } : {}));
        },

        toJSONWithNode: function (node) {
            var self = this, result = [];
            BI.each((node || this.root).getChildren(), function (i, child) {
                result.push(self._toJSONWithNode(child));
            });
            return result;
        },

        search: function (root, target, param) {
            if (!(root instanceof BI.Node)) {
                return arguments.callee.apply(this, [this.root, root, target]);
            }
            var self = this, next = null;

            if (BI.isNull(target)) {
                return null;
            }
            if (BI.isEqual(root[param || "id"], target)) {
                return root;
            }
            BI.any(root.getChildren(), function (i, child) {
                next = self.search(child, target, param);
                if (null !== next) {
                    return true;
                }
            });
            return next;
        },

        _traverse: function (node, callback) {
            var queue = [];
            queue.push(node);
            while (!BI.isEmpty(queue)) {
                var temp = queue.shift();
                var b = callback && callback(temp);
                if (b === false) {
                    break;
                }
                if (b === true) {
                    continue;
                }
                if (temp != null) {
                    queue = queue.concat(temp.getChildren());
                }
            }
        },

        traverse: function (callback) {
            this._traverse(this.root, callback);
        },

        _recursion: function (node, route, callback) {
            var self = this;
            return BI.every(node.getChildren(), function (i, child) {
                var next = BI.clone(route);
                next.push(child.id);
                var b = callback && callback(child, next);
                if (b === false) {
                    return false;
                }
                if (b === true) {
                    return true;
                }
                return self._recursion(child, next, callback);
            });
        },

        recursion: function (callback) {
            this._recursion(this.root, [], callback);
        },

        inOrderTraverse: function (callback) {
            this._inOrderTraverse(this.root, callback);
        },

        // 中序遍历(递归)
        _inOrderTraverse: function (node, callback) {
            if (node != null) {
                this._inOrderTraverse(node.getLeft());
                callback && callback(node);
                this._inOrderTraverse(node.getRight());
            }
        },

        // 中序遍历(非递归)
        nrInOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;
            while (node != null || !BI.isEmpty(stack)) {
                while (node != null) {
                    stack.push(node);
                    node = node.getLeft();
                }
                node = stack.pop();
                callback && callback(node);
                node = node.getRight();
            }
        },

        preOrderTraverse: function (callback) {
            this._preOrderTraverse(this.root, callback);
        },

        // 先序遍历(递归)
        _preOrderTraverse: function (node, callback) {
            if (node != null) {
                callback && callback(node);
                this._preOrderTraverse(node.getLeft());
                this._preOrderTraverse(node.getRight());
            }
        },

        // 先序遍历(非递归)
        nrPreOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;

            while (node != null || !BI.isEmpty(stack)) {

                while (node != null) {
                    callback && callback(node);
                    stack.push(node);
                    node = node.getLeft();
                }
                node = stack.pop();
                node = node.getRight();
            }
        },

        postOrderTraverse: function (callback) {
            this._postOrderTraverse(this.root, callback);
        },

        // 后序遍历(递归)
        _postOrderTraverse: function (node, callback) {
            if (node != null) {
                this._postOrderTraverse(node.getLeft());
                this._postOrderTraverse(node.getRight());
                callback && callback(node);
            }
        },

        // 后续遍历(非递归)
        nrPostOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;
            var preNode = null;// 表示最近一次访问的节点

            while (node != null || !BI.isEmpty(stack)) {

                while (node != null) {
                    stack.push(node);
                    node = node.getLeft();
                }

                node = BI.last(stack);

                if (node.getRight() == null || node.getRight() == preNode) {
                    callback && callback(node);
                    node = stack.pop();
                    preNode = node;
                    node = null;
                } else {
                    node = node.getRight();
                }
            }
        }
    };

    BI.Node = function (id) {
        if (BI.isObject(id)) {
            BI.extend(this, id);
        } else {
            this.id = id;
        }
        this.clear.apply(this, arguments);
    };

    BI.Node.prototype = {
        constructor: BI.Node,

        set: function (key, value) {
            if (BI.isObject(key)) {
                BI.extend(this, key);
                return;
            }
            this[key] = value;
        },

        get: function (key) {
            return this[key];
        },

        isLeaf: function () {
            return BI.isEmpty(this.children);
        },

        getChildren: function () {
            return this.children;
        },

        getChildrenLength: function () {
            return this.children.length;
        },

        getFirstChild: function () {
            return BI.first(this.children);
        },

        getLastChild: function () {
            return BI.last(this.children);
        },

        setLeft: function (left) {
            this.left = left;
        },

        getLeft: function () {
            return this.left;
        },

        setRight: function (right) {
            this.right = right;
        },

        getRight: function () {
            return this.right;
        },

        setParent: function (parent) {
            this.parent = parent;
        },

        getParent: function () {
            return this.parent;
        },

        getChild: function (index) {
            return this.children[index];
        },

        getChildIndex: function (id) {
            return BI.findIndex(this.children, function (i, ch) {
                return ch.get("id") === id;
            });
        },

        removeChild: function (id) {
            this.removeChildByIndex(this.getChildIndex(id));
        },

        removeChildByIndex: function (index) {
            var before = this.getChild(index - 1);
            var behind = this.getChild(index + 1);
            if (before != null) {
                before.setRight(behind || null);
            }
            if (behind != null) {
                behind.setLeft(before || null);
            }
            this.children.splice(index, 1);
        },

        removeAllChilds: function () {
            this.children = [];
        },

        addChild: function (child, index) {
            var cur = null;
            if (BI.isUndefined(index)) {
                cur = this.children.length - 1;
            } else {
                cur = index - 1;
            }
            child.setParent(this);
            if (cur >= 0) {
                this.getChild(cur) && this.getChild(cur).setRight(child);
                child.setLeft(this.getChild(cur));
            }
            if (BI.isUndefined(index)) {
                this.children.push(child);
            } else {
                this.children.splice(index, 0, child);
            }
        },

        equals: function (obj) {
            return this === obj || this.id === obj.id;
        },

        clear: function () {
            this.parent = null;
            this.left = null;
            this.right = null;
            this.children = [];
        }
    };

    BI.extend(BI.Tree, {
        transformToArrayFormat: function (nodes, pId) {
            if (!nodes) return [];
            var r = [];
            if (BI.isArray(nodes)) {
                for (var i = 0, l = nodes.length; i < l; i++) {
                    var node = BI.clone(nodes[i]);
                    node.pId = node.pId == null ? pId : node.pId;
                    delete node.children;
                    r.push(node);
                    if (nodes[i]["children"]) {
                        r = r.concat(BI.Tree.transformToArrayFormat(nodes[i]["children"], node.id));
                    }
                }
            } else {
                var newNodes = BI.clone(nodes);
                newNodes.pId = newNodes.pId == null ? pId : newNodes.pId;
                delete newNodes.children;
                r.push(newNodes);
                if (nodes["children"]) {
                    r = r.concat(BI.Tree.transformToArrayFormat(nodes["children"], newNodes.id));
                }
            }
            return r;
        },

        arrayFormat: function (nodes, pId) {
            if (!nodes) {
                return [];
            }
            var r = [];
            if (BI.isArray(nodes)) {
                for (var i = 0, l = nodes.length; i < l; i++) {
                    var node = nodes[i];
                    node.pId = node.pId == null ? pId : node.pId;
                    r.push(node);
                    if (nodes[i]["children"]) {
                        r = r.concat(BI.Tree.arrayFormat(nodes[i]["children"], node.id));
                    }
                }
            } else {
                var newNodes = nodes;
                newNodes.pId = newNodes.pId == null ? pId : newNodes.pId;
                r.push(newNodes);
                if (nodes["children"]) {
                    r = r.concat(BI.Tree.arrayFormat(nodes["children"], newNodes.id));
                }
            }
            return r;
        },

        transformToTreeFormat: function (sNodes) {
            var i, l;
            if (!sNodes) {
                return [];
            }

            if (BI.isArray(sNodes)) {
                var r = [];
                var tmpMap = [];
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (BI.isNull(sNodes[i].id)) {
                        return sNodes;
                    }
                    tmpMap[sNodes[i].id] = BI.clone(sNodes[i]);
                }
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) {
                        if (!tmpMap[sNodes[i].pId].children) {
                            tmpMap[sNodes[i].pId].children = [];
                        }
                        tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]);
                    } else {
                        r.push(tmpMap[sNodes[i].id]);
                    }
                    delete tmpMap[sNodes[i].id].pId;
                }
                return r;
            }
            return [sNodes];
            
        },

        treeFormat: function (sNodes) {
            var i, l;
            if (!sNodes) {
                return [];
            }

            if (BI.isArray(sNodes)) {
                var r = [];
                var tmpMap = [];
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (BI.isNull(sNodes[i].id)) {
                        return sNodes;
                    }
                    tmpMap[sNodes[i].id] = sNodes[i];
                }
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) {
                        if (!tmpMap[sNodes[i].pId].children) {
                            tmpMap[sNodes[i].pId].children = [];
                        }
                        tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]);
                    } else {
                        r.push(tmpMap[sNodes[i].id]);
                    }
                }
                return r;
            }
            return [sNodes];
            
        },

        traversal: function (array, callback) {
            if (BI.isNull(array)) {
                return;
            }
            var self = this;
            BI.any(array, function (i, item) {
                if (callback(i, item) === false) {
                    return true;
                }
                self.traversal(item.children, callback);
            });
        }
    });
})();// 向量操作
BI.Vector = function (x, y) {
    this.x = x;
    this.y = y;
};
BI.Vector.prototype = {
    constructor: BI.Vector,
    cross: function (v) {
        return (this.x * v.y - this.y * v.x);
    },
    length: function (v) {
        return (Math.sqrt(this.x * v.x + this.y * v.y));
    }
};
BI.Region = function (x, y, w, h) {
    this.x = x;
    this.y = y;
    this.w = w;
    this.h = h;
};
BI.Region.prototype = {
    constructor: BI.Region,
    // 判断两个区域是否相交,若相交,则要么顶点互相包含,要么矩形边界(或对角线)相交
    isIntersects: function (obj) {
        if (this.isPointInside(obj.x, obj.y) ||
            this.isPointInside(obj.x + obj.w, obj.y) ||
            this.isPointInside(obj.x, obj.y + obj.h) ||
            this.isPointInside(obj.x + obj.w, obj.y + obj.h)) {
            return true;
        } else if (obj.isPointInside(this.x, this.y) ||
            obj.isPointInside(this.x + this.w, this.y) ||
            obj.isPointInside(this.x, this.y + this.h) ||
            obj.isPointInside(this.x + this.w, this.y + this.h)) {
            return true;
        } else if (obj.x != null && obj.y != null)// 判断矩形对角线相交 |v1 X v2||v1 X v3| < 0
        {
            var vector1 = new BI.Vector(this.w, this.h);// 矩形对角线向量
            var vector2 = new BI.Vector(obj.x - this.x, obj.y - this.y);
            var vector3 = new BI.Vector(vector2.x + obj.w, vector2.y + obj.h);
            if ((vector1.cross(vector2) * vector1.cross(vector3)) < 0) {
                return true;
            }
        }
        return false;
    },
    // 判断一个点是否在这个区域内部
    isPointInside: function (x, y) {
        if (this.x == null || this.y == null) {
            return false;
        }
        if (x >= this.x && x <= this.x + this.w && y >= this.y && y <= this.y + this.h) {
            return true;
        }
        return false;
    },
    // 返回区域的重心,因为是矩形所以返回中点
    getPosition: function () {
        var pos = [];
        pos.push(this.x + this.w / 2);
        pos.push(this.y + this.h / 2);
        return pos;
    }
};/**
 * 缓冲池
 * @type {{Buffer: {}}}
 */

(function () {
    var Buffer = {};
    var MODE = false;// 设置缓存模式为关闭

    BI.BufferPool = {
        put: function (name, cache) {
            if (BI.isNotNull(Buffer[name])) {
                throw new Error("Buffer Pool has the key already!");
            }
            Buffer[name] = cache;
        },

        get: function (name) {
            return Buffer[name];
        }
    };
})();/**
 * 共享池
 * @type {{Shared: {}}}
 */

(function () {
    var _Shared = {};
    BI.SharingPool = {
        _Shared: _Shared,
        put: function (name, shared) {
            _Shared[name] = shared;
        },

        cat: function () {
            var args = Array.prototype.slice.call(arguments, 0),
                copy = _Shared;
            for (var i = 0; i < args.length; i++) {
                copy = copy && copy[args[i]];
            }
            return copy;
        },

        get: function () {
            return BI.deepClone(this.cat.apply(this, arguments));
        },

        remove: function (key) {
            delete _Shared[key];
        }
    };
})();BI.Req = {

};