/*!
 * jQuery JavaScript Library v1.9.1
 * http://jquery.com/
 *
 * Includes Sizzle.js
 * http://sizzlejs.com/
 *
 * Copyright 2005, 2012 jQuery Foundation, Inc. and other contributors
 * Released under the MIT license
 * http://jquery.org/license
 *
 * Date: 2013-2-4
 */
(function( window, undefined ) {

// Can't do this because several apps including ASP.NET trace
// the stack via arguments.caller.callee and Firefox dies if
// you try to trace through "use strict" call chains. (#13335)
// Support: Firefox 18+
//"use strict";
var
	// The deferred used on DOM ready
	readyList,

	// A central reference to the root jQuery(document)
	rootjQuery,

	// Support: IE<9
	// For `typeof node.method` instead of `node.method !== undefined`
	core_strundefined = typeof undefined,

	// Use the correct document accordingly with window argument (sandbox)
	document = window.document,
	location = window.location,

	// Map over jQuery in case of overwrite
	_jQuery = window.jQuery,

	// Map over the $ in case of overwrite
	_$ = window.$,

	// [[Class]] -> type pairs
	class2type = {},

	// List of deleted data cache ids, so we can reuse them
	core_deletedIds = [],

	core_version = "1.9.1",

	// Save a reference to some core methods
	core_concat = core_deletedIds.concat,
	core_push = core_deletedIds.push,
	core_slice = core_deletedIds.slice,
	core_indexOf = core_deletedIds.indexOf,
	core_toString = class2type.toString,
	core_hasOwn = class2type.hasOwnProperty,
	core_trim = core_version.trim,

	// Define a local copy of jQuery
	jQuery = function( selector, context ) {
		// The jQuery object is actually just the init constructor 'enhanced'
		return new jQuery.fn.init( selector, context, rootjQuery );
	},

	// Used for matching numbers
	core_pnum = /[+-]?(?:\d*\.|)\d+(?:[eE][+-]?\d+|)/.source,

	// Used for splitting on whitespace
	core_rnotwhite = /\S+/g,

	// Make sure we trim BOM and NBSP (here's looking at you, Safari 5.0 and IE)
	rtrim = /^[\s\uFEFF\xA0]+|[\s\uFEFF\xA0]+$/g,

	// A simple way to check for HTML strings
	// Prioritize #id over <tag> to avoid XSS via location.hash (#9521)
	// Strict HTML recognition (#11290: must start with <)
	rquickExpr = /^(?:(<[\w\W]+>)[^>]*|#([\w-]*))$/,

	// Match a standalone tag
	rsingleTag = /^<(\w+)\s*\/?>(?:<\/\1>|)$/,

	// JSON RegExp
	rvalidchars = /^[\],:{}\s]*$/,
	rvalidbraces = /(?:^|:|,)(?:\s*\[)+/g,
	rvalidescape = /\\(?:["\\\/bfnrt]|u[\da-fA-F]{4})/g,
	rvalidtokens = /"[^"\\\r\n]*"|true|false|null|-?(?:\d+\.|)\d+(?:[eE][+-]?\d+|)/g,

	// Matches dashed string for camelizing
	rmsPrefix = /^-ms-/,
	rdashAlpha = /-([\da-z])/gi,

	// Used by jQuery.camelCase as callback to replace()
	fcamelCase = function( all, letter ) {
		return letter.toUpperCase();
	},

	// The ready event handler
	completed = function( event ) {

		// readyState === "complete" is good enough for us to call the dom ready in oldIE
		if ( document.addEventListener || event.type === "load" || document.readyState === "complete" ) {
			detach();
			jQuery.ready();
		}
	},
	// Clean-up method for dom ready events
	detach = function() {
		if ( document.addEventListener ) {
			document.removeEventListener( "DOMContentLoaded", completed, false );
			window.removeEventListener( "load", completed, false );

		} else {
			document.detachEvent( "onreadystatechange", completed );
			window.detachEvent( "onload", completed );
		}
	};

jQuery.fn = jQuery.prototype = {
	// The current version of jQuery being used
	jquery: core_version,

	constructor: jQuery,
	init: function( selector, context, rootjQuery ) {
		var match, elem;

		// HANDLE: $(""), $(null), $(undefined), $(false)
		if ( !selector ) {
			return this;
		}

		// Handle HTML strings
		if ( typeof selector === "string" ) {
			if ( selector.charAt(0) === "<" && selector.charAt( selector.length - 1 ) === ">" && selector.length >= 3 ) {
				// Assume that strings that start and end with <> are HTML and skip the regex check
				match = [ null, selector, null ];

			} else {
				match = rquickExpr.exec( selector );
			}

			// Match html or make sure no context is specified for #id
			if ( match && (match[1] || !context) ) {

				// HANDLE: $(html) -> $(array)
				if ( match[1] ) {
					context = context instanceof jQuery ? context[0] : context;

					// scripts is true for back-compat
					jQuery.merge( this, jQuery.parseHTML(
						match[1],
						context && context.nodeType ? context.ownerDocument || context : document,
						true
					) );

					// HANDLE: $(html, props)
					if ( rsingleTag.test( match[1] ) && jQuery.isPlainObject( context ) ) {
						for ( match in context ) {
							// Properties of context are called as methods if possible
							if ( jQuery.isFunction( this[ match ] ) ) {
								this[ match ]( context[ match ] );

							// ...and otherwise set as attributes
							} else {
								this.attr( match, context[ match ] );
							}
						}
					}

					return this;

				// HANDLE: $(#id)
				} else {
					elem = document.getElementById( match[2] );

					// Check parentNode to catch when Blackberry 4.6 returns
					// nodes that are no longer in the document #6963
					if ( elem && elem.parentNode ) {
						// Handle the case where IE and Opera return items
						// by name instead of ID
						if ( elem.id !== match[2] ) {
							return rootjQuery.find( selector );
						}

						// Otherwise, we inject the element directly into the jQuery object
						this.length = 1;
						this[0] = elem;
					}

					this.context = document;
					this.selector = selector;
					return this;
				}

			// HANDLE: $(expr, $(...))
			} else if ( !context || context.jquery ) {
				return ( context || rootjQuery ).find( selector );

			// HANDLE: $(expr, context)
			// (which is just equivalent to: $(context).find(expr)
			} else {
				return this.constructor( context ).find( selector );
			}

		// HANDLE: $(DOMElement)
		} else if ( selector.nodeType ) {
			this.context = this[0] = selector;
			this.length = 1;
			return this;

		// HANDLE: $(function)
		// Shortcut for document ready
		} else if ( jQuery.isFunction( selector ) ) {
			return rootjQuery.ready( selector );
		}

		if ( selector.selector !== undefined ) {
			this.selector = selector.selector;
			this.context = selector.context;
		}

		return jQuery.makeArray( selector, this );
	},

	// Start with an empty selector
	selector: "",

	// The default length of a jQuery object is 0
	length: 0,

	// The number of elements contained in the matched element set
	size: function() {
		return this.length;
	},

	toArray: function() {
		return core_slice.call( this );
	},

	// Get the Nth element in the matched element set OR
	// Get the whole matched element set as a clean array
	get: function( num ) {
		return num == null ?

			// Return a 'clean' array
			this.toArray() :

			// Return just the object
			( num < 0 ? this[ this.length + num ] : this[ num ] );
	},

	// Take an array of elements and push it onto the stack
	// (returning the new matched element set)
	pushStack: function( elems ) {

		// Build a new jQuery matched element set
		var ret = jQuery.merge( this.constructor(), elems );

		// Add the old object onto the stack (as a reference)
		ret.prevObject = this;
		ret.context = this.context;

		// Return the newly-formed element set
		return ret;
	},

	// Execute a callback for every element in the matched set.
	// (You can seed the arguments with an array of args, but this is
	// only used internally.)
	each: function( callback, args ) {
		return jQuery.each( this, callback, args );
	},

	ready: function( fn ) {
		// Add the callback
		jQuery.ready.promise().done( fn );

		return this;
	},

	slice: function() {
		return this.pushStack( core_slice.apply( this, arguments ) );
	},

	first: function() {
		return this.eq( 0 );
	},

	last: function() {
		return this.eq( -1 );
	},

	eq: function( i ) {
		var len = this.length,
			j = +i + ( i < 0 ? len : 0 );
		return this.pushStack( j >= 0 && j < len ? [ this[j] ] : [] );
	},

	map: function( callback ) {
		return this.pushStack( jQuery.map(this, function( elem, i ) {
			return callback.call( elem, i, elem );
		}));
	},

	end: function() {
		return this.prevObject || this.constructor(null);
	},

	// For internal use only.
	// Behaves like an Array's method, not like a jQuery method.
	push: core_push,
	sort: [].sort,
	splice: [].splice
};

// Give the init function the jQuery prototype for later instantiation
jQuery.fn.init.prototype = jQuery.fn;

jQuery.extend = jQuery.fn.extend = function() {
	var src, copyIsArray, copy, name, options, clone,
		target = arguments[0] || {},
		i = 1,
		length = arguments.length,
		deep = false;

	// Handle a deep copy situation
	if ( typeof target === "boolean" ) {
		deep = target;
		target = arguments[1] || {};
		// skip the boolean and the target
		i = 2;
	}

	// Handle case when target is a string or something (possible in deep copy)
	if ( typeof target !== "object" && !jQuery.isFunction(target) ) {
		target = {};
	}

	// extend jQuery itself if only one argument is passed
	if ( length === i ) {
		target = this;
		--i;
	}

	for ( ; i < length; i++ ) {
		// Only deal with non-null/undefined values
		if ( (options = arguments[ i ]) != null ) {
			// Extend the base object
			for ( name in options ) {
				src = target[ name ];
				copy = options[ name ];

				// Prevent never-ending loop
				if ( target === copy ) {
					continue;
				}

				// Recurse if we're merging plain objects or arrays
				if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) {
					if ( copyIsArray ) {
						copyIsArray = false;
						clone = src && jQuery.isArray(src) ? src : [];

					} else {
						clone = src && jQuery.isPlainObject(src) ? src : {};
					}

					// Never move original objects, clone them
					target[ name ] = jQuery.extend( deep, clone, copy );

				// Don't bring in undefined values
				} else if ( copy !== undefined ) {
					target[ name ] = copy;
				}
			}
		}
	}

	// Return the modified object
	return target;
};

jQuery.extend({
	noConflict: function( deep ) {
		if ( window.$ === jQuery ) {
			window.$ = _$;
		}

		if ( deep && window.jQuery === jQuery ) {
			window.jQuery = _jQuery;
		}

		return jQuery;
	},

	// Is the DOM ready to be used? Set to true once it occurs.
	isReady: false,

	// A counter to track how many items to wait for before
	// the ready event fires. See #6781
	readyWait: 1,

	// Hold (or release) the ready event
	holdReady: function( hold ) {
		if ( hold ) {
			jQuery.readyWait++;
		} else {
			jQuery.ready( true );
		}
	},

	// Handle when the DOM is ready
	ready: function( wait ) {

		// Abort if there are pending holds or we're already ready
		if ( wait === true ? --jQuery.readyWait : jQuery.isReady ) {
			return;
		}

		// Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443).
		if ( !document.body ) {
			return setTimeout( jQuery.ready );
		}

		// Remember that the DOM is ready
		jQuery.isReady = true;

		// If a normal DOM Ready event fired, decrement, and wait if need be
		if ( wait !== true && --jQuery.readyWait > 0 ) {
			return;
		}

		// If there are functions bound, to execute
		readyList.resolveWith( document, [ jQuery ] );

		// Trigger any bound ready events
		if ( jQuery.fn.trigger ) {
			jQuery( document ).trigger("ready").off("ready");
		}
	},

	// See test/unit/core.js for details concerning isFunction.
	// Since version 1.3, DOM methods and functions like alert
	// aren't supported. They return false on IE (#2968).
	isFunction: function( obj ) {
		return jQuery.type(obj) === "function";
	},

	isArray: Array.isArray || function( obj ) {
		return jQuery.type(obj) === "array";
	},

	isWindow: function( obj ) {
		return obj != null && obj == obj.window;
	},

	isNumeric: function( obj ) {
		return !isNaN( parseFloat(obj) ) && isFinite( obj );
	},

	type: function( obj ) {
		if ( obj == null ) {
			return String( obj );
		}
		return typeof obj === "object" || typeof obj === "function" ?
			class2type[ core_toString.call(obj) ] || "object" :
			typeof obj;
	},

	isPlainObject: function( obj ) {
		// Must be an Object.
		// Because of IE, we also have to check the presence of the constructor property.
		// Make sure that DOM nodes and window objects don't pass through, as well
		if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) {
			return false;
		}

		try {
			// Not own constructor property must be Object
			if ( obj.constructor &&
				!core_hasOwn.call(obj, "constructor") &&
				!core_hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) {
				return false;
			}
		} catch ( e ) {
			// IE8,9 Will throw exceptions on certain host objects #9897
			return false;
		}

		// Own properties are enumerated firstly, so to speed up,
		// if last one is own, then all properties are own.

		var key;
		for ( key in obj ) {}

		return key === undefined || core_hasOwn.call( obj, key );
	},

	isEmptyObject: function( obj ) {
		var name;
		for ( name in obj ) {
			return false;
		}
		return true;
	},

	error: function( msg ) {
		throw new Error( msg );
	},

	// data: string of html
	// context (optional): If specified, the fragment will be created in this context, defaults to document
	// keepScripts (optional): If true, will include scripts passed in the html string
	parseHTML: function( data, context, keepScripts ) {
		if ( !data || typeof data !== "string" ) {
			return null;
		}
		if ( typeof context === "boolean" ) {
			keepScripts = context;
			context = false;
		}
		context = context || document;

		var parsed = rsingleTag.exec( data ),
			scripts = !keepScripts && [];

		// Single tag
		if ( parsed ) {
			return [ context.createElement( parsed[1] ) ];
		}

		parsed = jQuery.buildFragment( [ data ], context, scripts );
		if ( scripts ) {
			jQuery( scripts ).remove();
		}
		return jQuery.merge( [], parsed.childNodes );
	},

	parseJSON: function( data ) {
		// Attempt to parse using the native JSON parser first
		if ( window.JSON && window.JSON.parse ) {
			return window.JSON.parse( data );
		}

		if ( data === null ) {
			return data;
		}

		if ( typeof data === "string" ) {

			// Make sure leading/trailing whitespace is removed (IE can't handle it)
			data = jQuery.trim( data );

			if ( data ) {
				// Make sure the incoming data is actual JSON
				// Logic borrowed from http://json.org/json2.js
				if ( rvalidchars.test( data.replace( rvalidescape, "@" )
					.replace( rvalidtokens, "]" )
					.replace( rvalidbraces, "")) ) {

					return ( new Function( "return " + data ) )();
				}
			}
		}

		jQuery.error( "Invalid JSON: " + data );
	},

	// Cross-browser xml parsing
	parseXML: function( data ) {
		var xml, tmp;
		if ( !data || typeof data !== "string" ) {
			return null;
		}
		try {
			if ( window.DOMParser ) { // Standard
				tmp = new DOMParser();
				xml = tmp.parseFromString( data , "text/xml" );
			} else { // IE
				xml = new ActiveXObject( "Microsoft.XMLDOM" );
				xml.async = "false";
				xml.loadXML( data );
			}
		} catch( e ) {
			xml = undefined;
		}
		if ( !xml || !xml.documentElement || xml.getElementsByTagName( "parsererror" ).length ) {
			jQuery.error( "Invalid XML: " + data );
		}
		return xml;
	},

	noop: function() {},

	// Evaluates a script in a global context
	// Workarounds based on findings by Jim Driscoll
	// http://weblogs.java.net/blog/driscoll/archive/2009/09/08/eval-javascript-global-context
	globalEval: function( data ) {
		if ( data && jQuery.trim( data ) ) {
			// We use execScript on Internet Explorer
			// We use an anonymous function so that context is window
			// rather than jQuery in Firefox
			( window.execScript || function( data ) {
				window[ "eval" ].call( window, data );
			} )( data );
		}
	},

	// Convert dashed to camelCase; used by the css and data modules
	// Microsoft forgot to hump their vendor prefix (#9572)
	camelCase: function( string ) {
		return string.replace( rmsPrefix, "ms-" ).replace( rdashAlpha, fcamelCase );
	},

	nodeName: function( elem, name ) {
		return elem.nodeName && elem.nodeName.toLowerCase() === name.toLowerCase();
	},

	// args is for internal usage only
	each: function( obj, callback, args ) {
		var value,
			i = 0,
			length = obj.length,
			isArray = isArraylike( obj );

		if ( args ) {
			if ( isArray ) {
				for ( ; i < length; i++ ) {
					value = callback.apply( obj[ i ], args );

					if ( value === false ) {
						break;
					}
				}
			} else {
				for ( i in obj ) {
					value = callback.apply( obj[ i ], args );

					if ( value === false ) {
						break;
					}
				}
			}

		// A special, fast, case for the most common use of each
		} else {
			if ( isArray ) {
				for ( ; i < length; i++ ) {
					value = callback.call( obj[ i ], i, obj[ i ] );

					if ( value === false ) {
						break;
					}
				}
			} else {
				for ( i in obj ) {
					value = callback.call( obj[ i ], i, obj[ i ] );

					if ( value === false ) {
						break;
					}
				}
			}
		}

		return obj;
	},

	// Use native String.trim function wherever possible
	trim: core_trim && !core_trim.call("\uFEFF\xA0") ?
		function( text ) {
			return text == null ?
				"" :
				core_trim.call( text );
		} :

		// Otherwise use our own trimming functionality
		function( text ) {
			return text == null ?
				"" :
				( text + "" ).replace( rtrim, "" );
		},

	// results is for internal usage only
	makeArray: function( arr, results ) {
		var ret = results || [];

		if ( arr != null ) {
			if ( isArraylike( Object(arr) ) ) {
				jQuery.merge( ret,
					typeof arr === "string" ?
					[ arr ] : arr
				);
			} else {
				core_push.call( ret, arr );
			}
		}

		return ret;
	},

	inArray: function( elem, arr, i ) {
		var len;

		if ( arr ) {
			if ( core_indexOf ) {
				return core_indexOf.call( arr, elem, i );
			}

			len = arr.length;
			i = i ? i < 0 ? Math.max( 0, len + i ) : i : 0;

			for ( ; i < len; i++ ) {
				// Skip accessing in sparse arrays
				if ( i in arr && arr[ i ] === elem ) {
					return i;
				}
			}
		}

		return -1;
	},

	merge: function( first, second ) {
		var l = second.length,
			i = first.length,
			j = 0;

		if ( typeof l === "number" ) {
			for ( ; j < l; j++ ) {
				first[ i++ ] = second[ j ];
			}
		} else {
			while ( second[j] !== undefined ) {
				first[ i++ ] = second[ j++ ];
			}
		}

		first.length = i;

		return first;
	},

	grep: function( elems, callback, inv ) {
		var retVal,
			ret = [],
			i = 0,
			length = elems.length;
		inv = !!inv;

		// Go through the array, only saving the items
		// that pass the validator function
		for ( ; i < length; i++ ) {
			retVal = !!callback( elems[ i ], i );
			if ( inv !== retVal ) {
				ret.push( elems[ i ] );
			}
		}

		return ret;
	},

	// arg is for internal usage only
	map: function( elems, callback, arg ) {
		var value,
			i = 0,
			length = elems.length,
			isArray = isArraylike( elems ),
			ret = [];

		// Go through the array, translating each of the items to their
		if ( isArray ) {
			for ( ; i < length; i++ ) {
				value = callback( elems[ i ], i, arg );

				if ( value != null ) {
					ret[ ret.length ] = value;
				}
			}

		// Go through every key on the object,
		} else {
			for ( i in elems ) {
				value = callback( elems[ i ], i, arg );

				if ( value != null ) {
					ret[ ret.length ] = value;
				}
			}
		}

		// Flatten any nested arrays
		return core_concat.apply( [], ret );
	},

	// A global GUID counter for objects
	guid: 1,

	// Bind a function to a context, optionally partially applying any
	// arguments.
	proxy: function( fn, context ) {
		var args, proxy, tmp;

		if ( typeof context === "string" ) {
			tmp = fn[ context ];
			context = fn;
			fn = tmp;
		}

		// Quick check to determine if target is callable, in the spec
		// this throws a TypeError, but we will just return undefined.
		if ( !jQuery.isFunction( fn ) ) {
			return undefined;
		}

		// Simulated bind
		args = core_slice.call( arguments, 2 );
		proxy = function() {
			return fn.apply( context || this, args.concat( core_slice.call( arguments ) ) );
		};

		// Set the guid of unique handler to the same of original handler, so it can be removed
		proxy.guid = fn.guid = fn.guid || jQuery.guid++;

		return proxy;
	},

	// Multifunctional method to get and set values of a collection
	// The value/s can optionally be executed if it's a function
	access: function( elems, fn, key, value, chainable, emptyGet, raw ) {
		var i = 0,
			length = elems.length,
			bulk = key == null;

		// Sets many values
		if ( jQuery.type( key ) === "object" ) {
			chainable = true;
			for ( i in key ) {
				jQuery.access( elems, fn, i, key[i], true, emptyGet, raw );
			}

		// Sets one value
		} else if ( value !== undefined ) {
			chainable = true;

			if ( !jQuery.isFunction( value ) ) {
				raw = true;
			}

			if ( bulk ) {
				// Bulk operations run against the entire set
				if ( raw ) {
					fn.call( elems, value );
					fn = null;

				// ...except when executing function values
				} else {
					bulk = fn;
					fn = function( elem, key, value ) {
						return bulk.call( jQuery( elem ), value );
					};
				}
			}

			if ( fn ) {
				for ( ; i < length; i++ ) {
					fn( elems[i], key, raw ? value : value.call( elems[i], i, fn( elems[i], key ) ) );
				}
			}
		}

		return chainable ?
			elems :

			// Gets
			bulk ?
				fn.call( elems ) :
				length ? fn( elems[0], key ) : emptyGet;
	},

	now: function() {
		return ( new Date() ).getTime();
	}
});

jQuery.ready.promise = function( obj ) {
	if ( !readyList ) {

		readyList = jQuery.Deferred();

		// Catch cases where $(document).ready() is called after the browser event has already occurred.
		// we once tried to use readyState "interactive" here, but it caused issues like the one
		// discovered by ChrisS here: http://bugs.jquery.com/ticket/12282#comment:15
		if ( document.readyState === "complete" ) {
			// Handle it asynchronously to allow scripts the opportunity to delay ready
			setTimeout( jQuery.ready );

		// Standards-based browsers support DOMContentLoaded
		} else if ( document.addEventListener ) {
			// Use the handy event callback
			document.addEventListener( "DOMContentLoaded", completed, false );

			// A fallback to window.onload, that will always work
			window.addEventListener( "load", completed, false );

		// If IE event model is used
		} else {
			// Ensure firing before onload, maybe late but safe also for iframes
			document.attachEvent( "onreadystatechange", completed );

			// A fallback to window.onload, that will always work
			window.attachEvent( "onload", completed );

			// If IE and not a frame
			// continually check to see if the document is ready
			var top = false;

			try {
				top = window.frameElement == null && document.documentElement;
			} catch(e) {}

			if ( top && top.doScroll ) {
				(function doScrollCheck() {
					if ( !jQuery.isReady ) {

						try {
							// Use the trick by Diego Perini
							// http://javascript.nwbox.com/IEContentLoaded/
							top.doScroll("left");
						} catch(e) {
							return setTimeout( doScrollCheck, 50 );
						}

						// detach all dom ready events
						detach();

						// and execute any waiting functions
						jQuery.ready();
					}
				})();
			}
		}
	}
	return readyList.promise( obj );
};

// Populate the class2type map
jQuery.each("Boolean Number String Function Array Date RegExp Object Error".split(" "), function(i, name) {
	class2type[ "[object " + name + "]" ] = name.toLowerCase();
});

function isArraylike( obj ) {
	var length = obj.length,
		type = jQuery.type( obj );

	if ( jQuery.isWindow( obj ) ) {
		return false;
	}

	if ( obj.nodeType === 1 && length ) {
		return true;
	}

	return type === "array" || type !== "function" &&
		( length === 0 ||
		typeof length === "number" && length > 0 && ( length - 1 ) in obj );
}

// All jQuery objects should point back to these
rootjQuery = jQuery(document);
// String to Object options format cache
var optionsCache = {};

// Convert String-formatted options into Object-formatted ones and store in cache
function createOptions( options ) {
	var object = optionsCache[ options ] = {};
	jQuery.each( options.match( core_rnotwhite ) || [], function( _, flag ) {
		object[ flag ] = true;
	});
	return object;
}

/*
 * Create a callback list using the following parameters:
 *
 *	options: an optional list of space-separated options that will change how
 *			the callback list behaves or a more traditional option object
 *
 * By default a callback list will act like an event callback list and can be
 * "fired" multiple times.
 *
 * Possible options:
 *
 *	once:			will ensure the callback list can only be fired once (like a Deferred)
 *
 *	memory:			will keep track of previous values and will call any callback added
 *					after the list has been fired right away with the latest "memorized"
 *					values (like a Deferred)
 *
 *	unique:			will ensure a callback can only be added once (no duplicate in the list)
 *
 *	stopOnFalse:	interrupt callings when a callback returns false
 *
 */
jQuery.Callbacks = function( options ) {

	// Convert options from String-formatted to Object-formatted if needed
	// (we check in cache first)
	options = typeof options === "string" ?
		( optionsCache[ options ] || createOptions( options ) ) :
		jQuery.extend( {}, options );

	var // Flag to know if list is currently firing
		firing,
		// Last fire value (for non-forgettable lists)
		memory,
		// Flag to know if list was already fired
		fired,
		// End of the loop when firing
		firingLength,
		// Index of currently firing callback (modified by remove if needed)
		firingIndex,
		// First callback to fire (used internally by add and fireWith)
		firingStart,
		// Actual callback list
		list = [],
		// Stack of fire calls for repeatable lists
		stack = !options.once && [],
		// Fire callbacks
		fire = function( data ) {
			memory = options.memory && data;
			fired = true;
			firingIndex = firingStart || 0;
			firingStart = 0;
			firingLength = list.length;
			firing = true;
			for ( ; list && firingIndex < firingLength; firingIndex++ ) {
				if ( list[ firingIndex ].apply( data[ 0 ], data[ 1 ] ) === false && options.stopOnFalse ) {
					memory = false; // To prevent further calls using add
					break;
				}
			}
			firing = false;
			if ( list ) {
				if ( stack ) {
					if ( stack.length ) {
						fire( stack.shift() );
					}
				} else if ( memory ) {
					list = [];
				} else {
					self.disable();
				}
			}
		},
		// Actual Callbacks object
		self = {
			// Add a callback or a collection of callbacks to the list
			add: function() {
				if ( list ) {
					// First, we save the current length
					var start = list.length;
					(function add( args ) {
						jQuery.each( args, function( _, arg ) {
							var type = jQuery.type( arg );
							if ( type === "function" ) {
								if ( !options.unique || !self.has( arg ) ) {
									list.push( arg );
								}
							} else if ( arg && arg.length && type !== "string" ) {
								// Inspect recursively
								add( arg );
							}
						});
					})( arguments );
					// Do we need to add the callbacks to the
					// current firing batch?
					if ( firing ) {
						firingLength = list.length;
					// With memory, if we're not firing then
					// we should call right away
					} else if ( memory ) {
						firingStart = start;
						fire( memory );
					}
				}
				return this;
			},
			// Remove a callback from the list
			remove: function() {
				if ( list ) {
					jQuery.each( arguments, function( _, arg ) {
						var index;
						while( ( index = jQuery.inArray( arg, list, index ) ) > -1 ) {
							list.splice( index, 1 );
							// Handle firing indexes
							if ( firing ) {
								if ( index <= firingLength ) {
									firingLength--;
								}
								if ( index <= firingIndex ) {
									firingIndex--;
								}
							}
						}
					});
				}
				return this;
			},
			// Check if a given callback is in the list.
			// If no argument is given, return whether or not list has callbacks attached.
			has: function( fn ) {
				return fn ? jQuery.inArray( fn, list ) > -1 : !!( list && list.length );
			},
			// Remove all callbacks from the list
			empty: function() {
				list = [];
				return this;
			},
			// Have the list do nothing anymore
			disable: function() {
				list = stack = memory = undefined;
				return this;
			},
			// Is it disabled?
			disabled: function() {
				return !list;
			},
			// Lock the list in its current state
			lock: function() {
				stack = undefined;
				if ( !memory ) {
					self.disable();
				}
				return this;
			},
			// Is it locked?
			locked: function() {
				return !stack;
			},
			// Call all callbacks with the given context and arguments
			fireWith: function( context, args ) {
				args = args || [];
				args = [ context, args.slice ? args.slice() : args ];
				if ( list && ( !fired || stack ) ) {
					if ( firing ) {
						stack.push( args );
					} else {
						fire( args );
					}
				}
				return this;
			},
			// Call all the callbacks with the given arguments
			fire: function() {
				self.fireWith( this, arguments );
				return this;
			},
			// To know if the callbacks have already been called at least once
			fired: function() {
				return !!fired;
			}
		};

	return self;
};
jQuery.extend({

	Deferred: function( func ) {
		var tuples = [
				// action, add listener, listener list, final state
				[ "resolve", "done", jQuery.Callbacks("once memory"), "resolved" ],
				[ "reject", "fail", jQuery.Callbacks("once memory"), "rejected" ],
				[ "notify", "progress", jQuery.Callbacks("memory") ]
			],
			state = "pending",
			promise = {
				state: function() {
					return state;
				},
				always: function() {
					deferred.done( arguments ).fail( arguments );
					return this;
				},
				then: function( /* fnDone, fnFail, fnProgress */ ) {
					var fns = arguments;
					return jQuery.Deferred(function( newDefer ) {
						jQuery.each( tuples, function( i, tuple ) {
							var action = tuple[ 0 ],
								fn = jQuery.isFunction( fns[ i ] ) && fns[ i ];
							// deferred[ done | fail | progress ] for forwarding actions to newDefer
							deferred[ tuple[1] ](function() {
								var returned = fn && fn.apply( this, arguments );
								if ( returned && jQuery.isFunction( returned.promise ) ) {
									returned.promise()
										.done( newDefer.resolve )
										.fail( newDefer.reject )
										.progress( newDefer.notify );
								} else {
									newDefer[ action + "With" ]( this === promise ? newDefer.promise() : this, fn ? [ returned ] : arguments );
								}
							});
						});
						fns = null;
					}).promise();
				},
				// Get a promise for this deferred
				// If obj is provided, the promise aspect is added to the object
				promise: function( obj ) {
					return obj != null ? jQuery.extend( obj, promise ) : promise;
				}
			},
			deferred = {};

		// Keep pipe for back-compat
		promise.pipe = promise.then;

		// Add list-specific methods
		jQuery.each( tuples, function( i, tuple ) {
			var list = tuple[ 2 ],
				stateString = tuple[ 3 ];

			// promise[ done | fail | progress ] = list.add
			promise[ tuple[1] ] = list.add;

			// Handle state
			if ( stateString ) {
				list.add(function() {
					// state = [ resolved | rejected ]
					state = stateString;

				// [ reject_list | resolve_list ].disable; progress_list.lock
				}, tuples[ i ^ 1 ][ 2 ].disable, tuples[ 2 ][ 2 ].lock );
			}

			// deferred[ resolve | reject | notify ]
			deferred[ tuple[0] ] = function() {
				deferred[ tuple[0] + "With" ]( this === deferred ? promise : this, arguments );
				return this;
			};
			deferred[ tuple[0] + "With" ] = list.fireWith;
		});

		// Make the deferred a promise
		promise.promise( deferred );

		// Call given func if any
		if ( func ) {
			func.call( deferred, deferred );
		}

		// All done!
		return deferred;
	},

	// Deferred helper
	when: function( subordinate /* , ..., subordinateN */ ) {
		var i = 0,
			resolveValues = core_slice.call( arguments ),
			length = resolveValues.length,

			// the count of uncompleted subordinates
			remaining = length !== 1 || ( subordinate && jQuery.isFunction( subordinate.promise ) ) ? length : 0,

			// the master Deferred. If resolveValues consist of only a single Deferred, just use that.
			deferred = remaining === 1 ? subordinate : jQuery.Deferred(),

			// Update function for both resolve and progress values
			updateFunc = function( i, contexts, values ) {
				return function( value ) {
					contexts[ i ] = this;
					values[ i ] = arguments.length > 1 ? core_slice.call( arguments ) : value;
					if( values === progressValues ) {
						deferred.notifyWith( contexts, values );
					} else if ( !( --remaining ) ) {
						deferred.resolveWith( contexts, values );
					}
				};
			},

			progressValues, progressContexts, resolveContexts;

		// add listeners to Deferred subordinates; treat others as resolved
		if ( length > 1 ) {
			progressValues = new Array( length );
			progressContexts = new Array( length );
			resolveContexts = new Array( length );
			for ( ; i < length; i++ ) {
				if ( resolveValues[ i ] && jQuery.isFunction( resolveValues[ i ].promise ) ) {
					resolveValues[ i ].promise()
						.done( updateFunc( i, resolveContexts, resolveValues ) )
						.fail( deferred.reject )
						.progress( updateFunc( i, progressContexts, progressValues ) );
				} else {
					--remaining;
				}
			}
		}

		// if we're not waiting on anything, resolve the master
		if ( !remaining ) {
			deferred.resolveWith( resolveContexts, resolveValues );
		}

		return deferred.promise();
	}
});
jQuery.support = (function() {

	var support, all, a,
		input, select, fragment,
		opt, eventName, isSupported, i,
		div = document.createElement("div");

	// Setup
	div.setAttribute( "className", "t" );
	div.innerHTML = "  <link/><table></table><a href='/a'>a</a><input type='checkbox'/>";

	// Support tests won't run in some limited or non-browser environments
	all = div.getElementsByTagName("*");
	a = div.getElementsByTagName("a")[ 0 ];
	if ( !all || !a || !all.length ) {
		return {};
	}

	// First batch of tests
	select = document.createElement("select");
	opt = select.appendChild( document.createElement("option") );
	input = div.getElementsByTagName("input")[ 0 ];

	a.style.cssText = "top:1px;float:left;opacity:.5";
	support = {
		// Test setAttribute on camelCase class. If it works, we need attrFixes when doing get/setAttribute (ie6/7)
		getSetAttribute: div.className !== "t",

		// IE strips leading whitespace when .innerHTML is used
		leadingWhitespace: div.firstChild.nodeType === 3,

		// Make sure that tbody elements aren't automatically inserted
		// IE will insert them into empty tables
		tbody: !div.getElementsByTagName("tbody").length,

		// Make sure that link elements get serialized correctly by innerHTML
		// This requires a wrapper element in IE
		htmlSerialize: !!div.getElementsByTagName("link").length,

		// Get the style information from getAttribute
		// (IE uses .cssText instead)
		style: /top/.test( a.getAttribute("style") ),

		// Make sure that URLs aren't manipulated
		// (IE normalizes it by default)
		hrefNormalized: a.getAttribute("href") === "/a",

		// Make sure that element opacity exists
		// (IE uses filter instead)
		// Use a regex to work around a WebKit issue. See #5145
		opacity: /^0.5/.test( a.style.opacity ),

		// Verify style float existence
		// (IE uses styleFloat instead of cssFloat)
		cssFloat: !!a.style.cssFloat,

		// Check the default checkbox/radio value ("" on WebKit; "on" elsewhere)
		checkOn: !!input.value,

		// Make sure that a selected-by-default option has a working selected property.
		// (WebKit defaults to false instead of true, IE too, if it's in an optgroup)
		optSelected: opt.selected,

		// Tests for enctype support on a form (#6743)
		enctype: !!document.createElement("form").enctype,

		// Makes sure cloning an html5 element does not cause problems
		// Where outerHTML is undefined, this still works
		html5Clone: document.createElement("nav").cloneNode( true ).outerHTML !== "<:nav></:nav>",

		// jQuery.support.boxModel DEPRECATED in 1.8 since we don't support Quirks Mode
		boxModel: document.compatMode === "CSS1Compat",

		// Will be defined later
		deleteExpando: true,
		noCloneEvent: true,
		inlineBlockNeedsLayout: false,
		shrinkWrapBlocks: false,
		reliableMarginRight: true,
		boxSizingReliable: true,
		pixelPosition: false
	};

	// Make sure checked status is properly cloned
	input.checked = true;
	support.noCloneChecked = input.cloneNode( true ).checked;

	// Make sure that the options inside disabled selects aren't marked as disabled
	// (WebKit marks them as disabled)
	select.disabled = true;
	support.optDisabled = !opt.disabled;

	// Support: IE<9
	try {
		delete div.test;
	} catch( e ) {
		support.deleteExpando = false;
	}

	// Check if we can trust getAttribute("value")
	input = document.createElement("input");
	input.setAttribute( "value", "" );
	support.input = input.getAttribute( "value" ) === "";

	// Check if an input maintains its value after becoming a radio
	input.value = "t";
	input.setAttribute( "type", "radio" );
	support.radioValue = input.value === "t";

	// #11217 - WebKit loses check when the name is after the checked attribute
	input.setAttribute( "checked", "t" );
	input.setAttribute( "name", "t" );

	fragment = document.createDocumentFragment();
	fragment.appendChild( input );

	// Check if a disconnected checkbox will retain its checked
	// value of true after appended to the DOM (IE6/7)
	support.appendChecked = input.checked;

	// WebKit doesn't clone checked state correctly in fragments
	support.checkClone = fragment.cloneNode( true ).cloneNode( true ).lastChild.checked;

	// Support: IE<9
	// Opera does not clone events (and typeof div.attachEvent === undefined).
	// IE9-10 clones events bound via attachEvent, but they don't trigger with .click()
	if ( div.attachEvent ) {
		div.attachEvent( "onclick", function() {
			support.noCloneEvent = false;
		});

		div.cloneNode( true ).click();
	}

	// Support: IE<9 (lack submit/change bubble), Firefox 17+ (lack focusin event)
	// Beware of CSP restrictions (https://developer.mozilla.org/en/Security/CSP), test/csp.php
	for ( i in { submit: true, change: true, focusin: true }) {
		div.setAttribute( eventName = "on" + i, "t" );

		support[ i + "Bubbles" ] = eventName in window || div.attributes[ eventName ].expando === false;
	}

	div.style.backgroundClip = "content-box";
	div.cloneNode( true ).style.backgroundClip = "";
	support.clearCloneStyle = div.style.backgroundClip === "content-box";

	// Run tests that need a body at doc ready
	jQuery(function() {
		var container, marginDiv, tds,
			divReset = "padding:0;margin:0;border:0;display:block;box-sizing:content-box;-moz-box-sizing:content-box;-webkit-box-sizing:content-box;",
			body = document.getElementsByTagName("body")[0];

		if ( !body ) {
			// Return for frameset docs that don't have a body
			return;
		}

		container = document.createElement("div");
		container.style.cssText = "border:0;width:0;height:0;position:absolute;top:0;left:-9999px;margin-top:1px";

		body.appendChild( container ).appendChild( div );

		// Support: IE8
		// Check if table cells still have offsetWidth/Height when they are set
		// to display:none and there are still other visible table cells in a
		// table row; if so, offsetWidth/Height are not reliable for use when
		// determining if an element has been hidden directly using
		// display:none (it is still safe to use offsets if a parent element is
		// hidden; don safety goggles and see bug #4512 for more information).
		div.innerHTML = "<table><tr><td></td><td>t</td></tr></table>";
		tds = div.getElementsByTagName("td");
		tds[ 0 ].style.cssText = "padding:0;margin:0;border:0;display:none";
		isSupported = ( tds[ 0 ].offsetHeight === 0 );

		tds[ 0 ].style.display = "";
		tds[ 1 ].style.display = "none";

		// Support: IE8
		// Check if empty table cells still have offsetWidth/Height
		support.reliableHiddenOffsets = isSupported && ( tds[ 0 ].offsetHeight === 0 );

		// Check box-sizing and margin behavior
		div.innerHTML = "";
		div.style.cssText = "box-sizing:border-box;-moz-box-sizing:border-box;-webkit-box-sizing:border-box;padding:1px;border:1px;display:block;width:4px;margin-top:1%;position:absolute;top:1%;";
		support.boxSizing = ( div.offsetWidth === 4 );
		support.doesNotIncludeMarginInBodyOffset = ( body.offsetTop !== 1 );

		// Use window.getComputedStyle because jsdom on node.js will break without it.
		if ( window.getComputedStyle ) {
			support.pixelPosition = ( window.getComputedStyle( div, null ) || {} ).top !== "1%";
			support.boxSizingReliable = ( window.getComputedStyle( div, null ) || { width: "4px" } ).width === "4px";

			// Check if div with explicit width and no margin-right incorrectly
			// gets computed margin-right based on width of container. (#3333)
			// Fails in WebKit before Feb 2011 nightlies
			// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right
			marginDiv = div.appendChild( document.createElement("div") );
			marginDiv.style.cssText = div.style.cssText = divReset;
			marginDiv.style.marginRight = marginDiv.style.width = "0";
			div.style.width = "1px";

			support.reliableMarginRight =
				!parseFloat( ( window.getComputedStyle( marginDiv, null ) || {} ).marginRight );
		}

		if ( typeof div.style.zoom !== core_strundefined ) {
			// Support: IE<8
			// Check if natively block-level elements act like inline-block
			// elements when setting their display to 'inline' and giving
			// them layout
			div.innerHTML = "";
			div.style.cssText = divReset + "width:1px;padding:1px;display:inline;zoom:1";
			support.inlineBlockNeedsLayout = ( div.offsetWidth === 3 );

			// Support: IE6
			// Check if elements with layout shrink-wrap their children
			div.style.display = "block";
			div.innerHTML = "<div></div>";
			div.firstChild.style.width = "5px";
			support.shrinkWrapBlocks = ( div.offsetWidth !== 3 );

			if ( support.inlineBlockNeedsLayout ) {
				// Prevent IE 6 from affecting layout for positioned elements #11048
				// Prevent IE from shrinking the body in IE 7 mode #12869
				// Support: IE<8
				body.style.zoom = 1;
			}
		}

		body.removeChild( container );

		// Null elements to avoid leaks in IE
		container = div = tds = marginDiv = null;
	});

	// Null elements to avoid leaks in IE
	all = select = fragment = opt = a = input = null;

	return support;
})();

var rbrace = /(?:\{[\s\S]*\}|\[[\s\S]*\])$/,
	rmultiDash = /([A-Z])/g;

function internalData( elem, name, data, pvt /* Internal Use Only */ ){
	if ( !jQuery.acceptData( elem ) ) {
		return;
	}

	var thisCache, ret,
		internalKey = jQuery.expando,
		getByName = typeof name === "string",

		// We have to handle DOM nodes and JS objects differently because IE6-7
		// can't GC object references properly across the DOM-JS boundary
		isNode = elem.nodeType,

		// Only DOM nodes need the global jQuery cache; JS object data is
		// attached directly to the object so GC can occur automatically
		cache = isNode ? jQuery.cache : elem,

		// Only defining an ID for JS objects if its cache already exists allows
		// the code to shortcut on the same path as a DOM node with no cache
		id = isNode ? elem[ internalKey ] : elem[ internalKey ] && internalKey;

	// Avoid doing any more work than we need to when trying to get data on an
	// object that has no data at all
	if ( (!id || !cache[id] || (!pvt && !cache[id].data)) && getByName && data === undefined ) {
		return;
	}

	if ( !id ) {
		// Only DOM nodes need a new unique ID for each element since their data
		// ends up in the global cache
		if ( isNode ) {
			elem[ internalKey ] = id = core_deletedIds.pop() || jQuery.guid++;
		} else {
			id = internalKey;
		}
	}

	if ( !cache[ id ] ) {
		cache[ id ] = {};

		// Avoids exposing jQuery metadata on plain JS objects when the object
		// is serialized using JSON.stringify
		if ( !isNode ) {
			cache[ id ].toJSON = jQuery.noop;
		}
	}

	// An object can be passed to jQuery.data instead of a key/value pair; this gets
	// shallow copied over onto the existing cache
	if ( typeof name === "object" || typeof name === "function" ) {
		if ( pvt ) {
			cache[ id ] = jQuery.extend( cache[ id ], name );
		} else {
			cache[ id ].data = jQuery.extend( cache[ id ].data, name );
		}
	}

	thisCache = cache[ id ];

	// jQuery data() is stored in a separate object inside the object's internal data
	// cache in order to avoid key collisions between internal data and user-defined
	// data.
	if ( !pvt ) {
		if ( !thisCache.data ) {
			thisCache.data = {};
		}

		thisCache = thisCache.data;
	}

	if ( data !== undefined ) {
		thisCache[ jQuery.camelCase( name ) ] = data;
	}

	// Check for both converted-to-camel and non-converted data property names
	// If a data property was specified
	if ( getByName ) {

		// First Try to find as-is property data
		ret = thisCache[ name ];

		// Test for null|undefined property data
		if ( ret == null ) {

			// Try to find the camelCased property
			ret = thisCache[ jQuery.camelCase( name ) ];
		}
	} else {
		ret = thisCache;
	}

	return ret;
}

function internalRemoveData( elem, name, pvt ) {
	if ( !jQuery.acceptData( elem ) ) {
		return;
	}

	var i, l, thisCache,
		isNode = elem.nodeType,

		// See jQuery.data for more information
		cache = isNode ? jQuery.cache : elem,
		id = isNode ? elem[ jQuery.expando ] : jQuery.expando;

	// If there is already no cache entry for this object, there is no
	// purpose in continuing
	if ( !cache[ id ] ) {
		return;
	}

	if ( name ) {

		thisCache = pvt ? cache[ id ] : cache[ id ].data;

		if ( thisCache ) {

			// Support array or space separated string names for data keys
			if ( !jQuery.isArray( name ) ) {

				// try the string as a key before any manipulation
				if ( name in thisCache ) {
					name = [ name ];
				} else {

					// split the camel cased version by spaces unless a key with the spaces exists
					name = jQuery.camelCase( name );
					if ( name in thisCache ) {
						name = [ name ];
					} else {
						name = name.split(" ");
					}
				}
			} else {
				// If "name" is an array of keys...
				// When data is initially created, via ("key", "val") signature,
				// keys will be converted to camelCase.
				// Since there is no way to tell _how_ a key was added, remove
				// both plain key and camelCase key. #12786
				// This will only penalize the array argument path.
				name = name.concat( jQuery.map( name, jQuery.camelCase ) );
			}

			for ( i = 0, l = name.length; i < l; i++ ) {
				delete thisCache[ name[i] ];
			}

			// If there is no data left in the cache, we want to continue
			// and let the cache object itself get destroyed
			if ( !( pvt ? isEmptyDataObject : jQuery.isEmptyObject )( thisCache ) ) {
				return;
			}
		}
	}

	// See jQuery.data for more information
	if ( !pvt ) {
		delete cache[ id ].data;

		// Don't destroy the parent cache unless the internal data object
		// had been the only thing left in it
		if ( !isEmptyDataObject( cache[ id ] ) ) {
			return;
		}
	}

	// Destroy the cache
	if ( isNode ) {
		jQuery.cleanData( [ elem ], true );

	// Use delete when supported for expandos or `cache` is not a window per isWindow (#10080)
	} else if ( jQuery.support.deleteExpando || cache != cache.window ) {
		delete cache[ id ];

	// When all else fails, null
	} else {
		cache[ id ] = null;
	}
}

jQuery.extend({
	cache: {},

	// Unique for each copy of jQuery on the page
	// Non-digits removed to match rinlinejQuery
	expando: "jQuery" + ( core_version + Math.random() ).replace( /\D/g, "" ),

	// The following elements throw uncatchable exceptions if you
	// attempt to add expando properties to them.
	noData: {
		"embed": true,
		// Ban all objects except for Flash (which handle expandos)
		"object": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000",
		"applet": true
	},

	hasData: function( elem ) {
		elem = elem.nodeType ? jQuery.cache[ elem[jQuery.expando] ] : elem[ jQuery.expando ];
		return !!elem && !isEmptyDataObject( elem );
	},

	data: function( elem, name, data ) {
		return internalData( elem, name, data );
	},

	removeData: function( elem, name ) {
		return internalRemoveData( elem, name );
	},

	// For internal use only.
	_data: function( elem, name, data ) {
		return internalData( elem, name, data, true );
	},

	_removeData: function( elem, name ) {
		return internalRemoveData( elem, name, true );
	},

	// A method for determining if a DOM node can handle the data expando
	acceptData: function( elem ) {
		// Do not set data on non-element because it will not be cleared (#8335).
		if ( elem.nodeType && elem.nodeType !== 1 && elem.nodeType !== 9 ) {
			return false;
		}

		var noData = elem.nodeName && jQuery.noData[ elem.nodeName.toLowerCase() ];

		// nodes accept data unless otherwise specified; rejection can be conditional
		return !noData || noData !== true && elem.getAttribute("classid") === noData;
	}
});

jQuery.fn.extend({
	data: function( key, value ) {
		var attrs, name,
			elem = this[0],
			i = 0,
			data = null;

		// Gets all values
		if ( key === undefined ) {
			if ( this.length ) {
				data = jQuery.data( elem );

				if ( elem.nodeType === 1 && !jQuery._data( elem, "parsedAttrs" ) ) {
					attrs = elem.attributes;
					for ( ; i < attrs.length; i++ ) {
						name = attrs[i].name;

						if ( !name.indexOf( "data-" ) ) {
							name = jQuery.camelCase( name.slice(5) );

							dataAttr( elem, name, data[ name ] );
						}
					}
					jQuery._data( elem, "parsedAttrs", true );
				}
			}

			return data;
		}

		// Sets multiple values
		if ( typeof key === "object" ) {
			return this.each(function() {
				jQuery.data( this, key );
			});
		}

		return jQuery.access( this, function( value ) {

			if ( value === undefined ) {
				// Try to fetch any internally stored data first
				return elem ? dataAttr( elem, key, jQuery.data( elem, key ) ) : null;
			}

			this.each(function() {
				jQuery.data( this, key, value );
			});
		}, null, value, arguments.length > 1, null, true );
	},

	removeData: function( key ) {
		return this.each(function() {
			jQuery.removeData( this, key );
		});
	}
});

function dataAttr( elem, key, data ) {
	// If nothing was found internally, try to fetch any
	// data from the HTML5 data-* attribute
	if ( data === undefined && elem.nodeType === 1 ) {

		var name = "data-" + key.replace( rmultiDash, "-$1" ).toLowerCase();

		data = elem.getAttribute( name );

		if ( typeof data === "string" ) {
			try {
				data = data === "true" ? true :
					data === "false" ? false :
					data === "null" ? null :
					// Only convert to a number if it doesn't change the string
					+data + "" === data ? +data :
					rbrace.test( data ) ? jQuery.parseJSON( data ) :
						data;
			} catch( e ) {}

			// Make sure we set the data so it isn't changed later
			jQuery.data( elem, key, data );

		} else {
			data = undefined;
		}
	}

	return data;
}

// checks a cache object for emptiness
function isEmptyDataObject( obj ) {
	var name;
	for ( name in obj ) {

		// if the public data object is empty, the private is still empty
		if ( name === "data" && jQuery.isEmptyObject( obj[name] ) ) {
			continue;
		}
		if ( name !== "toJSON" ) {
			return false;
		}
	}

	return true;
}
jQuery.extend({
	queue: function( elem, type, data ) {
		var queue;

		if ( elem ) {
			type = ( type || "fx" ) + "queue";
			queue = jQuery._data( elem, type );

			// Speed up dequeue by getting out quickly if this is just a lookup
			if ( data ) {
				if ( !queue || jQuery.isArray(data) ) {
					queue = jQuery._data( elem, type, jQuery.makeArray(data) );
				} else {
					queue.push( data );
				}
			}
			return queue || [];
		}
	},

	dequeue: function( elem, type ) {
		type = type || "fx";

		var queue = jQuery.queue( elem, type ),
			startLength = queue.length,
			fn = queue.shift(),
			hooks = jQuery._queueHooks( elem, type ),
			next = function() {
				jQuery.dequeue( elem, type );
			};

		// If the fx queue is dequeued, always remove the progress sentinel
		if ( fn === "inprogress" ) {
			fn = queue.shift();
			startLength--;
		}

		hooks.cur = fn;
		if ( fn ) {

			// Add a progress sentinel to prevent the fx queue from being
			// automatically dequeued
			if ( type === "fx" ) {
				queue.unshift( "inprogress" );
			}

			// clear up the last queue stop function
			delete hooks.stop;
			fn.call( elem, next, hooks );
		}

		if ( !startLength && hooks ) {
			hooks.empty.fire();
		}
	},

	// not intended for public consumption - generates a queueHooks object, or returns the current one
	_queueHooks: function( elem, type ) {
		var key = type + "queueHooks";
		return jQuery._data( elem, key ) || jQuery._data( elem, key, {
			empty: jQuery.Callbacks("once memory").add(function() {
				jQuery._removeData( elem, type + "queue" );
				jQuery._removeData( elem, key );
			})
		});
	}
});

jQuery.fn.extend({
	queue: function( type, data ) {
		var setter = 2;

		if ( typeof type !== "string" ) {
			data = type;
			type = "fx";
			setter--;
		}

		if ( arguments.length < setter ) {
			return jQuery.queue( this[0], type );
		}

		return data === undefined ?
			this :
			this.each(function() {
				var queue = jQuery.queue( this, type, data );

				// ensure a hooks for this queue
				jQuery._queueHooks( this, type );

				if ( type === "fx" && queue[0] !== "inprogress" ) {
					jQuery.dequeue( this, type );
				}
			});
	},
	dequeue: function( type ) {
		return this.each(function() {
			jQuery.dequeue( this, type );
		});
	},
	// Based off of the plugin by Clint Helfers, with permission.
	// http://blindsignals.com/index.php/2009/07/jquery-delay/
	delay: function( time, type ) {
		time = jQuery.fx ? jQuery.fx.speeds[ time ] || time : time;
		type = type || "fx";

		return this.queue( type, function( next, hooks ) {
			var timeout = setTimeout( next, time );
			hooks.stop = function() {
				clearTimeout( timeout );
			};
		});
	},
	clearQueue: function( type ) {
		return this.queue( type || "fx", [] );
	},
	// Get a promise resolved when queues of a certain type
	// are emptied (fx is the type by default)
	promise: function( type, obj ) {
		var tmp,
			count = 1,
			defer = jQuery.Deferred(),
			elements = this,
			i = this.length,
			resolve = function() {
				if ( !( --count ) ) {
					defer.resolveWith( elements, [ elements ] );
				}
			};

		if ( typeof type !== "string" ) {
			obj = type;
			type = undefined;
		}
		type = type || "fx";

		while( i-- ) {
			tmp = jQuery._data( elements[ i ], type + "queueHooks" );
			if ( tmp && tmp.empty ) {
				count++;
				tmp.empty.add( resolve );
			}
		}
		resolve();
		return defer.promise( obj );
	}
});
var nodeHook, boolHook,
	rclass = /[\t\r\n]/g,
	rreturn = /\r/g,
	rfocusable = /^(?:input|select|textarea|button|object)$/i,
	rclickable = /^(?:a|area)$/i,
	rboolean = /^(?:checked|selected|autofocus|autoplay|async|controls|defer|disabled|hidden|loop|multiple|open|readonly|required|scoped)$/i,
	ruseDefault = /^(?:checked|selected)$/i,
	getSetAttribute = jQuery.support.getSetAttribute,
	getSetInput = jQuery.support.input;

jQuery.fn.extend({
	attr: function( name, value ) {
		return jQuery.access( this, jQuery.attr, name, value, arguments.length > 1 );
	},

	removeAttr: function( name ) {
		return this.each(function() {
			jQuery.removeAttr( this, name );
		});
	},

	prop: function( name, value ) {
		return jQuery.access( this, jQuery.prop, name, value, arguments.length > 1 );
	},

	removeProp: function( name ) {
		name = jQuery.propFix[ name ] || name;
		return this.each(function() {
			// try/catch handles cases where IE balks (such as removing a property on window)
			try {
				this[ name ] = undefined;
				delete this[ name ];
			} catch( e ) {}
		});
	},

	addClass: function( value ) {
		var classes, elem, cur, clazz, j,
			i = 0,
			len = this.length,
			proceed = typeof value === "string" && value;

		if ( jQuery.isFunction( value ) ) {
			return this.each(function( j ) {
				jQuery( this ).addClass( value.call( this, j, this.className ) );
			});
		}

		if ( proceed ) {
			// The disjunction here is for better compressibility (see removeClass)
			classes = ( value || "" ).match( core_rnotwhite ) || [];

			for ( ; i < len; i++ ) {
				elem = this[ i ];
				cur = elem.nodeType === 1 && ( elem.className ?
					( " " + elem.className + " " ).replace( rclass, " " ) :
					" "
				);

				if ( cur ) {
					j = 0;
					while ( (clazz = classes[j++]) ) {
						if ( cur.indexOf( " " + clazz + " " ) < 0 ) {
							cur += clazz + " ";
						}
					}
					elem.className = jQuery.trim( cur );

				}
			}
		}

		return this;
	},

	removeClass: function( value ) {
		var classes, elem, cur, clazz, j,
			i = 0,
			len = this.length,
			proceed = arguments.length === 0 || typeof value === "string" && value;

		if ( jQuery.isFunction( value ) ) {
			return this.each(function( j ) {
				jQuery( this ).removeClass( value.call( this, j, this.className ) );
			});
		}
		if ( proceed ) {
			classes = ( value || "" ).match( core_rnotwhite ) || [];

			for ( ; i < len; i++ ) {
				elem = this[ i ];
				// This expression is here for better compressibility (see addClass)
				cur = elem.nodeType === 1 && ( elem.className ?
					( " " + elem.className + " " ).replace( rclass, " " ) :
					""
				);

				if ( cur ) {
					j = 0;
					while ( (clazz = classes[j++]) ) {
						// Remove *all* instances
						while ( cur.indexOf( " " + clazz + " " ) >= 0 ) {
							cur = cur.replace( " " + clazz + " ", " " );
						}
					}
					elem.className = value ? jQuery.trim( cur ) : "";
				}
			}
		}

		return this;
	},

	toggleClass: function( value, stateVal ) {
		var type = typeof value,
			isBool = typeof stateVal === "boolean";

		if ( jQuery.isFunction( value ) ) {
			return this.each(function( i ) {
				jQuery( this ).toggleClass( value.call(this, i, this.className, stateVal), stateVal );
			});
		}

		return this.each(function() {
			if ( type === "string" ) {
				// toggle individual class names
				var className,
					i = 0,
					self = jQuery( this ),
					state = stateVal,
					classNames = value.match( core_rnotwhite ) || [];

				while ( (className = classNames[ i++ ]) ) {
					// check each className given, space separated list
					state = isBool ? state : !self.hasClass( className );
					self[ state ? "addClass" : "removeClass" ]( className );
				}

			// Toggle whole class name
			} else if ( type === core_strundefined || type === "boolean" ) {
				if ( this.className ) {
					// store className if set
					jQuery._data( this, "__className__", this.className );
				}

				// If the element has a class name or if we're passed "false",
				// then remove the whole classname (if there was one, the above saved it).
				// Otherwise bring back whatever was previously saved (if anything),
				// falling back to the empty string if nothing was stored.
				this.className = this.className || value === false ? "" : jQuery._data( this, "__className__" ) || "";
			}
		});
	},

	hasClass: function( selector ) {
		var className = " " + selector + " ",
			i = 0,
			l = this.length;
		for ( ; i < l; i++ ) {
			if ( this[i].nodeType === 1 && (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) >= 0 ) {
				return true;
			}
		}

		return false;
	},

	val: function( value ) {
		var ret, hooks, isFunction,
			elem = this[0];

		if ( !arguments.length ) {
			if ( elem ) {
				hooks = jQuery.valHooks[ elem.type ] || jQuery.valHooks[ elem.nodeName.toLowerCase() ];

				if ( hooks && "get" in hooks && (ret = hooks.get( elem, "value" )) !== undefined ) {
					return ret;
				}

				ret = elem.value;

				return typeof ret === "string" ?
					// handle most common string cases
					ret.replace(rreturn, "") :
					// handle cases where value is null/undef or number
					ret == null ? "" : ret;
			}

			return;
		}

		isFunction = jQuery.isFunction( value );

		return this.each(function( i ) {
			var val,
				self = jQuery(this);

			if ( this.nodeType !== 1 ) {
				return;
			}

			if ( isFunction ) {
				val = value.call( this, i, self.val() );
			} else {
				val = value;
			}

			// Treat null/undefined as ""; convert numbers to string
			if ( val == null ) {
				val = "";
			} else if ( typeof val === "number" ) {
				val += "";
			} else if ( jQuery.isArray( val ) ) {
				val = jQuery.map(val, function ( value ) {
					return value == null ? "" : value + "";
				});
			}

			hooks = jQuery.valHooks[ this.type ] || jQuery.valHooks[ this.nodeName.toLowerCase() ];

			// If set returns undefined, fall back to normal setting
			if ( !hooks || !("set" in hooks) || hooks.set( this, val, "value" ) === undefined ) {
				this.value = val;
			}
		});
	}
});

jQuery.extend({
	valHooks: {
		option: {
			get: function( elem ) {
				// attributes.value is undefined in Blackberry 4.7 but
				// uses .value. See #6932
				var val = elem.attributes.value;
				return !val || val.specified ? elem.value : elem.text;
			}
		},
		select: {
			get: function( elem ) {
				var value, option,
					options = elem.options,
					index = elem.selectedIndex,
					one = elem.type === "select-one" || index < 0,
					values = one ? null : [],
					max = one ? index + 1 : options.length,
					i = index < 0 ?
						max :
						one ? index : 0;

				// Loop through all the selected options
				for ( ; i < max; i++ ) {
					option = options[ i ];

					// oldIE doesn't update selected after form reset (#2551)
					if ( ( option.selected || i === index ) &&
							// Don't return options that are disabled or in a disabled optgroup
							( jQuery.support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null ) &&
							( !option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" ) ) ) {

						// Get the specific value for the option
						value = jQuery( option ).val();

						// We don't need an array for one selects
						if ( one ) {
							return value;
						}

						// Multi-Selects return an array
						values.push( value );
					}
				}

				return values;
			},

			set: function( elem, value ) {
				var values = jQuery.makeArray( value );

				jQuery(elem).find("option").each(function() {
					this.selected = jQuery.inArray( jQuery(this).val(), values ) >= 0;
				});

				if ( !values.length ) {
					elem.selectedIndex = -1;
				}
				return values;
			}
		}
	},

	attr: function( elem, name, value ) {
		var hooks, notxml, ret,
			nType = elem.nodeType;

		// don't get/set attributes on text, comment and attribute nodes
		if ( !elem || nType === 3 || nType === 8 || nType === 2 ) {
			return;
		}

		// Fallback to prop when attributes are not supported
		if ( typeof elem.getAttribute === core_strundefined ) {
			return jQuery.prop( elem, name, value );
		}

		notxml = nType !== 1 || !jQuery.isXMLDoc( elem );

		// All attributes are lowercase
		// Grab necessary hook if one is defined
		if ( notxml ) {
			name = name.toLowerCase();
			hooks = jQuery.attrHooks[ name ] || ( rboolean.test( name ) ? boolHook : nodeHook );
		}

		if ( value !== undefined ) {

			if ( value === null ) {
				jQuery.removeAttr( elem, name );

			} else if ( hooks && notxml && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) {
				return ret;

			} else {
				elem.setAttribute( name, value + "" );
				return value;
			}

		} else if ( hooks && notxml && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) {
			return ret;

		} else {

			// In IE9+, Flash objects don't have .getAttribute (#12945)
			// Support: IE9+
			if ( typeof elem.getAttribute !== core_strundefined ) {
				ret =  elem.getAttribute( name );
			}

			// Non-existent attributes return null, we normalize to undefined
			return ret == null ?
				undefined :
				ret;
		}
	},

	removeAttr: function( elem, value ) {
		var name, propName,
			i = 0,
			attrNames = value && value.match( core_rnotwhite );

		if ( attrNames && elem.nodeType === 1 ) {
			while ( (name = attrNames[i++]) ) {
				propName = jQuery.propFix[ name ] || name;

				// Boolean attributes get special treatment (#10870)
				if ( rboolean.test( name ) ) {
					// Set corresponding property to false for boolean attributes
					// Also clear defaultChecked/defaultSelected (if appropriate) for IE<8
					if ( !getSetAttribute && ruseDefault.test( name ) ) {
						elem[ jQuery.camelCase( "default-" + name ) ] =
							elem[ propName ] = false;
					} else {
						elem[ propName ] = false;
					}

				// See #9699 for explanation of this approach (setting first, then removal)
				} else {
					jQuery.attr( elem, name, "" );
				}

				elem.removeAttribute( getSetAttribute ? name : propName );
			}
		}
	},

	attrHooks: {
		type: {
			set: function( elem, value ) {
				if ( !jQuery.support.radioValue && value === "radio" && jQuery.nodeName(elem, "input") ) {
					// Setting the type on a radio button after the value resets the value in IE6-9
					// Reset value to default in case type is set after value during creation
					var val = elem.value;
					elem.setAttribute( "type", value );
					if ( val ) {
						elem.value = val;
					}
					return value;
				}
			}
		}
	},

	propFix: {
		tabindex: "tabIndex",
		readonly: "readOnly",
		"for": "htmlFor",
		"class": "className",
		maxlength: "maxLength",
		cellspacing: "cellSpacing",
		cellpadding: "cellPadding",
		rowspan: "rowSpan",
		colspan: "colSpan",
		usemap: "useMap",
		frameborder: "frameBorder",
		contenteditable: "contentEditable"
	},

	prop: function( elem, name, value ) {
		var ret, hooks, notxml,
			nType = elem.nodeType;

		// don't get/set properties on text, comment and attribute nodes
		if ( !elem || nType === 3 || nType === 8 || nType === 2 ) {
			return;
		}

		notxml = nType !== 1 || !jQuery.isXMLDoc( elem );

		if ( notxml ) {
			// Fix name and attach hooks
			name = jQuery.propFix[ name ] || name;
			hooks = jQuery.propHooks[ name ];
		}

		if ( value !== undefined ) {
			if ( hooks && "set" in hooks && (ret = hooks.set( elem, value, name )) !== undefined ) {
				return ret;

			} else {
				return ( elem[ name ] = value );
			}

		} else {
			if ( hooks && "get" in hooks && (ret = hooks.get( elem, name )) !== null ) {
				return ret;

			} else {
				return elem[ name ];
			}
		}
	},

	propHooks: {
		tabIndex: {
			get: function( elem ) {
				// elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set
				// http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/
				var attributeNode = elem.getAttributeNode("tabindex");

				return attributeNode && attributeNode.specified ?
					parseInt( attributeNode.value, 10 ) :
					rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ?
						0 :
						undefined;
			}
		}
	}
});

// Hook for boolean attributes
boolHook = {
	get: function( elem, name ) {
		var
			// Use .prop to determine if this attribute is understood as boolean
			prop = jQuery.prop( elem, name ),

			// Fetch it accordingly
			attr = typeof prop === "boolean" && elem.getAttribute( name ),
			detail = typeof prop === "boolean" ?

				getSetInput && getSetAttribute ?
					attr != null :
					// oldIE fabricates an empty string for missing boolean attributes
					// and conflates checked/selected into attroperties
					ruseDefault.test( name ) ?
						elem[ jQuery.camelCase( "default-" + name ) ] :
						!!attr :

				// fetch an attribute node for properties not recognized as boolean
				elem.getAttributeNode( name );

		return detail && detail.value !== false ?
			name.toLowerCase() :
			undefined;
	},
	set: function( elem, value, name ) {
		if ( value === false ) {
			// Remove boolean attributes when set to false
			jQuery.removeAttr( elem, name );
		} else if ( getSetInput && getSetAttribute || !ruseDefault.test( name ) ) {
			// IE<8 needs the *property* name
			elem.setAttribute( !getSetAttribute && jQuery.propFix[ name ] || name, name );

		// Use defaultChecked and defaultSelected for oldIE
		} else {
			elem[ jQuery.camelCase( "default-" + name ) ] = elem[ name ] = true;
		}

		return name;
	}
};

// fix oldIE value attroperty
if ( !getSetInput || !getSetAttribute ) {
	jQuery.attrHooks.value = {
		get: function( elem, name ) {
			var ret = elem.getAttributeNode( name );
			return jQuery.nodeName( elem, "input" ) ?

				// Ignore the value *property* by using defaultValue
				elem.defaultValue :

				ret && ret.specified ? ret.value : undefined;
		},
		set: function( elem, value, name ) {
			if ( jQuery.nodeName( elem, "input" ) ) {
				// Does not return so that setAttribute is also used
				elem.defaultValue = value;
			} else {
				// Use nodeHook if defined (#1954); otherwise setAttribute is fine
				return nodeHook && nodeHook.set( elem, value, name );
			}
		}
	};
}

// IE6/7 do not support getting/setting some attributes with get/setAttribute
if ( !getSetAttribute ) {

	// Use this for any attribute in IE6/7
	// This fixes almost every IE6/7 issue
	nodeHook = jQuery.valHooks.button = {
		get: function( elem, name ) {
			var ret = elem.getAttributeNode( name );
			return ret && ( name === "id" || name === "name" || name === "coords" ? ret.value !== "" : ret.specified ) ?
				ret.value :
				undefined;
		},
		set: function( elem, value, name ) {
			// Set the existing or create a new attribute node
			var ret = elem.getAttributeNode( name );
			if ( !ret ) {
				elem.setAttributeNode(
					(ret = elem.ownerDocument.createAttribute( name ))
				);
			}

			ret.value = value += "";

			// Break association with cloned elements by also using setAttribute (#9646)
			return name === "value" || value === elem.getAttribute( name ) ?
				value :
				undefined;
		}
	};

	// Set contenteditable to false on removals(#10429)
	// Setting to empty string throws an error as an invalid value
	jQuery.attrHooks.contenteditable = {
		get: nodeHook.get,
		set: function( elem, value, name ) {
			nodeHook.set( elem, value === "" ? false : value, name );
		}
	};

	// Set width and height to auto instead of 0 on empty string( Bug #8150 )
	// This is for removals
	jQuery.each([ "width", "height" ], function( i, name ) {
		jQuery.attrHooks[ name ] = jQuery.extend( jQuery.attrHooks[ name ], {
			set: function( elem, value ) {
				if ( value === "" ) {
					elem.setAttribute( name, "auto" );
					return value;
				}
			}
		});
	});
}


// Some attributes require a special call on IE
// http://msdn.microsoft.com/en-us/library/ms536429%28VS.85%29.aspx
if ( !jQuery.support.hrefNormalized ) {
	jQuery.each([ "href", "src", "width", "height" ], function( i, name ) {
		jQuery.attrHooks[ name ] = jQuery.extend( jQuery.attrHooks[ name ], {
			get: function( elem ) {
				var ret = elem.getAttribute( name, 2 );
				return ret == null ? undefined : ret;
			}
		});
	});

	// href/src property should get the full normalized URL (#10299/#12915)
	jQuery.each([ "href", "src" ], function( i, name ) {
		jQuery.propHooks[ name ] = {
			get: function( elem ) {
				return elem.getAttribute( name, 4 );
			}
		};
	});
}

if ( !jQuery.support.style ) {
	jQuery.attrHooks.style = {
		get: function( elem ) {
			// Return undefined in the case of empty string
			// Note: IE uppercases css property names, but if we were to .toLowerCase()
			// .cssText, that would destroy case senstitivity in URL's, like in "background"
			return elem.style.cssText || undefined;
		},
		set: function( elem, value ) {
			return ( elem.style.cssText = value + "" );
		}
	};
}

// Safari mis-reports the default selected property of an option
// Accessing the parent's selectedIndex property fixes it
if ( !jQuery.support.optSelected ) {
	jQuery.propHooks.selected = jQuery.extend( jQuery.propHooks.selected, {
		get: function( elem ) {
			var parent = elem.parentNode;

			if ( parent ) {
				parent.selectedIndex;

				// Make sure that it also works with optgroups, see #5701
				if ( parent.parentNode ) {
					parent.parentNode.selectedIndex;
				}
			}
			return null;
		}
	});
}

// IE6/7 call enctype encoding
if ( !jQuery.support.enctype ) {
	jQuery.propFix.enctype = "encoding";
}

// Radios and checkboxes getter/setter
if ( !jQuery.support.checkOn ) {
	jQuery.each([ "radio", "checkbox" ], function() {
		jQuery.valHooks[ this ] = {
			get: function( elem ) {
				// Handle the case where in Webkit "" is returned instead of "on" if a value isn't specified
				return elem.getAttribute("value") === null ? "on" : elem.value;
			}
		};
	});
}
jQuery.each([ "radio", "checkbox" ], function() {
	jQuery.valHooks[ this ] = jQuery.extend( jQuery.valHooks[ this ], {
		set: function( elem, value ) {
			if ( jQuery.isArray( value ) ) {
				return ( elem.checked = jQuery.inArray( jQuery(elem).val(), value ) >= 0 );
			}
		}
	});
});
var rformElems = /^(?:input|select|textarea)$/i,
	rkeyEvent = /^key/,
	rmouseEvent = /^(?:mouse|contextmenu)|click/,
	rfocusMorph = /^(?:focusinfocus|focusoutblur)$/,
	rtypenamespace = /^([^.]*)(?:\.(.+)|)$/;

function returnTrue() {
	return true;
}

function returnFalse() {
	return false;
}

/*
 * Helper functions for managing events -- not part of the public interface.
 * Props to Dean Edwards' addEvent library for many of the ideas.
 */
jQuery.event = {

	global: {},

	add: function( elem, types, handler, data, selector ) {
		var tmp, events, t, handleObjIn,
			special, eventHandle, handleObj,
			handlers, type, namespaces, origType,
			elemData = jQuery._data( elem );

		// Don't attach events to noData or text/comment nodes (but allow plain objects)
		if ( !elemData ) {
			return;
		}

		// Caller can pass in an object of custom data in lieu of the handler
		if ( handler.handler ) {
			handleObjIn = handler;
			handler = handleObjIn.handler;
			selector = handleObjIn.selector;
		}

		// Make sure that the handler has a unique ID, used to find/remove it later
		if ( !handler.guid ) {
			handler.guid = jQuery.guid++;
		}

		// Init the element's event structure and main handler, if this is the first
		if ( !(events = elemData.events) ) {
			events = elemData.events = {};
		}
		if ( !(eventHandle = elemData.handle) ) {
			eventHandle = elemData.handle = function( e ) {
				// Discard the second event of a jQuery.event.trigger() and
				// when an event is called after a page has unloaded
				return typeof jQuery !== core_strundefined && (!e || jQuery.event.triggered !== e.type) ?
					jQuery.event.dispatch.apply( eventHandle.elem, arguments ) :
					undefined;
			};
			// Add elem as a property of the handle fn to prevent a memory leak with IE non-native events
			eventHandle.elem = elem;
		}

		// Handle multiple events separated by a space
		// jQuery(...).bind("mouseover mouseout", fn);
		types = ( types || "" ).match( core_rnotwhite ) || [""];
		t = types.length;
		while ( t-- ) {
			tmp = rtypenamespace.exec( types[t] ) || [];
			type = origType = tmp[1];
			namespaces = ( tmp[2] || "" ).split( "." ).sort();

			// If event changes its type, use the special event handlers for the changed type
			special = jQuery.event.special[ type ] || {};

			// If selector defined, determine special event api type, otherwise given type
			type = ( selector ? special.delegateType : special.bindType ) || type;

			// Update special based on newly reset type
			special = jQuery.event.special[ type ] || {};

			// handleObj is passed to all event handlers
			handleObj = jQuery.extend({
				type: type,
				origType: origType,
				data: data,
				handler: handler,
				guid: handler.guid,
				selector: selector,
				needsContext: selector && jQuery.expr.match.needsContext.test( selector ),
				namespace: namespaces.join(".")
			}, handleObjIn );

			// Init the event handler queue if we're the first
			if ( !(handlers = events[ type ]) ) {
				handlers = events[ type ] = [];
				handlers.delegateCount = 0;

				// Only use addEventListener/attachEvent if the special events handler returns false
				if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) {
					// Bind the global event handler to the element
					if ( elem.addEventListener ) {
						elem.addEventListener( type, eventHandle, false );

					} else if ( elem.attachEvent ) {
						elem.attachEvent( "on" + type, eventHandle );
					}
				}
			}

			if ( special.add ) {
				special.add.call( elem, handleObj );

				if ( !handleObj.handler.guid ) {
					handleObj.handler.guid = handler.guid;
				}
			}

			// Add to the element's handler list, delegates in front
			if ( selector ) {
				handlers.splice( handlers.delegateCount++, 0, handleObj );
			} else {
				handlers.push( handleObj );
			}

			// Keep track of which events have ever been used, for event optimization
			jQuery.event.global[ type ] = true;
		}

		// Nullify elem to prevent memory leaks in IE
		elem = null;
	},

	// Detach an event or set of events from an element
	remove: function( elem, types, handler, selector, mappedTypes ) {
		var j, handleObj, tmp,
			origCount, t, events,
			special, handlers, type,
			namespaces, origType,
			elemData = jQuery.hasData( elem ) && jQuery._data( elem );

		if ( !elemData || !(events = elemData.events) ) {
			return;
		}

		// Once for each type.namespace in types; type may be omitted
		types = ( types || "" ).match( core_rnotwhite ) || [""];
		t = types.length;
		while ( t-- ) {
			tmp = rtypenamespace.exec( types[t] ) || [];
			type = origType = tmp[1];
			namespaces = ( tmp[2] || "" ).split( "." ).sort();

			// Unbind all events (on this namespace, if provided) for the element
			if ( !type ) {
				for ( type in events ) {
					jQuery.event.remove( elem, type + types[ t ], handler, selector, true );
				}
				continue;
			}

			special = jQuery.event.special[ type ] || {};
			type = ( selector ? special.delegateType : special.bindType ) || type;
			handlers = events[ type ] || [];
			tmp = tmp[2] && new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" );

			// Remove matching events
			origCount = j = handlers.length;
			while ( j-- ) {
				handleObj = handlers[ j ];

				if ( ( mappedTypes || origType === handleObj.origType ) &&
					( !handler || handler.guid === handleObj.guid ) &&
					( !tmp || tmp.test( handleObj.namespace ) ) &&
					( !selector || selector === handleObj.selector || selector === "**" && handleObj.selector ) ) {
					handlers.splice( j, 1 );

					if ( handleObj.selector ) {
						handlers.delegateCount--;
					}
					if ( special.remove ) {
						special.remove.call( elem, handleObj );
					}
				}
			}

			// Remove generic event handler if we removed something and no more handlers exist
			// (avoids potential for endless recursion during removal of special event handlers)
			if ( origCount && !handlers.length ) {
				if ( !special.teardown || special.teardown.call( elem, namespaces, elemData.handle ) === false ) {
					jQuery.removeEvent( elem, type, elemData.handle );
				}

				delete events[ type ];
			}
		}

		// Remove the expando if it's no longer used
		if ( jQuery.isEmptyObject( events ) ) {
			delete elemData.handle;

			// removeData also checks for emptiness and clears the expando if empty
			// so use it instead of delete
			jQuery._removeData( elem, "events" );
		}
	},

	trigger: function( event, data, elem, onlyHandlers ) {
		var handle, ontype, cur,
			bubbleType, special, tmp, i,
			eventPath = [ elem || document ],
			type = core_hasOwn.call( event, "type" ) ? event.type : event,
			namespaces = core_hasOwn.call( event, "namespace" ) ? event.namespace.split(".") : [];

		cur = tmp = elem = elem || document;

		// Don't do events on text and comment nodes
		if ( elem.nodeType === 3 || elem.nodeType === 8 ) {
			return;
		}

		// focus/blur morphs to focusin/out; ensure we're not firing them right now
		if ( rfocusMorph.test( type + jQuery.event.triggered ) ) {
			return;
		}

		if ( type.indexOf(".") >= 0 ) {
			// Namespaced trigger; create a regexp to match event type in handle()
			namespaces = type.split(".");
			type = namespaces.shift();
			namespaces.sort();
		}
		ontype = type.indexOf(":") < 0 && "on" + type;

		// Caller can pass in a jQuery.Event object, Object, or just an event type string
		event = event[ jQuery.expando ] ?
			event :
			new jQuery.Event( type, typeof event === "object" && event );

		event.isTrigger = true;
		event.namespace = namespaces.join(".");
		event.namespace_re = event.namespace ?
			new RegExp( "(^|\\.)" + namespaces.join("\\.(?:.*\\.|)") + "(\\.|$)" ) :
			null;

		// Clean up the event in case it is being reused
		event.result = undefined;
		if ( !event.target ) {
			event.target = elem;
		}

		// Clone any incoming data and prepend the event, creating the handler arg list
		data = data == null ?
			[ event ] :
			jQuery.makeArray( data, [ event ] );

		// Allow special events to draw outside the lines
		special = jQuery.event.special[ type ] || {};
		if ( !onlyHandlers && special.trigger && special.trigger.apply( elem, data ) === false ) {
			return;
		}

		// Determine event propagation path in advance, per W3C events spec (#9951)
		// Bubble up to document, then to window; watch for a global ownerDocument var (#9724)
		if ( !onlyHandlers && !special.noBubble && !jQuery.isWindow( elem ) ) {

			bubbleType = special.delegateType || type;
			if ( !rfocusMorph.test( bubbleType + type ) ) {
				cur = cur.parentNode;
			}
			for ( ; cur; cur = cur.parentNode ) {
				eventPath.push( cur );
				tmp = cur;
			}

			// Only add window if we got to document (e.g., not plain obj or detached DOM)
			if ( tmp === (elem.ownerDocument || document) ) {
				eventPath.push( tmp.defaultView || tmp.parentWindow || window );
			}
		}

		// Fire handlers on the event path
		i = 0;
		while ( (cur = eventPath[i++]) && !event.isPropagationStopped() ) {

			event.type = i > 1 ?
				bubbleType :
				special.bindType || type;

			// jQuery handler
			handle = ( jQuery._data( cur, "events" ) || {} )[ event.type ] && jQuery._data( cur, "handle" );
			if ( handle ) {
				handle.apply( cur, data );
			}

			// Native handler
			handle = ontype && cur[ ontype ];
			if ( handle && jQuery.acceptData( cur ) && handle.apply && handle.apply( cur, data ) === false ) {
				event.preventDefault();
			}
		}
		event.type = type;

		// If nobody prevented the default action, do it now
		if ( !onlyHandlers && !event.isDefaultPrevented() ) {

			if ( (!special._default || special._default.apply( elem.ownerDocument, data ) === false) &&
				!(type === "click" && jQuery.nodeName( elem, "a" )) && jQuery.acceptData( elem ) ) {

				// Call a native DOM method on the target with the same name name as the event.
				// Can't use an .isFunction() check here because IE6/7 fails that test.
				// Don't do default actions on window, that's where global variables be (#6170)
				if ( ontype && elem[ type ] && !jQuery.isWindow( elem ) ) {

					// Don't re-trigger an onFOO event when we call its FOO() method
					tmp = elem[ ontype ];

					if ( tmp ) {
						elem[ ontype ] = null;
					}

					// Prevent re-triggering of the same event, since we already bubbled it above
					jQuery.event.triggered = type;
					try {
						elem[ type ]();
					} catch ( e ) {
						// IE<9 dies on focus/blur to hidden element (#1486,#12518)
						// only reproducible on winXP IE8 native, not IE9 in IE8 mode
					}
					jQuery.event.triggered = undefined;

					if ( tmp ) {
						elem[ ontype ] = tmp;
					}
				}
			}
		}

		return event.result;
	},

	dispatch: function( event ) {

		// Make a writable jQuery.Event from the native event object
		event = jQuery.event.fix( event );

		var i, ret, handleObj, matched, j,
			handlerQueue = [],
			args = core_slice.call( arguments ),
			handlers = ( jQuery._data( this, "events" ) || {} )[ event.type ] || [],
			special = jQuery.event.special[ event.type ] || {};

		// Use the fix-ed jQuery.Event rather than the (read-only) native event
		args[0] = event;
		event.delegateTarget = this;

		// Call the preDispatch hook for the mapped type, and let it bail if desired
		if ( special.preDispatch && special.preDispatch.call( this, event ) === false ) {
			return;
		}

		// Determine handlers
		handlerQueue = jQuery.event.handlers.call( this, event, handlers );

		// Run delegates first; they may want to stop propagation beneath us
		i = 0;
		while ( (matched = handlerQueue[ i++ ]) && !event.isPropagationStopped() ) {
			event.currentTarget = matched.elem;

			j = 0;
			while ( (handleObj = matched.handlers[ j++ ]) && !event.isImmediatePropagationStopped() ) {

				// Triggered event must either 1) have no namespace, or
				// 2) have namespace(s) a subset or equal to those in the bound event (both can have no namespace).
				if ( !event.namespace_re || event.namespace_re.test( handleObj.namespace ) ) {

					event.handleObj = handleObj;
					event.data = handleObj.data;

					var obj = ( (jQuery.event.special[ handleObj.origType ] || {}).handle || handleObj.handler );
					if(obj.apply){
						ret = obj.apply( matched.elem, args );
					}

					if ( ret !== undefined ) {
						if ( (event.result = ret) === false ) {
							event.preventDefault();
							event.stopPropagation();
						}
					}
				}
			}
		}

		// Call the postDispatch hook for the mapped type
		if ( special.postDispatch ) {
			special.postDispatch.call( this, event );
		}

		return event.result;
	},

	handlers: function( event, handlers ) {
		var sel, handleObj, matches, i,
			handlerQueue = [],
			delegateCount = handlers.delegateCount,
			cur = event.target;

		// Find delegate handlers
		// Black-hole SVG <use> instance trees (#13180)
		// Avoid non-left-click bubbling in Firefox (#3861)
		if ( delegateCount && cur.nodeType && (!event.button || event.type !== "click") ) {

			for ( ; cur != this; cur = cur.parentNode || this ) {

				// Don't check non-elements (#13208)
				// Don't process clicks on disabled elements (#6911, #8165, #11382, #11764)
				if ( cur.nodeType === 1 && (cur.disabled !== true || event.type !== "click") ) {
					matches = [];
					for ( i = 0; i < delegateCount; i++ ) {
						handleObj = handlers[ i ];

						// Don't conflict with Object.prototype properties (#13203)
						sel = handleObj.selector + " ";

						if ( matches[ sel ] === undefined ) {
							matches[ sel ] = handleObj.needsContext ?
								jQuery( sel, this ).index( cur ) >= 0 :
								jQuery.find( sel, this, null, [ cur ] ).length;
						}
						if ( matches[ sel ] ) {
							matches.push( handleObj );
						}
					}
					if ( matches.length ) {
						handlerQueue.push({ elem: cur, handlers: matches });
					}
				}
			}
		}

		// Add the remaining (directly-bound) handlers
		if ( delegateCount < handlers.length ) {
			handlerQueue.push({ elem: this, handlers: handlers.slice( delegateCount ) });
		}

		return handlerQueue;
	},

	fix: function( event ) {
		if ( event[ jQuery.expando ] ) {
			return event;
		}

		// Create a writable copy of the event object and normalize some properties
		var i, prop, copy,
			type = event.type,
			originalEvent = event,
			fixHook = this.fixHooks[ type ];

		if ( !fixHook ) {
			this.fixHooks[ type ] = fixHook =
				rmouseEvent.test( type ) ? this.mouseHooks :
				rkeyEvent.test( type ) ? this.keyHooks :
				{};
		}
		copy = fixHook.props ? this.props.concat( fixHook.props ) : this.props;

		event = new jQuery.Event( originalEvent );

		i = copy.length;
		while ( i-- ) {
			prop = copy[ i ];
			event[ prop ] = originalEvent[ prop ];
		}

		// Support: IE<9
		// Fix target property (#1925)
		if ( !event.target ) {
			event.target = originalEvent.srcElement || document;
		}

		// Support: Chrome 23+, Safari?
		// Target should not be a text node (#504, #13143)
		if ( event.target.nodeType === 3 ) {
			event.target = event.target.parentNode;
		}

		// Support: IE<9
		// For mouse/key events, metaKey==false if it's undefined (#3368, #11328)
		event.metaKey = !!event.metaKey;

		return fixHook.filter ? fixHook.filter( event, originalEvent ) : event;
	},

	// Includes some event props shared by KeyEvent and MouseEvent
	props: "altKey bubbles cancelable ctrlKey currentTarget eventPhase metaKey relatedTarget shiftKey target timeStamp view which".split(" "),

	fixHooks: {},

	keyHooks: {
		props: "char charCode key keyCode".split(" "),
		filter: function( event, original ) {

			// Add which for key events
			if ( event.which == null ) {
				event.which = original.charCode != null ? original.charCode : original.keyCode;
			}

			return event;
		}
	},

	mouseHooks: {
		props: "button buttons clientX clientY fromElement offsetX offsetY pageX pageY screenX screenY toElement".split(" "),
		filter: function( event, original ) {
			var body, eventDoc, doc,
				button = original.button,
				fromElement = original.fromElement;

			// Calculate pageX/Y if missing and clientX/Y available
			if ( event.pageX == null && original.clientX != null ) {
				eventDoc = event.target.ownerDocument || document;
				doc = eventDoc.documentElement;
				body = eventDoc.body;

				event.pageX = original.clientX + ( doc && doc.scrollLeft || body && body.scrollLeft || 0 ) - ( doc && doc.clientLeft || body && body.clientLeft || 0 );
				event.pageY = original.clientY + ( doc && doc.scrollTop  || body && body.scrollTop  || 0 ) - ( doc && doc.clientTop  || body && body.clientTop  || 0 );
			}

			// Add relatedTarget, if necessary
			if ( !event.relatedTarget && fromElement ) {
				event.relatedTarget = fromElement === event.target ? original.toElement : fromElement;
			}

			// Add which for click: 1 === left; 2 === middle; 3 === right
			// Note: button is not normalized, so don't use it
			if ( !event.which && button !== undefined ) {
				event.which = ( button & 1 ? 1 : ( button & 2 ? 3 : ( button & 4 ? 2 : 0 ) ) );
			}

			return event;
		}
	},

	special: {
		load: {
			// Prevent triggered image.load events from bubbling to window.load
			noBubble: true
		},
		click: {
			// For checkbox, fire native event so checked state will be right
			trigger: function() {
				if ( jQuery.nodeName( this, "input" ) && this.type === "checkbox" && this.click ) {
					this.click();
					return false;
				}
			}
		},
		focus: {
			// Fire native event if possible so blur/focus sequence is correct
			trigger: function() {
				if ( this !== document.activeElement && this.focus ) {
					try {
						this.focus();
						return false;
					} catch ( e ) {
						// Support: IE<9
						// If we error on focus to hidden element (#1486, #12518),
						// let .trigger() run the handlers
					}
				}
			},
			delegateType: "focusin"
		},
		blur: {
			trigger: function() {
				if ( this === document.activeElement && this.blur ) {
					this.blur();
					return false;
				}
			},
			delegateType: "focusout"
		},

		beforeunload: {
			postDispatch: function( event ) {

				// Even when returnValue equals to undefined Firefox will still show alert
				if ( event.result !== undefined ) {
					event.originalEvent.returnValue = event.result;
				}
			}
		}
	},

	simulate: function( type, elem, event, bubble ) {
		// Piggyback on a donor event to simulate a different one.
		// Fake originalEvent to avoid donor's stopPropagation, but if the
		// simulated event prevents default then we do the same on the donor.
		var e = jQuery.extend(
			new jQuery.Event(),
			event,
			{ type: type,
				isSimulated: true,
				originalEvent: {}
			}
		);
		if ( bubble ) {
			jQuery.event.trigger( e, null, elem );
		} else {
			jQuery.event.dispatch.call( elem, e );
		}
		if ( e.isDefaultPrevented() ) {
			event.preventDefault();
		}
	}
};

jQuery.removeEvent = document.removeEventListener ?
	function( elem, type, handle ) {
		if ( elem.removeEventListener ) {
			elem.removeEventListener( type, handle, false );
		}
	} :
	function( elem, type, handle ) {
		var name = "on" + type;

		if ( elem.detachEvent ) {

			// #8545, #7054, preventing memory leaks for custom events in IE6-8
			// detachEvent needed property on element, by name of that event, to properly expose it to GC
			if ( typeof elem[ name ] === core_strundefined ) {
				elem[ name ] = null;
			}

			elem.detachEvent( name, handle );
		}
	};

jQuery.Event = function( src, props ) {
	// Allow instantiation without the 'new' keyword
	if ( !(this instanceof jQuery.Event) ) {
		return new jQuery.Event( src, props );
	}

	// Event object
	if ( src && src.type ) {
		this.originalEvent = src;
		this.type = src.type;

		// Events bubbling up the document may have been marked as prevented
		// by a handler lower down the tree; reflect the correct value.
		this.isDefaultPrevented = ( src.defaultPrevented || src.returnValue === false ||
			src.getPreventDefault && src.getPreventDefault() ) ? returnTrue : returnFalse;

	// Event type
	} else {
		this.type = src;
	}

	// Put explicitly provided properties onto the event object
	if ( props ) {
		jQuery.extend( this, props );
	}

	// Create a timestamp if incoming event doesn't have one
	this.timeStamp = src && src.timeStamp || jQuery.now();

	// Mark it as fixed
	this[ jQuery.expando ] = true;
};

// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding
// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html
jQuery.Event.prototype = {
	isDefaultPrevented: returnFalse,
	isPropagationStopped: returnFalse,
	isImmediatePropagationStopped: returnFalse,

	preventDefault: function() {
		var e = this.originalEvent;

		this.isDefaultPrevented = returnTrue;
		if ( !e ) {
			return;
		}

		// If preventDefault exists, run it on the original event
		if ( e.preventDefault ) {
			e.preventDefault();

		// Support: IE
		// Otherwise set the returnValue property of the original event to false
		} else {
			e.returnValue = false;
		}
	},
	stopPropagation: function() {
		var e = this.originalEvent;

		this.isPropagationStopped = returnTrue;
		if ( !e ) {
			return;
		}
		// If stopPropagation exists, run it on the original event
		if ( e.stopPropagation ) {
			e.stopPropagation();
		}

		// Support: IE
		// Set the cancelBubble property of the original event to true
		e.cancelBubble = true;
	},
	stopImmediatePropagation: function() {
		this.isImmediatePropagationStopped = returnTrue;
		this.stopPropagation();
	}
};

// Create mouseenter/leave events using mouseover/out and event-time checks
jQuery.each({
	mouseenter: "mouseover",
	mouseleave: "mouseout"
}, function( orig, fix ) {
	jQuery.event.special[ orig ] = {
		delegateType: fix,
		bindType: fix,

		handle: function( event ) {
			var ret,
				target = this,
				related = event.relatedTarget,
				handleObj = event.handleObj;

			// For mousenter/leave call the handler if related is outside the target.
			// NB: No relatedTarget if the mouse left/entered the browser window
			if ( !related || (related !== target && !jQuery.contains( target, related )) ) {
				event.type = handleObj.origType;
				ret = handleObj.handler.apply( this, arguments );
				event.type = fix;
			}
			return ret;
		}
	};
});

// IE submit delegation
if ( !jQuery.support.submitBubbles ) {

	jQuery.event.special.submit = {
		setup: function() {
			// Only need this for delegated form submit events
			if ( jQuery.nodeName( this, "form" ) ) {
				return false;
			}

			// Lazy-add a submit handler when a descendant form may potentially be submitted
			jQuery.event.add( this, "click._submit keypress._submit", function( e ) {
				// Node name check avoids a VML-related crash in IE (#9807)
				var elem = e.target,
					form = jQuery.nodeName( elem, "input" ) || jQuery.nodeName( elem, "button" ) ? elem.form : undefined;
				if ( form && !jQuery._data( form, "submitBubbles" ) ) {
					jQuery.event.add( form, "submit._submit", function( event ) {
						event._submit_bubble = true;
					});
					jQuery._data( form, "submitBubbles", true );
				}
			});
			// return undefined since we don't need an event listener
		},

		postDispatch: function( event ) {
			// If form was submitted by the user, bubble the event up the tree
			if ( event._submit_bubble ) {
				delete event._submit_bubble;
				if ( this.parentNode && !event.isTrigger ) {
					jQuery.event.simulate( "submit", this.parentNode, event, true );
				}
			}
		},

		teardown: function() {
			// Only need this for delegated form submit events
			if ( jQuery.nodeName( this, "form" ) ) {
				return false;
			}

			// Remove delegated handlers; cleanData eventually reaps submit handlers attached above
			jQuery.event.remove( this, "._submit" );
		}
	};
}

// IE change delegation and checkbox/radio fix
if ( !jQuery.support.changeBubbles ) {

	jQuery.event.special.change = {

		setup: function() {

			if ( rformElems.test( this.nodeName ) ) {
				// IE doesn't fire change on a check/radio until blur; trigger it on click
				// after a propertychange. Eat the blur-change in special.change.handle.
				// This still fires onchange a second time for check/radio after blur.
				if ( this.type === "checkbox" || this.type === "radio" ) {
					jQuery.event.add( this, "propertychange._change", function( event ) {
						if ( event.originalEvent.propertyName === "checked" ) {
							this._just_changed = true;
						}
					});
					jQuery.event.add( this, "click._change", function( event ) {
						if ( this._just_changed && !event.isTrigger ) {
							this._just_changed = false;
						}
						// Allow triggered, simulated change events (#11500)
						jQuery.event.simulate( "change", this, event, true );
					});
				}
				return false;
			}
			// Delegated event; lazy-add a change handler on descendant inputs
			jQuery.event.add( this, "beforeactivate._change", function( e ) {
				var elem = e.target;

				if ( rformElems.test( elem.nodeName ) && !jQuery._data( elem, "changeBubbles" ) ) {
					jQuery.event.add( elem, "change._change", function( event ) {
						if ( this.parentNode && !event.isSimulated && !event.isTrigger ) {
							jQuery.event.simulate( "change", this.parentNode, event, true );
						}
					});
					jQuery._data( elem, "changeBubbles", true );
				}
			});
		},

		handle: function( event ) {
			var elem = event.target;

			// Swallow native change events from checkbox/radio, we already triggered them above
			if ( this !== elem || event.isSimulated || event.isTrigger || (elem.type !== "radio" && elem.type !== "checkbox") ) {
				return event.handleObj.handler.apply( this, arguments );
			}
		},

		teardown: function() {
			jQuery.event.remove( this, "._change" );

			return !rformElems.test( this.nodeName );
		}
	};
}

// Create "bubbling" focus and blur events
if ( !jQuery.support.focusinBubbles ) {
	jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) {

		// Attach a single capturing handler while someone wants focusin/focusout
		var attaches = 0,
			handler = function( event ) {
				jQuery.event.simulate( fix, event.target, jQuery.event.fix( event ), true );
			};

		jQuery.event.special[ fix ] = {
			setup: function() {
				if ( attaches++ === 0 ) {
					document.addEventListener( orig, handler, true );
				}
			},
			teardown: function() {
				if ( --attaches === 0 ) {
					document.removeEventListener( orig, handler, true );
				}
			}
		};
	});
}

jQuery.fn.extend({

	on: function( types, selector, data, fn, /*INTERNAL*/ one ) {
		var type, origFn;

		// Types can be a map of types/handlers
		if ( typeof types === "object" ) {
			// ( types-Object, selector, data )
			if ( typeof selector !== "string" ) {
				// ( types-Object, data )
				data = data || selector;
				selector = undefined;
			}
			for ( type in types ) {
				this.on( type, selector, data, types[ type ], one );
			}
			return this;
		}

		if ( data == null && fn == null ) {
			// ( types, fn )
			fn = selector;
			data = selector = undefined;
		} else if ( fn == null ) {
			if ( typeof selector === "string" ) {
				// ( types, selector, fn )
				fn = data;
				data = undefined;
			} else {
				// ( types, data, fn )
				fn = data;
				data = selector;
				selector = undefined;
			}
		}
		if ( fn === false ) {
			fn = returnFalse;
		} else if ( !fn ) {
			return this;
		}

		if ( one === 1 ) {
			origFn = fn;
			fn = function( event ) {
				// Can use an empty set, since event contains the info
				jQuery().off( event );
				return origFn.apply( this, arguments );
			};
			// Use same guid so caller can remove using origFn
			fn.guid = origFn.guid || ( origFn.guid = jQuery.guid++ );
		}
		return this.each( function() {
			jQuery.event.add( this, types, fn, data, selector );
		});
	},
	one: function( types, selector, data, fn ) {
		return this.on( types, selector, data, fn, 1 );
	},
	off: function( types, selector, fn ) {
		var handleObj, type;
		if ( types && types.preventDefault && types.handleObj ) {
			// ( event )  dispatched jQuery.Event
			handleObj = types.handleObj;
			jQuery( types.delegateTarget ).off(
				handleObj.namespace ? handleObj.origType + "." + handleObj.namespace : handleObj.origType,
				handleObj.selector,
				handleObj.handler
			);
			return this;
		}
		if ( typeof types === "object" ) {
			// ( types-object [, selector] )
			for ( type in types ) {
				this.off( type, selector, types[ type ] );
			}
			return this;
		}
		if ( selector === false || typeof selector === "function" ) {
			// ( types [, fn] )
			fn = selector;
			selector = undefined;
		}
		if ( fn === false ) {
			fn = returnFalse;
		}
		return this.each(function() {
			jQuery.event.remove( this, types, fn, selector );
		});
	},

	bind: function( types, data, fn ) {
		return this.on( types, null, data, fn );
	},
	unbind: function( types, fn ) {
		return this.off( types, null, fn );
	},

	delegate: function( selector, types, data, fn ) {
		return this.on( types, selector, data, fn );
	},
	undelegate: function( selector, types, fn ) {
		// ( namespace ) or ( selector, types [, fn] )
		return arguments.length === 1 ? this.off( selector, "**" ) : this.off( types, selector || "**", fn );
	},

	trigger: function( type, data ) {
		return this.each(function() {
			jQuery.event.trigger( type, data, this );
		});
	},
	triggerHandler: function( type, data ) {
		var elem = this[0];
		if ( elem ) {
			return jQuery.event.trigger( type, data, elem, true );
		}
	}
});
/*!
 * Sizzle CSS Selector Engine
 * Copyright 2012 jQuery Foundation and other contributors
 * Released under the MIT license
 * http://sizzlejs.com/
 */
(function( window, undefined ) {

var i,
	cachedruns,
	Expr,
	getText,
	isXML,
	compile,
	hasDuplicate,
	outermostContext,

	// Local document vars
	setDocument,
	document,
	docElem,
	documentIsXML,
	rbuggyQSA,
	rbuggyMatches,
	matches,
	contains,
	sortOrder,

	// Instance-specific data
	expando = "sizzle" + -(new Date()),
	preferredDoc = window.document,
	support = {},
	dirruns = 0,
	done = 0,
	classCache = createCache(),
	tokenCache = createCache(),
	compilerCache = createCache(),

	// General-purpose constants
	strundefined = typeof undefined,
	MAX_NEGATIVE = 1 << 31,

	// Array methods
	arr = [],
	pop = arr.pop,
	push = arr.push,
	slice = arr.slice,
	// Use a stripped-down indexOf if we can't use a native one
	indexOf = arr.indexOf || function( elem ) {
		var i = 0,
			len = this.length;
		for ( ; i < len; i++ ) {
			if ( this[i] === elem ) {
				return i;
			}
		}
		return -1;
	},


	// Regular expressions

	// Whitespace characters http://www.w3.org/TR/css3-selectors/#whitespace
	whitespace = "[\\x20\\t\\r\\n\\f]",
	// http://www.w3.org/TR/css3-syntax/#characters
	characterEncoding = "(?:\\\\.|[\\w-]|[^\\x00-\\xa0])+",

	// Loosely modeled on CSS identifier characters
	// An unquoted value should be a CSS identifier http://www.w3.org/TR/css3-selectors/#attribute-selectors
	// Proper syntax: http://www.w3.org/TR/CSS21/syndata.html#value-def-identifier
	identifier = characterEncoding.replace( "w", "w#" ),

	// Acceptable operators http://www.w3.org/TR/selectors/#attribute-selectors
	operators = "([*^$|!~]?=)",
	attributes = "\\[" + whitespace + "*(" + characterEncoding + ")" + whitespace +
		"*(?:" + operators + whitespace + "*(?:(['\"])((?:\\\\.|[^\\\\])*?)\\3|(" + identifier + ")|)|)" + whitespace + "*\\]",

	// Prefer arguments quoted,
	//   then not containing pseudos/brackets,
	//   then attribute selectors/non-parenthetical expressions,
	//   then anything else
	// These preferences are here to reduce the number of selectors
	//   needing tokenize in the PSEUDO preFilter
	pseudos = ":(" + characterEncoding + ")(?:\\(((['\"])((?:\\\\.|[^\\\\])*?)\\3|((?:\\\\.|[^\\\\()[\\]]|" + attributes.replace( 3, 8 ) + ")*)|.*)\\)|)",

	// Leading and non-escaped trailing whitespace, capturing some non-whitespace characters preceding the latter
	rtrim = new RegExp( "^" + whitespace + "+|((?:^|[^\\\\])(?:\\\\.)*)" + whitespace + "+$", "g" ),

	rcomma = new RegExp( "^" + whitespace + "*," + whitespace + "*" ),
	rcombinators = new RegExp( "^" + whitespace + "*([\\x20\\t\\r\\n\\f>+~])" + whitespace + "*" ),
	rpseudo = new RegExp( pseudos ),
	ridentifier = new RegExp( "^" + identifier + "$" ),

	matchExpr = {
		"ID": new RegExp( "^#(" + characterEncoding + ")" ),
		"CLASS": new RegExp( "^\\.(" + characterEncoding + ")" ),
		"NAME": new RegExp( "^\\[name=['\"]?(" + characterEncoding + ")['\"]?\\]" ),
		"TAG": new RegExp( "^(" + characterEncoding.replace( "w", "w*" ) + ")" ),
		"ATTR": new RegExp( "^" + attributes ),
		"PSEUDO": new RegExp( "^" + pseudos ),
		"CHILD": new RegExp( "^:(only|first|last|nth|nth-last)-(child|of-type)(?:\\(" + whitespace +
			"*(even|odd|(([+-]|)(\\d*)n|)" + whitespace + "*(?:([+-]|)" + whitespace +
			"*(\\d+)|))" + whitespace + "*\\)|)", "i" ),
		// For use in libraries implementing .is()
		// We use this for POS matching in `select`
		"needsContext": new RegExp( "^" + whitespace + "*[>+~]|:(even|odd|eq|gt|lt|nth|first|last)(?:\\(" +
			whitespace + "*((?:-\\d)?\\d*)" + whitespace + "*\\)|)(?=[^-]|$)", "i" )
	},

	rsibling = /[\x20\t\r\n\f]*[+~]/,

	rnative = /^[^{]+\{\s*\[native code/,

	// Easily-parseable/retrievable ID or TAG or CLASS selectors
	rquickExpr = /^(?:#([\w-]+)|(\w+)|\.([\w-]+))$/,

	rinputs = /^(?:input|select|textarea|button)$/i,
	rheader = /^h\d$/i,

	rescape = /'|\\/g,
	rattributeQuotes = /\=[\x20\t\r\n\f]*([^'"\]]*)[\x20\t\r\n\f]*\]/g,

	// CSS escapes http://www.w3.org/TR/CSS21/syndata.html#escaped-characters
	runescape = /\\([\da-fA-F]{1,6}[\x20\t\r\n\f]?|.)/g,
	funescape = function( _, escaped ) {
		var high = "0x" + escaped - 0x10000;
		// NaN means non-codepoint
		return high !== high ?
			escaped :
			// BMP codepoint
			high < 0 ?
				String.fromCharCode( high + 0x10000 ) :
				// Supplemental Plane codepoint (surrogate pair)
				String.fromCharCode( high >> 10 | 0xD800, high & 0x3FF | 0xDC00 );
	};

// Use a stripped-down slice if we can't use a native one
try {
	slice.call( preferredDoc.documentElement.childNodes, 0 )[0].nodeType;
} catch ( e ) {
	slice = function( i ) {
		var elem,
			results = [];
		while ( (elem = this[i++]) ) {
			results.push( elem );
		}
		return results;
	};
}

/**
 * For feature detection
 * @param {Function} fn The function to test for native support
 */
function isNative( fn ) {
	return rnative.test( fn + "" );
}

/**
 * Create key-value caches of limited size
 * @returns {Function(string, Object)} Returns the Object data after storing it on itself with
 *	property name the (space-suffixed) string and (if the cache is larger than Expr.cacheLength)
 *	deleting the oldest entry
 */
function createCache() {
	var cache,
		keys = [];

	return (cache = function( key, value ) {
		// Use (key + " ") to avoid collision with native prototype properties (see Issue #157)
		if ( keys.push( key += " " ) > Expr.cacheLength ) {
			// Only keep the most recent entries
			delete cache[ keys.shift() ];
		}
		return (cache[ key ] = value);
	});
}

/**
 * Mark a function for special use by Sizzle
 * @param {Function} fn The function to mark
 */
function markFunction( fn ) {
	fn[ expando ] = true;
	return fn;
}

/**
 * Support testing using an element
 * @param {Function} fn Passed the created div and expects a boolean result
 */
function assert( fn ) {
	var div = document.createElement("div");

	try {
		return fn( div );
	} catch (e) {
		return false;
	} finally {
		// release memory in IE
		div = null;
	}
}

function Sizzle( selector, context, results, seed ) {
	var match, elem, m, nodeType,
		// QSA vars
		i, groups, old, nid, newContext, newSelector;

	if ( ( context ? context.ownerDocument || context : preferredDoc ) !== document ) {
		setDocument( context );
	}

	context = context || document;
	results = results || [];

	if ( !selector || typeof selector !== "string" ) {
		return results;
	}

	if ( (nodeType = context.nodeType) !== 1 && nodeType !== 9 ) {
		return [];
	}

	if ( !documentIsXML && !seed ) {

		// Shortcuts
		if ( (match = rquickExpr.exec( selector )) ) {
			// Speed-up: Sizzle("#ID")
			if ( (m = match[1]) ) {
				if ( nodeType === 9 ) {
					elem = context.getElementById( m );
					// Check parentNode to catch when Blackberry 4.6 returns
					// nodes that are no longer in the document #6963
					if ( elem && elem.parentNode ) {
						// Handle the case where IE, Opera, and Webkit return items
						// by name instead of ID
						if ( elem.id === m ) {
							results.push( elem );
							return results;
						}
					} else {
						return results;
					}
				} else {
					// Context is not a document
					if ( context.ownerDocument && (elem = context.ownerDocument.getElementById( m )) &&
						contains( context, elem ) && elem.id === m ) {
						results.push( elem );
						return results;
					}
				}

			// Speed-up: Sizzle("TAG")
			} else if ( match[2] ) {
				push.apply( results, slice.call(context.getElementsByTagName( selector ), 0) );
				return results;

			// Speed-up: Sizzle(".CLASS")
			} else if ( (m = match[3]) && support.getByClassName && context.getElementsByClassName ) {
				push.apply( results, slice.call(context.getElementsByClassName( m ), 0) );
				return results;
			}
		}

		// QSA path
		if ( support.qsa && !rbuggyQSA.test(selector) ) {
			old = true;
			nid = expando;
			newContext = context;
			newSelector = nodeType === 9 && selector;

			// qSA works strangely on Element-rooted queries
			// We can work around this by specifying an extra ID on the root
			// and working up from there (Thanks to Andrew Dupont for the technique)
			// IE 8 doesn't work on object elements
			if ( nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) {
				groups = tokenize( selector );

				if ( (old = context.getAttribute("id")) ) {
					nid = old.replace( rescape, "\\$&" );
				} else {
					context.setAttribute( "id", nid );
				}
				nid = "[id='" + nid + "'] ";

				i = groups.length;
				while ( i-- ) {
					groups[i] = nid + toSelector( groups[i] );
				}
				newContext = rsibling.test( selector ) && context.parentNode || context;
				newSelector = groups.join(",");
			}

			if ( newSelector ) {
				try {
					push.apply( results, slice.call( newContext.querySelectorAll(
						newSelector
					), 0 ) );
					return results;
				} catch(qsaError) {
				} finally {
					if ( !old ) {
						context.removeAttribute("id");
					}
				}
			}
		}
	}

	// All others
	return select( selector.replace( rtrim, "$1" ), context, results, seed );
}

/**
 * Detect xml
 * @param {Element|Object} elem An element or a document
 */
isXML = Sizzle.isXML = function( elem ) {
	// documentElement is verified for cases where it doesn't yet exist
	// (such as loading iframes in IE - #4833)
	var documentElement = elem && (elem.ownerDocument || elem).documentElement;
	return documentElement ? documentElement.nodeName !== "HTML" : false;
};

/**
 * Sets document-related variables once based on the current document
 * @param {Element|Object} [doc] An element or document object to use to set the document
 * @returns {Object} Returns the current document
 */
setDocument = Sizzle.setDocument = function( node ) {
	var doc = node ? node.ownerDocument || node : preferredDoc;

	// If no document and documentElement is available, return
	if ( doc === document || doc.nodeType !== 9 || !doc.documentElement ) {
		return document;
	}

	// Set our document
	document = doc;
	docElem = doc.documentElement;

	// Support tests
	documentIsXML = isXML( doc );

	// Check if getElementsByTagName("*") returns only elements
	support.tagNameNoComments = assert(function( div ) {
		div.appendChild( doc.createComment("") );
		return !div.getElementsByTagName("*").length;
	});

	// Check if attributes should be retrieved by attribute nodes
	support.attributes = assert(function( div ) {
		div.innerHTML = "<select></select>";
		var type = typeof div.lastChild.getAttribute("multiple");
		// IE8 returns a string for some attributes even when not present
		return type !== "boolean" && type !== "string";
	});

	// Check if getElementsByClassName can be trusted
	support.getByClassName = assert(function( div ) {
		// Opera can't find a second classname (in 9.6)
		div.innerHTML = "<div class='hidden e'></div><div class='hidden'></div>";
		if ( !div.getElementsByClassName || !div.getElementsByClassName("e").length ) {
			return false;
		}

		// Safari 3.2 caches class attributes and doesn't catch changes
		div.lastChild.className = "e";
		return div.getElementsByClassName("e").length === 2;
	});

	// Check if getElementById returns elements by name
	// Check if getElementsByName privileges form controls or returns elements by ID
	support.getByName = assert(function( div ) {
		// Inject content
		div.id = expando + 0;
		div.innerHTML = "<a name='" + expando + "'></a><div name='" + expando + "'></div>";
		docElem.insertBefore( div, docElem.firstChild );

		// Test
		var pass = doc.getElementsByName &&
			// buggy browsers will return fewer than the correct 2
			doc.getElementsByName( expando ).length === 2 +
			// buggy browsers will return more than the correct 0
			doc.getElementsByName( expando + 0 ).length;
		support.getIdNotName = !doc.getElementById( expando );

		// Cleanup
		docElem.removeChild( div );

		return pass;
	});

	// IE6/7 return modified attributes
	Expr.attrHandle = assert(function( div ) {
		div.innerHTML = "<a href='#'></a>";
		return div.firstChild && typeof div.firstChild.getAttribute !== strundefined &&
			div.firstChild.getAttribute("href") === "#";
	}) ?
		{} :
		{
			"href": function( elem ) {
				return elem.getAttribute( "href", 2 );
			},
			"type": function( elem ) {
				return elem.getAttribute("type");
			}
		};

	// ID find and filter
	if ( support.getIdNotName ) {
		Expr.find["ID"] = function( id, context ) {
			if ( typeof context.getElementById !== strundefined && !documentIsXML ) {
				var m = context.getElementById( id );
				// Check parentNode to catch when Blackberry 4.6 returns
				// nodes that are no longer in the document #6963
				return m && m.parentNode ? [m] : [];
			}
		};
		Expr.filter["ID"] = function( id ) {
			var attrId = id.replace( runescape, funescape );
			return function( elem ) {
				return elem.getAttribute("id") === attrId;
			};
		};
	} else {
		Expr.find["ID"] = function( id, context ) {
			if ( typeof context.getElementById !== strundefined && !documentIsXML ) {
				var m = context.getElementById( id );

				return m ?
					m.id === id || typeof m.getAttributeNode !== strundefined && m.getAttributeNode("id").value === id ?
						[m] :
						undefined :
					[];
			}
		};
		Expr.filter["ID"] =  function( id ) {
			var attrId = id.replace( runescape, funescape );
			return function( elem ) {
				var node = typeof elem.getAttributeNode !== strundefined && elem.getAttributeNode("id");
				return node && node.value === attrId;
			};
		};
	}

	// Tag
	Expr.find["TAG"] = support.tagNameNoComments ?
		function( tag, context ) {
			if ( typeof context.getElementsByTagName !== strundefined ) {
				return context.getElementsByTagName( tag );
			}
		} :
		function( tag, context ) {
			var elem,
				tmp = [],
				i = 0,
				results = context.getElementsByTagName( tag );

			// Filter out possible comments
			if ( tag === "*" ) {
				while ( (elem = results[i++]) ) {
					if ( elem.nodeType === 1 ) {
						tmp.push( elem );
					}
				}

				return tmp;
			}
			return results;
		};

	// Name
	Expr.find["NAME"] = support.getByName && function( tag, context ) {
		if ( typeof context.getElementsByName !== strundefined ) {
			return context.getElementsByName( name );
		}
	};

	// Class
	Expr.find["CLASS"] = support.getByClassName && function( className, context ) {
		if ( typeof context.getElementsByClassName !== strundefined && !documentIsXML ) {
			return context.getElementsByClassName( className );
		}
	};

	// QSA and matchesSelector support

	// matchesSelector(:active) reports false when true (IE9/Opera 11.5)
	rbuggyMatches = [];

	// qSa(:focus) reports false when true (Chrome 21),
	// no need to also add to buggyMatches since matches checks buggyQSA
	// A support test would require too much code (would include document ready)
	rbuggyQSA = [ ":focus" ];

	if ( (support.qsa = isNative(doc.querySelectorAll)) ) {
		// Build QSA regex
		// Regex strategy adopted from Diego Perini
		assert(function( div ) {
			// Select is set to empty string on purpose
			// This is to test IE's treatment of not explictly
			// setting a boolean content attribute,
			// since its presence should be enough
			// http://bugs.jquery.com/ticket/12359
			div.innerHTML = "<select><option selected=''></option></select>";

			// IE8 - Some boolean attributes are not treated correctly
			if ( !div.querySelectorAll("[selected]").length ) {
				rbuggyQSA.push( "\\[" + whitespace + "*(?:checked|disabled|ismap|multiple|readonly|selected|value)" );
			}

			// Webkit/Opera - :checked should return selected option elements
			// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked
			// IE8 throws error here and will not see later tests
			if ( !div.querySelectorAll(":checked").length ) {
				rbuggyQSA.push(":checked");
			}
		});

		assert(function( div ) {

			// Opera 10-12/IE8 - ^= $= *= and empty values
			// Should not select anything
			div.innerHTML = "<input type='hidden' i=''/>";
			if ( div.querySelectorAll("[i^='']").length ) {
				rbuggyQSA.push( "[*^$]=" + whitespace + "*(?:\"\"|'')" );
			}

			// FF 3.5 - :enabled/:disabled and hidden elements (hidden elements are still enabled)
			// IE8 throws error here and will not see later tests
			if ( !div.querySelectorAll(":enabled").length ) {
				rbuggyQSA.push( ":enabled", ":disabled" );
			}

			// Opera 10-11 does not throw on post-comma invalid pseudos
			div.querySelectorAll("*,:x");
			rbuggyQSA.push(",.*:");
		});
	}

	if ( (support.matchesSelector = isNative( (matches = docElem.matchesSelector ||
		docElem.mozMatchesSelector ||
		docElem.webkitMatchesSelector ||
		docElem.oMatchesSelector ||
		docElem.msMatchesSelector) )) ) {

		assert(function( div ) {
			// Check to see if it's possible to do matchesSelector
			// on a disconnected node (IE 9)
			support.disconnectedMatch = matches.call( div, "div" );

			// This should fail with an exception
			// Gecko does not error, returns false instead
			matches.call( div, "[s!='']:x" );
			rbuggyMatches.push( "!=", pseudos );
		});
	}

	rbuggyQSA = new RegExp( rbuggyQSA.join("|") );
	rbuggyMatches = new RegExp( rbuggyMatches.join("|") );

	// Element contains another
	// Purposefully does not implement inclusive descendent
	// As in, an element does not contain itself
	contains = isNative(docElem.contains) || docElem.compareDocumentPosition ?
		function( a, b ) {
			var adown = a.nodeType === 9 ? a.documentElement : a,
				bup = b && b.parentNode;
			return a === bup || !!( bup && bup.nodeType === 1 && (
				adown.contains ?
					adown.contains( bup ) :
					a.compareDocumentPosition && a.compareDocumentPosition( bup ) & 16
			));
		} :
		function( a, b ) {
			if ( b ) {
				while ( (b = b.parentNode) ) {
					if ( b === a ) {
						return true;
					}
				}
			}
			return false;
		};

	// Document order sorting
	sortOrder = docElem.compareDocumentPosition ?
	function( a, b ) {
		var compare;

		if ( a === b ) {
			hasDuplicate = true;
			return 0;
		}

		if ( (compare = b.compareDocumentPosition && a.compareDocumentPosition && a.compareDocumentPosition( b )) ) {
			if ( compare & 1 || a.parentNode && a.parentNode.nodeType === 11 ) {
				if ( a === doc || contains( preferredDoc, a ) ) {
					return -1;
				}
				if ( b === doc || contains( preferredDoc, b ) ) {
					return 1;
				}
				return 0;
			}
			return compare & 4 ? -1 : 1;
		}

		return a.compareDocumentPosition ? -1 : 1;
	} :
	function( a, b ) {
		var cur,
			i = 0,
			aup = a.parentNode,
			bup = b.parentNode,
			ap = [ a ],
			bp = [ b ];

		// Exit early if the nodes are identical
		if ( a === b ) {
			hasDuplicate = true;
			return 0;

		// Parentless nodes are either documents or disconnected
		} else if ( !aup || !bup ) {
			return a === doc ? -1 :
				b === doc ? 1 :
				aup ? -1 :
				bup ? 1 :
				0;

		// If the nodes are siblings, we can do a quick check
		} else if ( aup === bup ) {
			return siblingCheck( a, b );
		}

		// Otherwise we need full lists of their ancestors for comparison
		cur = a;
		while ( (cur = cur.parentNode) ) {
			ap.unshift( cur );
		}
		cur = b;
		while ( (cur = cur.parentNode) ) {
			bp.unshift( cur );
		}

		// Walk down the tree looking for a discrepancy
		while ( ap[i] === bp[i] ) {
			i++;
		}

		return i ?
			// Do a sibling check if the nodes have a common ancestor
			siblingCheck( ap[i], bp[i] ) :

			// Otherwise nodes in our document sort first
			ap[i] === preferredDoc ? -1 :
			bp[i] === preferredDoc ? 1 :
			0;
	};

	// Always assume the presence of duplicates if sort doesn't
	// pass them to our comparison function (as in Google Chrome).
	hasDuplicate = false;
	[0, 0].sort( sortOrder );
	support.detectDuplicates = hasDuplicate;

	return document;
};

Sizzle.matches = function( expr, elements ) {
	return Sizzle( expr, null, null, elements );
};

Sizzle.matchesSelector = function( elem, expr ) {
	// Set document vars if needed
	if ( ( elem.ownerDocument || elem ) !== document ) {
		setDocument( elem );
	}

	// Make sure that attribute selectors are quoted
	expr = expr.replace( rattributeQuotes, "='$1']" );

	// rbuggyQSA always contains :focus, so no need for an existence check
	if ( support.matchesSelector && !documentIsXML && (!rbuggyMatches || !rbuggyMatches.test(expr)) && !rbuggyQSA.test(expr) ) {
		try {
			var ret = matches.call( elem, expr );

			// IE 9's matchesSelector returns false on disconnected nodes
			if ( ret || support.disconnectedMatch ||
					// As well, disconnected nodes are said to be in a document
					// fragment in IE 9
					elem.document && elem.document.nodeType !== 11 ) {
				return ret;
			}
		} catch(e) {}
	}

	return Sizzle( expr, document, null, [elem] ).length > 0;
};

Sizzle.contains = function( context, elem ) {
	// Set document vars if needed
	if ( ( context.ownerDocument || context ) !== document ) {
		setDocument( context );
	}
	return contains( context, elem );
};

Sizzle.attr = function( elem, name ) {
	var val;

	// Set document vars if needed
	if ( ( elem.ownerDocument || elem ) !== document ) {
		setDocument( elem );
	}

	if ( !documentIsXML ) {
		name = name.toLowerCase();
	}
	if ( (val = Expr.attrHandle[ name ]) ) {
		return val( elem );
	}
	if ( documentIsXML || support.attributes ) {
		return elem.getAttribute( name );
	}
	return ( (val = elem.getAttributeNode( name )) || elem.getAttribute( name ) ) && elem[ name ] === true ?
		name :
		val && val.specified ? val.value : null;
};

Sizzle.error = function( msg ) {
	throw new Error( "Syntax error, unrecognized expression: " + msg );
};

// Document sorting and removing duplicates
Sizzle.uniqueSort = function( results ) {
	var elem,
		duplicates = [],
		i = 1,
		j = 0;

	// Unless we *know* we can detect duplicates, assume their presence
	hasDuplicate = !support.detectDuplicates;
	results.sort( sortOrder );

	if ( hasDuplicate ) {
		for ( ; (elem = results[i]); i++ ) {
			if ( elem === results[ i - 1 ] ) {
				j = duplicates.push( i );
			}
		}
		while ( j-- ) {
			results.splice( duplicates[ j ], 1 );
		}
	}

	return results;
};

function siblingCheck( a, b ) {
	var cur = b && a,
		diff = cur && ( ~b.sourceIndex || MAX_NEGATIVE ) - ( ~a.sourceIndex || MAX_NEGATIVE );

	// Use IE sourceIndex if available on both nodes
	if ( diff ) {
		return diff;
	}

	// Check if b follows a
	if ( cur ) {
		while ( (cur = cur.nextSibling) ) {
			if ( cur === b ) {
				return -1;
			}
		}
	}

	return a ? 1 : -1;
}

// Returns a function to use in pseudos for input types
function createInputPseudo( type ) {
	return function( elem ) {
		var name = elem.nodeName.toLowerCase();
		return name === "input" && elem.type === type;
	};
}

// Returns a function to use in pseudos for buttons
function createButtonPseudo( type ) {
	return function( elem ) {
		var name = elem.nodeName.toLowerCase();
		return (name === "input" || name === "button") && elem.type === type;
	};
}

// Returns a function to use in pseudos for positionals
function createPositionalPseudo( fn ) {
	return markFunction(function( argument ) {
		argument = +argument;
		return markFunction(function( seed, matches ) {
			var j,
				matchIndexes = fn( [], seed.length, argument ),
				i = matchIndexes.length;

			// Match elements found at the specified indexes
			while ( i-- ) {
				if ( seed[ (j = matchIndexes[i]) ] ) {
					seed[j] = !(matches[j] = seed[j]);
				}
			}
		});
	});
}

/**
 * Utility function for retrieving the text value of an array of DOM nodes
 * @param {Array|Element} elem
 */
getText = Sizzle.getText = function( elem ) {
	var node,
		ret = "",
		i = 0,
		nodeType = elem.nodeType;

	if ( !nodeType ) {
		// If no nodeType, this is expected to be an array
		for ( ; (node = elem[i]); i++ ) {
			// Do not traverse comment nodes
			ret += getText( node );
		}
	} else if ( nodeType === 1 || nodeType === 9 || nodeType === 11 ) {
		// Use textContent for elements
		// innerText usage removed for consistency of new lines (see #11153)
		if ( typeof elem.textContent === "string" ) {
			return elem.textContent;
		} else {
			// Traverse its children
			for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) {
				ret += getText( elem );
			}
		}
	} else if ( nodeType === 3 || nodeType === 4 ) {
		return elem.nodeValue;
	}
	// Do not include comment or processing instruction nodes

	return ret;
};

Expr = Sizzle.selectors = {

	// Can be adjusted by the user
	cacheLength: 50,

	createPseudo: markFunction,

	match: matchExpr,

	find: {},

	relative: {
		">": { dir: "parentNode", first: true },
		" ": { dir: "parentNode" },
		"+": { dir: "previousSibling", first: true },
		"~": { dir: "previousSibling" }
	},

	preFilter: {
		"ATTR": function( match ) {
			match[1] = match[1].replace( runescape, funescape );

			// Move the given value to match[3] whether quoted or unquoted
			match[3] = ( match[4] || match[5] || "" ).replace( runescape, funescape );

			if ( match[2] === "~=" ) {
				match[3] = " " + match[3] + " ";
			}

			return match.slice( 0, 4 );
		},

		"CHILD": function( match ) {
			/* matches from matchExpr["CHILD"]
				1 type (only|nth|...)
				2 what (child|of-type)
				3 argument (even|odd|\d*|\d*n([+-]\d+)?|...)
				4 xn-component of xn+y argument ([+-]?\d*n|)
				5 sign of xn-component
				6 x of xn-component
				7 sign of y-component
				8 y of y-component
			*/
			match[1] = match[1].toLowerCase();

			if ( match[1].slice( 0, 3 ) === "nth" ) {
				// nth-* requires argument
				if ( !match[3] ) {
					Sizzle.error( match[0] );
				}

				// numeric x and y parameters for Expr.filter.CHILD
				// remember that false/true cast respectively to 0/1
				match[4] = +( match[4] ? match[5] + (match[6] || 1) : 2 * ( match[3] === "even" || match[3] === "odd" ) );
				match[5] = +( ( match[7] + match[8] ) || match[3] === "odd" );

			// other types prohibit arguments
			} else if ( match[3] ) {
				Sizzle.error( match[0] );
			}

			return match;
		},

		"PSEUDO": function( match ) {
			var excess,
				unquoted = !match[5] && match[2];

			if ( matchExpr["CHILD"].test( match[0] ) ) {
				return null;
			}

			// Accept quoted arguments as-is
			if ( match[4] ) {
				match[2] = match[4];

			// Strip excess characters from unquoted arguments
			} else if ( unquoted && rpseudo.test( unquoted ) &&
				// Get excess from tokenize (recursively)
				(excess = tokenize( unquoted, true )) &&
				// advance to the next closing parenthesis
				(excess = unquoted.indexOf( ")", unquoted.length - excess ) - unquoted.length) ) {

				// excess is a negative index
				match[0] = match[0].slice( 0, excess );
				match[2] = unquoted.slice( 0, excess );
			}

			// Return only captures needed by the pseudo filter method (type and argument)
			return match.slice( 0, 3 );
		}
	},

	filter: {

		"TAG": function( nodeName ) {
			if ( nodeName === "*" ) {
				return function() { return true; };
			}

			nodeName = nodeName.replace( runescape, funescape ).toLowerCase();
			return function( elem ) {
				return elem.nodeName && elem.nodeName.toLowerCase() === nodeName;
			};
		},

		"CLASS": function( className ) {
			var pattern = classCache[ className + " " ];

			return pattern ||
				(pattern = new RegExp( "(^|" + whitespace + ")" + className + "(" + whitespace + "|$)" )) &&
				classCache( className, function( elem ) {
					return pattern.test( elem.className || (typeof elem.getAttribute !== strundefined && elem.getAttribute("class")) || "" );
				});
		},

		"ATTR": function( name, operator, check ) {
			return function( elem ) {
				var result = Sizzle.attr( elem, name );

				if ( result == null ) {
					return operator === "!=";
				}
				if ( !operator ) {
					return true;
				}

				result += "";

				return operator === "=" ? result === check :
					operator === "!=" ? result !== check :
					operator === "^=" ? check && result.indexOf( check ) === 0 :
					operator === "*=" ? check && result.indexOf( check ) > -1 :
					operator === "$=" ? check && result.slice( -check.length ) === check :
					operator === "~=" ? ( " " + result + " " ).indexOf( check ) > -1 :
					operator === "|=" ? result === check || result.slice( 0, check.length + 1 ) === check + "-" :
					false;
			};
		},

		"CHILD": function( type, what, argument, first, last ) {
			var simple = type.slice( 0, 3 ) !== "nth",
				forward = type.slice( -4 ) !== "last",
				ofType = what === "of-type";

			return first === 1 && last === 0 ?

				// Shortcut for :nth-*(n)
				function( elem ) {
					return !!elem.parentNode;
				} :

				function( elem, context, xml ) {
					var cache, outerCache, node, diff, nodeIndex, start,
						dir = simple !== forward ? "nextSibling" : "previousSibling",
						parent = elem.parentNode,
						name = ofType && elem.nodeName.toLowerCase(),
						useCache = !xml && !ofType;

					if ( parent ) {

						// :(first|last|only)-(child|of-type)
						if ( simple ) {
							while ( dir ) {
								node = elem;
								while ( (node = node[ dir ]) ) {
									if ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) {
										return false;
									}
								}
								// Reverse direction for :only-* (if we haven't yet done so)
								start = dir = type === "only" && !start && "nextSibling";
							}
							return true;
						}

						start = [ forward ? parent.firstChild : parent.lastChild ];

						// non-xml :nth-child(...) stores cache data on `parent`
						if ( forward && useCache ) {
							// Seek `elem` from a previously-cached index
							outerCache = parent[ expando ] || (parent[ expando ] = {});
							cache = outerCache[ type ] || [];
							nodeIndex = cache[0] === dirruns && cache[1];
							diff = cache[0] === dirruns && cache[2];
							node = nodeIndex && parent.childNodes[ nodeIndex ];

							while ( (node = ++nodeIndex && node && node[ dir ] ||

								// Fallback to seeking `elem` from the start
								(diff = nodeIndex = 0) || start.pop()) ) {

								// When found, cache indexes on `parent` and break
								if ( node.nodeType === 1 && ++diff && node === elem ) {
									outerCache[ type ] = [ dirruns, nodeIndex, diff ];
									break;
								}
							}

						// Use previously-cached element index if available
						} else if ( useCache && (cache = (elem[ expando ] || (elem[ expando ] = {}))[ type ]) && cache[0] === dirruns ) {
							diff = cache[1];

						// xml :nth-child(...) or :nth-last-child(...) or :nth(-last)?-of-type(...)
						} else {
							// Use the same loop as above to seek `elem` from the start
							while ( (node = ++nodeIndex && node && node[ dir ] ||
								(diff = nodeIndex = 0) || start.pop()) ) {

								if ( ( ofType ? node.nodeName.toLowerCase() === name : node.nodeType === 1 ) && ++diff ) {
									// Cache the index of each encountered element
									if ( useCache ) {
										(node[ expando ] || (node[ expando ] = {}))[ type ] = [ dirruns, diff ];
									}

									if ( node === elem ) {
										break;
									}
								}
							}
						}

						// Incorporate the offset, then check against cycle size
						diff -= last;
						return diff === first || ( diff % first === 0 && diff / first >= 0 );
					}
				};
		},

		"PSEUDO": function( pseudo, argument ) {
			// pseudo-class names are case-insensitive
			// http://www.w3.org/TR/selectors/#pseudo-classes
			// Prioritize by case sensitivity in case custom pseudos are added with uppercase letters
			// Remember that setFilters inherits from pseudos
			var args,
				fn = Expr.pseudos[ pseudo ] || Expr.setFilters[ pseudo.toLowerCase() ] ||
					Sizzle.error( "unsupported pseudo: " + pseudo );

			// The user may use createPseudo to indicate that
			// arguments are needed to create the filter function
			// just as Sizzle does
			if ( fn[ expando ] ) {
				return fn( argument );
			}

			// But maintain support for old signatures
			if ( fn.length > 1 ) {
				args = [ pseudo, pseudo, "", argument ];
				return Expr.setFilters.hasOwnProperty( pseudo.toLowerCase() ) ?
					markFunction(function( seed, matches ) {
						var idx,
							matched = fn( seed, argument ),
							i = matched.length;
						while ( i-- ) {
							idx = indexOf.call( seed, matched[i] );
							seed[ idx ] = !( matches[ idx ] = matched[i] );
						}
					}) :
					function( elem ) {
						return fn( elem, 0, args );
					};
			}

			return fn;
		}
	},

	pseudos: {
		// Potentially complex pseudos
		"not": markFunction(function( selector ) {
			// Trim the selector passed to compile
			// to avoid treating leading and trailing
			// spaces as combinators
			var input = [],
				results = [],
				matcher = compile( selector.replace( rtrim, "$1" ) );

			return matcher[ expando ] ?
				markFunction(function( seed, matches, context, xml ) {
					var elem,
						unmatched = matcher( seed, null, xml, [] ),
						i = seed.length;

					// Match elements unmatched by `matcher`
					while ( i-- ) {
						if ( (elem = unmatched[i]) ) {
							seed[i] = !(matches[i] = elem);
						}
					}
				}) :
				function( elem, context, xml ) {
					input[0] = elem;
					matcher( input, null, xml, results );
					return !results.pop();
				};
		}),

		"has": markFunction(function( selector ) {
			return function( elem ) {
				return Sizzle( selector, elem ).length > 0;
			};
		}),

		"contains": markFunction(function( text ) {
			return function( elem ) {
				return ( elem.textContent || elem.innerText || getText( elem ) ).indexOf( text ) > -1;
			};
		}),

		// "Whether an element is represented by a :lang() selector
		// is based solely on the element's language value
		// being equal to the identifier C,
		// or beginning with the identifier C immediately followed by "-".
		// The matching of C against the element's language value is performed case-insensitively.
		// The identifier C does not have to be a valid language name."
		// http://www.w3.org/TR/selectors/#lang-pseudo
		"lang": markFunction( function( lang ) {
			// lang value must be a valid identifider
			if ( !ridentifier.test(lang || "") ) {
				Sizzle.error( "unsupported lang: " + lang );
			}
			lang = lang.replace( runescape, funescape ).toLowerCase();
			return function( elem ) {
				var elemLang;
				do {
					if ( (elemLang = documentIsXML ?
						elem.getAttribute("xml:lang") || elem.getAttribute("lang") :
						elem.lang) ) {

						elemLang = elemLang.toLowerCase();
						return elemLang === lang || elemLang.indexOf( lang + "-" ) === 0;
					}
				} while ( (elem = elem.parentNode) && elem.nodeType === 1 );
				return false;
			};
		}),

		// Miscellaneous
		"target": function( elem ) {
			var hash = window.location && window.location.hash;
			return hash && hash.slice( 1 ) === elem.id;
		},

		"root": function( elem ) {
			return elem === docElem;
		},

		"focus": function( elem ) {
			return elem === document.activeElement && (!document.hasFocus || document.hasFocus()) && !!(elem.type || elem.href || ~elem.tabIndex);
		},

		// Boolean properties
		"enabled": function( elem ) {
			return elem.disabled === false;
		},

		"disabled": function( elem ) {
			return elem.disabled === true;
		},

		"checked": function( elem ) {
			// In CSS3, :checked should return both checked and selected elements
			// http://www.w3.org/TR/2011/REC-css3-selectors-20110929/#checked
			var nodeName = elem.nodeName.toLowerCase();
			return (nodeName === "input" && !!elem.checked) || (nodeName === "option" && !!elem.selected);
		},

		"selected": function( elem ) {
			// Accessing this property makes selected-by-default
			// options in Safari work properly
			if ( elem.parentNode ) {
				elem.parentNode.selectedIndex;
			}

			return elem.selected === true;
		},

		// Contents
		"empty": function( elem ) {
			// http://www.w3.org/TR/selectors/#empty-pseudo
			// :empty is only affected by element nodes and content nodes(including text(3), cdata(4)),
			//   not comment, processing instructions, or others
			// Thanks to Diego Perini for the nodeName shortcut
			//   Greater than "@" means alpha characters (specifically not starting with "#" or "?")
			for ( elem = elem.firstChild; elem; elem = elem.nextSibling ) {
				if ( elem.nodeName > "@" || elem.nodeType === 3 || elem.nodeType === 4 ) {
					return false;
				}
			}
			return true;
		},

		"parent": function( elem ) {
			return !Expr.pseudos["empty"]( elem );
		},

		// Element/input types
		"header": function( elem ) {
			return rheader.test( elem.nodeName );
		},

		"input": function( elem ) {
			return rinputs.test( elem.nodeName );
		},

		"button": function( elem ) {
			var name = elem.nodeName.toLowerCase();
			return name === "input" && elem.type === "button" || name === "button";
		},

		"text": function( elem ) {
			var attr;
			// IE6 and 7 will map elem.type to 'text' for new HTML5 types (search, etc)
			// use getAttribute instead to test this case
			return elem.nodeName.toLowerCase() === "input" &&
				elem.type === "text" &&
				( (attr = elem.getAttribute("type")) == null || attr.toLowerCase() === elem.type );
		},

		// Position-in-collection
		"first": createPositionalPseudo(function() {
			return [ 0 ];
		}),

		"last": createPositionalPseudo(function( matchIndexes, length ) {
			return [ length - 1 ];
		}),

		"eq": createPositionalPseudo(function( matchIndexes, length, argument ) {
			return [ argument < 0 ? argument + length : argument ];
		}),

		"even": createPositionalPseudo(function( matchIndexes, length ) {
			var i = 0;
			for ( ; i < length; i += 2 ) {
				matchIndexes.push( i );
			}
			return matchIndexes;
		}),

		"odd": createPositionalPseudo(function( matchIndexes, length ) {
			var i = 1;
			for ( ; i < length; i += 2 ) {
				matchIndexes.push( i );
			}
			return matchIndexes;
		}),

		"lt": createPositionalPseudo(function( matchIndexes, length, argument ) {
			var i = argument < 0 ? argument + length : argument;
			for ( ; --i >= 0; ) {
				matchIndexes.push( i );
			}
			return matchIndexes;
		}),

		"gt": createPositionalPseudo(function( matchIndexes, length, argument ) {
			var i = argument < 0 ? argument + length : argument;
			for ( ; ++i < length; ) {
				matchIndexes.push( i );
			}
			return matchIndexes;
		})
	}
};

// Add button/input type pseudos
for ( i in { radio: true, checkbox: true, file: true, password: true, image: true } ) {
	Expr.pseudos[ i ] = createInputPseudo( i );
}
for ( i in { submit: true, reset: true } ) {
	Expr.pseudos[ i ] = createButtonPseudo( i );
}

function tokenize( selector, parseOnly ) {
	var matched, match, tokens, type,
		soFar, groups, preFilters,
		cached = tokenCache[ selector + " " ];

	if ( cached ) {
		return parseOnly ? 0 : cached.slice( 0 );
	}

	soFar = selector;
	groups = [];
	preFilters = Expr.preFilter;

	while ( soFar ) {

		// Comma and first run
		if ( !matched || (match = rcomma.exec( soFar )) ) {
			if ( match ) {
				// Don't consume trailing commas as valid
				soFar = soFar.slice( match[0].length ) || soFar;
			}
			groups.push( tokens = [] );
		}

		matched = false;

		// Combinators
		if ( (match = rcombinators.exec( soFar )) ) {
			matched = match.shift();
			tokens.push( {
				value: matched,
				// Cast descendant combinators to space
				type: match[0].replace( rtrim, " " )
			} );
			soFar = soFar.slice( matched.length );
		}

		// Filters
		for ( type in Expr.filter ) {
			if ( (match = matchExpr[ type ].exec( soFar )) && (!preFilters[ type ] ||
				(match = preFilters[ type ]( match ))) ) {
				matched = match.shift();
				tokens.push( {
					value: matched,
					type: type,
					matches: match
				} );
				soFar = soFar.slice( matched.length );
			}
		}

		if ( !matched ) {
			break;
		}
	}

	// Return the length of the invalid excess
	// if we're just parsing
	// Otherwise, throw an error or return tokens
	return parseOnly ?
		soFar.length :
		soFar ?
			Sizzle.error( selector ) :
			// Cache the tokens
			tokenCache( selector, groups ).slice( 0 );
}

function toSelector( tokens ) {
	var i = 0,
		len = tokens.length,
		selector = "";
	for ( ; i < len; i++ ) {
		selector += tokens[i].value;
	}
	return selector;
}

function addCombinator( matcher, combinator, base ) {
	var dir = combinator.dir,
		checkNonElements = base && dir === "parentNode",
		doneName = done++;

	return combinator.first ?
		// Check against closest ancestor/preceding element
		function( elem, context, xml ) {
			while ( (elem = elem[ dir ]) ) {
				if ( elem.nodeType === 1 || checkNonElements ) {
					return matcher( elem, context, xml );
				}
			}
		} :

		// Check against all ancestor/preceding elements
		function( elem, context, xml ) {
			var data, cache, outerCache,
				dirkey = dirruns + " " + doneName;

			// We can't set arbitrary data on XML nodes, so they don't benefit from dir caching
			if ( xml ) {
				while ( (elem = elem[ dir ]) ) {
					if ( elem.nodeType === 1 || checkNonElements ) {
						if ( matcher( elem, context, xml ) ) {
							return true;
						}
					}
				}
			} else {
				while ( (elem = elem[ dir ]) ) {
					if ( elem.nodeType === 1 || checkNonElements ) {
						outerCache = elem[ expando ] || (elem[ expando ] = {});
						if ( (cache = outerCache[ dir ]) && cache[0] === dirkey ) {
							if ( (data = cache[1]) === true || data === cachedruns ) {
								return data === true;
							}
						} else {
							cache = outerCache[ dir ] = [ dirkey ];
							cache[1] = matcher( elem, context, xml ) || cachedruns;
							if ( cache[1] === true ) {
								return true;
							}
						}
					}
				}
			}
		};
}

function elementMatcher( matchers ) {
	return matchers.length > 1 ?
		function( elem, context, xml ) {
			var i = matchers.length;
			while ( i-- ) {
				if ( !matchers[i]( elem, context, xml ) ) {
					return false;
				}
			}
			return true;
		} :
		matchers[0];
}

function condense( unmatched, map, filter, context, xml ) {
	var elem,
		newUnmatched = [],
		i = 0,
		len = unmatched.length,
		mapped = map != null;

	for ( ; i < len; i++ ) {
		if ( (elem = unmatched[i]) ) {
			if ( !filter || filter( elem, context, xml ) ) {
				newUnmatched.push( elem );
				if ( mapped ) {
					map.push( i );
				}
			}
		}
	}

	return newUnmatched;
}

function setMatcher( preFilter, selector, matcher, postFilter, postFinder, postSelector ) {
	if ( postFilter && !postFilter[ expando ] ) {
		postFilter = setMatcher( postFilter );
	}
	if ( postFinder && !postFinder[ expando ] ) {
		postFinder = setMatcher( postFinder, postSelector );
	}
	return markFunction(function( seed, results, context, xml ) {
		var temp, i, elem,
			preMap = [],
			postMap = [],
			preexisting = results.length,

			// Get initial elements from seed or context
			elems = seed || multipleContexts( selector || "*", context.nodeType ? [ context ] : context, [] ),

			// Prefilter to get matcher input, preserving a map for seed-results synchronization
			matcherIn = preFilter && ( seed || !selector ) ?
				condense( elems, preMap, preFilter, context, xml ) :
				elems,

			matcherOut = matcher ?
				// If we have a postFinder, or filtered seed, or non-seed postFilter or preexisting results,
				postFinder || ( seed ? preFilter : preexisting || postFilter ) ?

					// ...intermediate processing is necessary
					[] :

					// ...otherwise use results directly
					results :
				matcherIn;

		// Find primary matches
		if ( matcher ) {
			matcher( matcherIn, matcherOut, context, xml );
		}

		// Apply postFilter
		if ( postFilter ) {
			temp = condense( matcherOut, postMap );
			postFilter( temp, [], context, xml );

			// Un-match failing elements by moving them back to matcherIn
			i = temp.length;
			while ( i-- ) {
				if ( (elem = temp[i]) ) {
					matcherOut[ postMap[i] ] = !(matcherIn[ postMap[i] ] = elem);
				}
			}
		}

		if ( seed ) {
			if ( postFinder || preFilter ) {
				if ( postFinder ) {
					// Get the final matcherOut by condensing this intermediate into postFinder contexts
					temp = [];
					i = matcherOut.length;
					while ( i-- ) {
						if ( (elem = matcherOut[i]) ) {
							// Restore matcherIn since elem is not yet a final match
							temp.push( (matcherIn[i] = elem) );
						}
					}
					postFinder( null, (matcherOut = []), temp, xml );
				}

				// Move matched elements from seed to results to keep them synchronized
				i = matcherOut.length;
				while ( i-- ) {
					if ( (elem = matcherOut[i]) &&
						(temp = postFinder ? indexOf.call( seed, elem ) : preMap[i]) > -1 ) {

						seed[temp] = !(results[temp] = elem);
					}
				}
			}

		// Add elements to results, through postFinder if defined
		} else {
			matcherOut = condense(
				matcherOut === results ?
					matcherOut.splice( preexisting, matcherOut.length ) :
					matcherOut
			);
			if ( postFinder ) {
				postFinder( null, results, matcherOut, xml );
			} else {
				push.apply( results, matcherOut );
			}
		}
	});
}

function matcherFromTokens( tokens ) {
	var checkContext, matcher, j,
		len = tokens.length,
		leadingRelative = Expr.relative[ tokens[0].type ],
		implicitRelative = leadingRelative || Expr.relative[" "],
		i = leadingRelative ? 1 : 0,

		// The foundational matcher ensures that elements are reachable from top-level context(s)
		matchContext = addCombinator( function( elem ) {
			return elem === checkContext;
		}, implicitRelative, true ),
		matchAnyContext = addCombinator( function( elem ) {
			return indexOf.call( checkContext, elem ) > -1;
		}, implicitRelative, true ),
		matchers = [ function( elem, context, xml ) {
			return ( !leadingRelative && ( xml || context !== outermostContext ) ) || (
				(checkContext = context).nodeType ?
					matchContext( elem, context, xml ) :
					matchAnyContext( elem, context, xml ) );
		} ];

	for ( ; i < len; i++ ) {
		if ( (matcher = Expr.relative[ tokens[i].type ]) ) {
			matchers = [ addCombinator(elementMatcher( matchers ), matcher) ];
		} else {
			matcher = Expr.filter[ tokens[i].type ].apply( null, tokens[i].matches );

			// Return special upon seeing a positional matcher
			if ( matcher[ expando ] ) {
				// Find the next relative operator (if any) for proper handling
				j = ++i;
				for ( ; j < len; j++ ) {
					if ( Expr.relative[ tokens[j].type ] ) {
						break;
					}
				}
				return setMatcher(
					i > 1 && elementMatcher( matchers ),
					i > 1 && toSelector( tokens.slice( 0, i - 1 ) ).replace( rtrim, "$1" ),
					matcher,
					i < j && matcherFromTokens( tokens.slice( i, j ) ),
					j < len && matcherFromTokens( (tokens = tokens.slice( j )) ),
					j < len && toSelector( tokens )
				);
			}
			matchers.push( matcher );
		}
	}

	return elementMatcher( matchers );
}

function matcherFromGroupMatchers( elementMatchers, setMatchers ) {
	// A counter to specify which element is currently being matched
	var matcherCachedRuns = 0,
		bySet = setMatchers.length > 0,
		byElement = elementMatchers.length > 0,
		superMatcher = function( seed, context, xml, results, expandContext ) {
			var elem, j, matcher,
				setMatched = [],
				matchedCount = 0,
				i = "0",
				unmatched = seed && [],
				outermost = expandContext != null,
				contextBackup = outermostContext,
				// We must always have either seed elements or context
				elems = seed || byElement && Expr.find["TAG"]( "*", expandContext && context.parentNode || context ),
				// Use integer dirruns iff this is the outermost matcher
				dirrunsUnique = (dirruns += contextBackup == null ? 1 : Math.random() || 0.1);

			if ( outermost ) {
				outermostContext = context !== document && context;
				cachedruns = matcherCachedRuns;
			}

			// Add elements passing elementMatchers directly to results
			// Keep `i` a string if there are no elements so `matchedCount` will be "00" below
			for ( ; (elem = elems[i]) != null; i++ ) {
				if ( byElement && elem ) {
					j = 0;
					while ( (matcher = elementMatchers[j++]) ) {
						if ( matcher( elem, context, xml ) ) {
							results.push( elem );
							break;
						}
					}
					if ( outermost ) {
						dirruns = dirrunsUnique;
						cachedruns = ++matcherCachedRuns;
					}
				}

				// Track unmatched elements for set filters
				if ( bySet ) {
					// They will have gone through all possible matchers
					if ( (elem = !matcher && elem) ) {
						matchedCount--;
					}

					// Lengthen the array for every element, matched or not
					if ( seed ) {
						unmatched.push( elem );
					}
				}
			}

			// Apply set filters to unmatched elements
			matchedCount += i;
			if ( bySet && i !== matchedCount ) {
				j = 0;
				while ( (matcher = setMatchers[j++]) ) {
					matcher( unmatched, setMatched, context, xml );
				}

				if ( seed ) {
					// Reintegrate element matches to eliminate the need for sorting
					if ( matchedCount > 0 ) {
						while ( i-- ) {
							if ( !(unmatched[i] || setMatched[i]) ) {
								setMatched[i] = pop.call( results );
							}
						}
					}

					// Discard index placeholder values to get only actual matches
					setMatched = condense( setMatched );
				}

				// Add matches to results
				push.apply( results, setMatched );

				// Seedless set matches succeeding multiple successful matchers stipulate sorting
				if ( outermost && !seed && setMatched.length > 0 &&
					( matchedCount + setMatchers.length ) > 1 ) {

					Sizzle.uniqueSort( results );
				}
			}

			// Override manipulation of globals by nested matchers
			if ( outermost ) {
				dirruns = dirrunsUnique;
				outermostContext = contextBackup;
			}

			return unmatched;
		};

	return bySet ?
		markFunction( superMatcher ) :
		superMatcher;
}

compile = Sizzle.compile = function( selector, group /* Internal Use Only */ ) {
	var i,
		setMatchers = [],
		elementMatchers = [],
		cached = compilerCache[ selector + " " ];

	if ( !cached ) {
		// Generate a function of recursive functions that can be used to check each element
		if ( !group ) {
			group = tokenize( selector );
		}
		i = group.length;
		while ( i-- ) {
			cached = matcherFromTokens( group[i] );
			if ( cached[ expando ] ) {
				setMatchers.push( cached );
			} else {
				elementMatchers.push( cached );
			}
		}

		// Cache the compiled function
		cached = compilerCache( selector, matcherFromGroupMatchers( elementMatchers, setMatchers ) );
	}
	return cached;
};

function multipleContexts( selector, contexts, results ) {
	var i = 0,
		len = contexts.length;
	for ( ; i < len; i++ ) {
		Sizzle( selector, contexts[i], results );
	}
	return results;
}

function select( selector, context, results, seed ) {
	var i, tokens, token, type, find,
		match = tokenize( selector );

	if ( !seed ) {
		// Try to minimize operations if there is only one group
		if ( match.length === 1 ) {

			// Take a shortcut and set the context if the root selector is an ID
			tokens = match[0] = match[0].slice( 0 );
			if ( tokens.length > 2 && (token = tokens[0]).type === "ID" &&
					context.nodeType === 9 && !documentIsXML &&
					Expr.relative[ tokens[1].type ] ) {

				context = Expr.find["ID"]( token.matches[0].replace( runescape, funescape ), context )[0];
				if ( !context ) {
					return results;
				}

				selector = selector.slice( tokens.shift().value.length );
			}

			// Fetch a seed set for right-to-left matching
			i = matchExpr["needsContext"].test( selector ) ? 0 : tokens.length;
			while ( i-- ) {
				token = tokens[i];

				// Abort if we hit a combinator
				if ( Expr.relative[ (type = token.type) ] ) {
					break;
				}
				if ( (find = Expr.find[ type ]) ) {
					// Search, expanding context for leading sibling combinators
					if ( (seed = find(
						token.matches[0].replace( runescape, funescape ),
						rsibling.test( tokens[0].type ) && context.parentNode || context
					)) ) {

						// If seed is empty or no tokens remain, we can return early
						tokens.splice( i, 1 );
						selector = seed.length && toSelector( tokens );
						if ( !selector ) {
							push.apply( results, slice.call( seed, 0 ) );
							return results;
						}

						break;
					}
				}
			}
		}
	}

	// Compile and execute a filtering function
	// Provide `match` to avoid retokenization if we modified the selector above
	compile( selector, match )(
		seed,
		context,
		documentIsXML,
		results,
		rsibling.test( selector )
	);
	return results;
}

// Deprecated
Expr.pseudos["nth"] = Expr.pseudos["eq"];

// Easy API for creating new setFilters
function setFilters() {}
Expr.filters = setFilters.prototype = Expr.pseudos;
Expr.setFilters = new setFilters();

// Initialize with the default document
setDocument();

// Override sizzle attribute retrieval
Sizzle.attr = jQuery.attr;
jQuery.find = Sizzle;
jQuery.expr = Sizzle.selectors;
jQuery.expr[":"] = jQuery.expr.pseudos;
jQuery.unique = Sizzle.uniqueSort;
jQuery.text = Sizzle.getText;
jQuery.isXMLDoc = Sizzle.isXML;
jQuery.contains = Sizzle.contains;


})( window );
var runtil = /Until$/,
	rparentsprev = /^(?:parents|prev(?:Until|All))/,
	isSimple = /^.[^:#\[\.,]*$/,
	rneedsContext = jQuery.expr.match.needsContext,
	// methods guaranteed to produce a unique set when starting from a unique set
	guaranteedUnique = {
		children: true,
		contents: true,
		next: true,
		prev: true
	};

jQuery.fn.extend({
	find: function( selector ) {
		var i, ret, self,
			len = this.length;

		if ( typeof selector !== "string" ) {
			self = this;
			return this.pushStack( jQuery( selector ).filter(function() {
				for ( i = 0; i < len; i++ ) {
					if ( jQuery.contains( self[ i ], this ) ) {
						return true;
					}
				}
			}) );
		}

		ret = [];
		for ( i = 0; i < len; i++ ) {
			jQuery.find( selector, this[ i ], ret );
		}

		// Needed because $( selector, context ) becomes $( context ).find( selector )
		ret = this.pushStack( len > 1 ? jQuery.unique( ret ) : ret );
		ret.selector = ( this.selector ? this.selector + " " : "" ) + selector;
		return ret;
	},

	has: function( target ) {
		var i,
			targets = jQuery( target, this ),
			len = targets.length;

		return this.filter(function() {
			for ( i = 0; i < len; i++ ) {
				if ( jQuery.contains( this, targets[i] ) ) {
					return true;
				}
			}
		});
	},

	not: function( selector ) {
		return this.pushStack( winnow(this, selector, false) );
	},

	filter: function( selector ) {
		return this.pushStack( winnow(this, selector, true) );
	},

	is: function( selector ) {
		return !!selector && (
			typeof selector === "string" ?
				// If this is a positional/relative selector, check membership in the returned set
				// so $("p:first").is("p:last") won't return true for a doc with two "p".
				rneedsContext.test( selector ) ?
					jQuery( selector, this.context ).index( this[0] ) >= 0 :
					jQuery.filter( selector, this ).length > 0 :
				this.filter( selector ).length > 0 );
	},

	closest: function( selectors, context ) {
		var cur,
			i = 0,
			l = this.length,
			ret = [],
			pos = rneedsContext.test( selectors ) || typeof selectors !== "string" ?
				jQuery( selectors, context || this.context ) :
				0;

		for ( ; i < l; i++ ) {
			cur = this[i];

			while ( cur && cur.ownerDocument && cur !== context && cur.nodeType !== 11 ) {
				if ( pos ? pos.index(cur) > -1 : jQuery.find.matchesSelector(cur, selectors) ) {
					ret.push( cur );
					break;
				}
				cur = cur.parentNode;
			}
		}

		return this.pushStack( ret.length > 1 ? jQuery.unique( ret ) : ret );
	},

	// Determine the position of an element within
	// the matched set of elements
	index: function( elem ) {

		// No argument, return index in parent
		if ( !elem ) {
			return ( this[0] && this[0].parentNode ) ? this.first().prevAll().length : -1;
		}

		// index in selector
		if ( typeof elem === "string" ) {
			return jQuery.inArray( this[0], jQuery( elem ) );
		}

		// Locate the position of the desired element
		return jQuery.inArray(
			// If it receives a jQuery object, the first element is used
			elem.jquery ? elem[0] : elem, this );
	},

	add: function( selector, context ) {
		var set = typeof selector === "string" ?
				jQuery( selector, context ) :
				jQuery.makeArray( selector && selector.nodeType ? [ selector ] : selector ),
			all = jQuery.merge( this.get(), set );

		return this.pushStack( jQuery.unique(all) );
	},

	addBack: function( selector ) {
		return this.add( selector == null ?
			this.prevObject : this.prevObject.filter(selector)
		);
	}
});

jQuery.fn.andSelf = jQuery.fn.addBack;

function sibling( cur, dir ) {
	do {
		cur = cur[ dir ];
	} while ( cur && cur.nodeType !== 1 );

	return cur;
}

jQuery.each({
	parent: function( elem ) {
		var parent = elem.parentNode;
		return parent && parent.nodeType !== 11 ? parent : null;
	},
	parents: function( elem ) {
		return jQuery.dir( elem, "parentNode" );
	},
	parentsUntil: function( elem, i, until ) {
		return jQuery.dir( elem, "parentNode", until );
	},
	next: function( elem ) {
		return sibling( elem, "nextSibling" );
	},
	prev: function( elem ) {
		return sibling( elem, "previousSibling" );
	},
	nextAll: function( elem ) {
		return jQuery.dir( elem, "nextSibling" );
	},
	prevAll: function( elem ) {
		return jQuery.dir( elem, "previousSibling" );
	},
	nextUntil: function( elem, i, until ) {
		return jQuery.dir( elem, "nextSibling", until );
	},
	prevUntil: function( elem, i, until ) {
		return jQuery.dir( elem, "previousSibling", until );
	},
	siblings: function( elem ) {
		return jQuery.sibling( ( elem.parentNode || {} ).firstChild, elem );
	},
	children: function( elem ) {
		return jQuery.sibling( elem.firstChild );
	},
	contents: function( elem ) {
		return jQuery.nodeName( elem, "iframe" ) ?
			elem.contentDocument || elem.contentWindow.document :
			jQuery.merge( [], elem.childNodes );
	}
}, function( name, fn ) {
	jQuery.fn[ name ] = function( until, selector ) {
		var ret = jQuery.map( this, fn, until );

		if ( !runtil.test( name ) ) {
			selector = until;
		}

		if ( selector && typeof selector === "string" ) {
			ret = jQuery.filter( selector, ret );
		}

		ret = this.length > 1 && !guaranteedUnique[ name ] ? jQuery.unique( ret ) : ret;

		if ( this.length > 1 && rparentsprev.test( name ) ) {
			ret = ret.reverse();
		}

		return this.pushStack( ret );
	};
});

jQuery.extend({
	filter: function( expr, elems, not ) {
		if ( not ) {
			expr = ":not(" + expr + ")";
		}

		return elems.length === 1 ?
			jQuery.find.matchesSelector(elems[0], expr) ? [ elems[0] ] : [] :
			jQuery.find.matches(expr, elems);
	},

	dir: function( elem, dir, until ) {
		var matched = [],
			cur = elem[ dir ];

		while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) {
			if ( cur.nodeType === 1 ) {
				matched.push( cur );
			}
			cur = cur[dir];
		}
		return matched;
	},

	sibling: function( n, elem ) {
		var r = [];

		for ( ; n; n = n.nextSibling ) {
			if ( n.nodeType === 1 && n !== elem ) {
				r.push( n );
			}
		}

		return r;
	}
});

// Implement the identical functionality for filter and not
function winnow( elements, qualifier, keep ) {

	// Can't pass null or undefined to indexOf in Firefox 4
	// Set to 0 to skip string check
	qualifier = qualifier || 0;

	if ( jQuery.isFunction( qualifier ) ) {
		return jQuery.grep(elements, function( elem, i ) {
			var retVal = !!qualifier.call( elem, i, elem );
			return retVal === keep;
		});

	} else if ( qualifier.nodeType ) {
		return jQuery.grep(elements, function( elem ) {
			return ( elem === qualifier ) === keep;
		});

	} else if ( typeof qualifier === "string" ) {
		var filtered = jQuery.grep(elements, function( elem ) {
			return elem.nodeType === 1;
		});

		if ( isSimple.test( qualifier ) ) {
			return jQuery.filter(qualifier, filtered, !keep);
		} else {
			qualifier = jQuery.filter( qualifier, filtered );
		}
	}

	return jQuery.grep(elements, function( elem ) {
		return ( jQuery.inArray( elem, qualifier ) >= 0 ) === keep;
	});
}
function createSafeFragment( document ) {
	var list = nodeNames.split( "|" ),
		safeFrag = document.createDocumentFragment();

	if ( safeFrag.createElement ) {
		while ( list.length ) {
			safeFrag.createElement(
				list.pop()
			);
		}
	}
	return safeFrag;
}

var nodeNames = "abbr|article|aside|audio|bdi|canvas|data|datalist|details|figcaption|figure|footer|" +
		"header|hgroup|mark|meter|nav|output|progress|section|summary|time|video",
	rinlinejQuery = / jQuery\d+="(?:null|\d+)"/g,
	rnoshimcache = new RegExp("<(?:" + nodeNames + ")[\\s/>]", "i"),
	rleadingWhitespace = /^\s+/,
	rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/gi,
	rtagName = /<([\w:]+)/,
	rtbody = /<tbody/i,
	rhtml = /<|&#?\w+;/,
	rnoInnerhtml = /<(?:script|style|link)/i,
	manipulation_rcheckableType = /^(?:checkbox|radio)$/i,
	// checked="checked" or checked
	rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i,
	rscriptType = /^$|\/(?:java|ecma)script/i,
	rscriptTypeMasked = /^true\/(.*)/,
	rcleanScript = /^\s*<!(?:\[CDATA\[|--)|(?:\]\]|--)>\s*$/g,

	// We have to close these tags to support XHTML (#13200)
	wrapMap = {
		option: [ 1, "<select multiple='multiple'>", "</select>" ],
		legend: [ 1, "<fieldset>", "</fieldset>" ],
		area: [ 1, "<map>", "</map>" ],
		param: [ 1, "<object>", "</object>" ],
		thead: [ 1, "<table>", "</table>" ],
		tr: [ 2, "<table><tbody>", "</tbody></table>" ],
		col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ],
		td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ],

		// IE6-8 can't serialize link, script, style, or any html5 (NoScope) tags,
		// unless wrapped in a div with non-breaking characters in front of it.
		_default: jQuery.support.htmlSerialize ? [ 0, "", "" ] : [ 1, "X<div>", "</div>"  ]
	},
	safeFragment = createSafeFragment( document ),
	fragmentDiv = safeFragment.appendChild( document.createElement("div") );

wrapMap.optgroup = wrapMap.option;
wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead;
wrapMap.th = wrapMap.td;

jQuery.fn.extend({
	text: function( value ) {
		return jQuery.access( this, function( value ) {
			return value === undefined ?
				jQuery.text( this ) :
				this.empty().append( ( this[0] && this[0].ownerDocument || document ).createTextNode( value ) );
		}, null, value, arguments.length );
	},

	wrapAll: function( html ) {
		if ( jQuery.isFunction( html ) ) {
			return this.each(function(i) {
				jQuery(this).wrapAll( html.call(this, i) );
			});
		}

		if ( this[0] ) {
			// The elements to wrap the target around
			var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true);

			if ( this[0].parentNode ) {
				wrap.insertBefore( this[0] );
			}

			wrap.map(function() {
				var elem = this;

				while ( elem.firstChild && elem.firstChild.nodeType === 1 ) {
					elem = elem.firstChild;
				}

				return elem;
			}).append( this );
		}

		return this;
	},

	wrapInner: function( html ) {
		if ( jQuery.isFunction( html ) ) {
			return this.each(function(i) {
				jQuery(this).wrapInner( html.call(this, i) );
			});
		}

		return this.each(function() {
			var self = jQuery( this ),
				contents = self.contents();

			if ( contents.length ) {
				contents.wrapAll( html );

			} else {
				self.append( html );
			}
		});
	},

	wrap: function( html ) {
		var isFunction = jQuery.isFunction( html );

		return this.each(function(i) {
			jQuery( this ).wrapAll( isFunction ? html.call(this, i) : html );
		});
	},

	unwrap: function() {
		return this.parent().each(function() {
			if ( !jQuery.nodeName( this, "body" ) ) {
				jQuery( this ).replaceWith( this.childNodes );
			}
		}).end();
	},

	append: function() {
		return this.domManip(arguments, true, function( elem ) {
			if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) {
				this.appendChild( elem );
			}
		});
	},

	prepend: function() {
		return this.domManip(arguments, true, function( elem ) {
			if ( this.nodeType === 1 || this.nodeType === 11 || this.nodeType === 9 ) {
				this.insertBefore( elem, this.firstChild );
			}
		});
	},

	before: function() {
		return this.domManip( arguments, false, function( elem ) {
			if ( this.parentNode ) {
				this.parentNode.insertBefore( elem, this );
			}
		});
	},

	after: function() {
		return this.domManip( arguments, false, function( elem ) {
			if ( this.parentNode ) {
				this.parentNode.insertBefore( elem, this.nextSibling );
			}
		});
	},

	// keepData is for internal use only--do not document
	remove: function( selector, keepData ) {
		var elem,
			i = 0;

		for ( ; (elem = this[i]) != null; i++ ) {
			if ( !selector || jQuery.filter( selector, [ elem ] ).length > 0 ) {
				if ( !keepData && elem.nodeType === 1 ) {
					jQuery.cleanData( getAll( elem ) );
				}

				if ( elem.parentNode ) {
					if ( keepData && jQuery.contains( elem.ownerDocument, elem ) ) {
						setGlobalEval( getAll( elem, "script" ) );
					}
					elem.parentNode.removeChild( elem );
				}
			}
		}

		return this;
	},

	empty: function() {
		var elem,
			i = 0;

		for ( ; (elem = this[i]) != null; i++ ) {
			// Remove element nodes and prevent memory leaks
			if ( elem.nodeType === 1 ) {
				jQuery.cleanData( getAll( elem, false ) );
			}

			// Remove any remaining nodes
			while ( elem.firstChild ) {
				elem.removeChild( elem.firstChild );
			}

			// If this is a select, ensure that it displays empty (#12336)
			// Support: IE<9
			if ( elem.options && jQuery.nodeName( elem, "select" ) ) {
				elem.options.length = 0;
			}
		}

		return this;
	},

	clone: function( dataAndEvents, deepDataAndEvents ) {
		dataAndEvents = dataAndEvents == null ? false : dataAndEvents;
		deepDataAndEvents = deepDataAndEvents == null ? dataAndEvents : deepDataAndEvents;

		return this.map( function () {
			return jQuery.clone( this, dataAndEvents, deepDataAndEvents );
		});
	},

	html: function( value ) {
		return jQuery.access( this, function( value ) {
			var elem = this[0] || {},
				i = 0,
				l = this.length;

			if ( value === undefined ) {
				return elem.nodeType === 1 ?
					elem.innerHTML.replace( rinlinejQuery, "" ) :
					undefined;
			}

			// See if we can take a shortcut and just use innerHTML
			if ( typeof value === "string" && !rnoInnerhtml.test( value ) &&
				( jQuery.support.htmlSerialize || !rnoshimcache.test( value )  ) &&
				( jQuery.support.leadingWhitespace || !rleadingWhitespace.test( value ) ) &&
				!wrapMap[ ( rtagName.exec( value ) || ["", ""] )[1].toLowerCase() ] ) {

				value = value.replace( rxhtmlTag, "<$1></$2>" );

				try {
					for (; i < l; i++ ) {
						// Remove element nodes and prevent memory leaks
						elem = this[i] || {};
						if ( elem.nodeType === 1 ) {
							jQuery.cleanData( getAll( elem, false ) );
							elem.innerHTML = value;
						}
					}

					elem = 0;

				// If using innerHTML throws an exception, use the fallback method
				} catch(e) {}
			}

			if ( elem ) {
				this.empty().append( value );
			}
		}, null, value, arguments.length );
	},

	replaceWith: function( value ) {
		var isFunc = jQuery.isFunction( value );

		// Make sure that the elements are removed from the DOM before they are inserted
		// this can help fix replacing a parent with child elements
		if ( !isFunc && typeof value !== "string" ) {
			value = jQuery( value ).not( this ).detach();
		}

		return this.domManip( [ value ], true, function( elem ) {
			var next = this.nextSibling,
				parent = this.parentNode;

			if ( parent ) {
				jQuery( this ).remove();
				parent.insertBefore( elem, next );
			}
		});
	},

	detach: function( selector ) {
		return this.remove( selector, true );
	},

	domManip: function( args, table, callback ) {

		// Flatten any nested arrays
		args = core_concat.apply( [], args );

		var first, node, hasScripts,
			scripts, doc, fragment,
			i = 0,
			l = this.length,
			set = this,
			iNoClone = l - 1,
			value = args[0],
			isFunction = jQuery.isFunction( value );

		// We can't cloneNode fragments that contain checked, in WebKit
		if ( isFunction || !( l <= 1 || typeof value !== "string" || jQuery.support.checkClone || !rchecked.test( value ) ) ) {
			return this.each(function( index ) {
				var self = set.eq( index );
				if ( isFunction ) {
					args[0] = value.call( this, index, table ? self.html() : undefined );
				}
				self.domManip( args, table, callback );
			});
		}

		if ( l ) {
			fragment = jQuery.buildFragment( args, this[ 0 ].ownerDocument, false, this );
			first = fragment.firstChild;

			if ( fragment.childNodes.length === 1 ) {
				fragment = first;
			}

			if ( first ) {
				table = table && jQuery.nodeName( first, "tr" );
				scripts = jQuery.map( getAll( fragment, "script" ), disableScript );
				hasScripts = scripts.length;

				// Use the original fragment for the last item instead of the first because it can end up
				// being emptied incorrectly in certain situations (#8070).
				for ( ; i < l; i++ ) {
					node = fragment;

					if ( i !== iNoClone ) {
						node = jQuery.clone( node, true, true );

						// Keep references to cloned scripts for later restoration
						if ( hasScripts ) {
							jQuery.merge( scripts, getAll( node, "script" ) );
						}
					}

					callback.call(
						table && jQuery.nodeName( this[i], "table" ) ?
							findOrAppend( this[i], "tbody" ) :
							this[i],
						node,
						i
					);
				}

				if ( hasScripts ) {
					doc = scripts[ scripts.length - 1 ].ownerDocument;

					// Reenable scripts
					jQuery.map( scripts, restoreScript );

					// Evaluate executable scripts on first document insertion
					for ( i = 0; i < hasScripts; i++ ) {
						node = scripts[ i ];
						if ( rscriptType.test( node.type || "" ) &&
							!jQuery._data( node, "globalEval" ) && jQuery.contains( doc, node ) ) {

							if ( node.src ) {
								// Hope ajax is available...
								jQuery.ajax({
									url: node.src,
									type: "GET",
									dataType: "script",
									async: false,
									global: false,
									"throws": true
								});
							} else {
								jQuery.globalEval( ( node.text || node.textContent || node.innerHTML || "" ).replace( rcleanScript, "" ) );
							}
						}
					}
				}

				// Fix #11809: Avoid leaking memory
				fragment = first = null;
			}
		}

		return this;
	}
});

function findOrAppend( elem, tag ) {
	return elem.getElementsByTagName( tag )[0] || elem.appendChild( elem.ownerDocument.createElement( tag ) );
}

// Replace/restore the type attribute of script elements for safe DOM manipulation
function disableScript( elem ) {
	var attr = elem.getAttributeNode("type");
	elem.type = ( attr && attr.specified ) + "/" + elem.type;
	return elem;
}
function restoreScript( elem ) {
	var match = rscriptTypeMasked.exec( elem.type );
	if ( match ) {
		elem.type = match[1];
	} else {
		elem.removeAttribute("type");
	}
	return elem;
}

// Mark scripts as having already been evaluated
function setGlobalEval( elems, refElements ) {
	var elem,
		i = 0;
	for ( ; (elem = elems[i]) != null; i++ ) {
		jQuery._data( elem, "globalEval", !refElements || jQuery._data( refElements[i], "globalEval" ) );
	}
}

function cloneCopyEvent( src, dest ) {

	if ( dest.nodeType !== 1 || !jQuery.hasData( src ) ) {
		return;
	}

	var type, i, l,
		oldData = jQuery._data( src ),
		curData = jQuery._data( dest, oldData ),
		events = oldData.events;

	if ( events ) {
		delete curData.handle;
		curData.events = {};

		for ( type in events ) {
			for ( i = 0, l = events[ type ].length; i < l; i++ ) {
				jQuery.event.add( dest, type, events[ type ][ i ] );
			}
		}
	}

	// make the cloned public data object a copy from the original
	if ( curData.data ) {
		curData.data = jQuery.extend( {}, curData.data );
	}
}

function fixCloneNodeIssues( src, dest ) {
	var nodeName, e, data;

	// We do not need to do anything for non-Elements
	if ( dest.nodeType !== 1 ) {
		return;
	}

	nodeName = dest.nodeName.toLowerCase();

	// IE6-8 copies events bound via attachEvent when using cloneNode.
	if ( !jQuery.support.noCloneEvent && dest[ jQuery.expando ] ) {
		data = jQuery._data( dest );

		for ( e in data.events ) {
			jQuery.removeEvent( dest, e, data.handle );
		}

		// Event data gets referenced instead of copied if the expando gets copied too
		dest.removeAttribute( jQuery.expando );
	}

	// IE blanks contents when cloning scripts, and tries to evaluate newly-set text
	if ( nodeName === "script" && dest.text !== src.text ) {
		disableScript( dest ).text = src.text;
		restoreScript( dest );

	// IE6-10 improperly clones children of object elements using classid.
	// IE10 throws NoModificationAllowedError if parent is null, #12132.
	} else if ( nodeName === "object" ) {
		if ( dest.parentNode ) {
			dest.outerHTML = src.outerHTML;
		}

		// This path appears unavoidable for IE9. When cloning an object
		// element in IE9, the outerHTML strategy above is not sufficient.
		// If the src has innerHTML and the destination does not,
		// copy the src.innerHTML into the dest.innerHTML. #10324
		if ( jQuery.support.html5Clone && ( src.innerHTML && !jQuery.trim(dest.innerHTML) ) ) {
			dest.innerHTML = src.innerHTML;
		}

	} else if ( nodeName === "input" && manipulation_rcheckableType.test( src.type ) ) {
		// IE6-8 fails to persist the checked state of a cloned checkbox
		// or radio button. Worse, IE6-7 fail to give the cloned element
		// a checked appearance if the defaultChecked value isn't also set

		dest.defaultChecked = dest.checked = src.checked;

		// IE6-7 get confused and end up setting the value of a cloned
		// checkbox/radio button to an empty string instead of "on"
		if ( dest.value !== src.value ) {
			dest.value = src.value;
		}

	// IE6-8 fails to return the selected option to the default selected
	// state when cloning options
	} else if ( nodeName === "option" ) {
		dest.defaultSelected = dest.selected = src.defaultSelected;

	// IE6-8 fails to set the defaultValue to the correct value when
	// cloning other types of input fields
	} else if ( nodeName === "input" || nodeName === "textarea" ) {
		dest.defaultValue = src.defaultValue;
	}
}

jQuery.each({
	appendTo: "append",
	prependTo: "prepend",
	insertBefore: "before",
	insertAfter: "after",
	replaceAll: "replaceWith"
}, function( name, original ) {
	jQuery.fn[ name ] = function( selector ) {
		var elems,
			i = 0,
			ret = [],
			insert = jQuery( selector ),
			last = insert.length - 1;

		for ( ; i <= last; i++ ) {
			elems = i === last ? this : this.clone(true);
			jQuery( insert[i] )[ original ]( elems );

			// Modern browsers can apply jQuery collections as arrays, but oldIE needs a .get()
			core_push.apply( ret, elems.get() );
		}

		return this.pushStack( ret );
	};
});

function getAll( context, tag ) {
	var elems, elem,
		i = 0,
		found = typeof context.getElementsByTagName !== core_strundefined ? context.getElementsByTagName( tag || "*" ) :
			typeof context.querySelectorAll !== core_strundefined ? context.querySelectorAll( tag || "*" ) :
			undefined;

	if ( !found ) {
		for ( found = [], elems = context.childNodes || context; (elem = elems[i]) != null; i++ ) {
			if ( !tag || jQuery.nodeName( elem, tag ) ) {
				found.push( elem );
			} else {
				jQuery.merge( found, getAll( elem, tag ) );
			}
		}
	}

	return tag === undefined || tag && jQuery.nodeName( context, tag ) ?
		jQuery.merge( [ context ], found ) :
		found;
}

// Used in buildFragment, fixes the defaultChecked property
function fixDefaultChecked( elem ) {
	if ( manipulation_rcheckableType.test( elem.type ) ) {
		elem.defaultChecked = elem.checked;
	}
}

jQuery.extend({
	clone: function( elem, dataAndEvents, deepDataAndEvents ) {
		var destElements, node, clone, i, srcElements,
			inPage = jQuery.contains( elem.ownerDocument, elem );

		if ( jQuery.support.html5Clone || jQuery.isXMLDoc(elem) || !rnoshimcache.test( "<" + elem.nodeName + ">" ) ) {
			clone = elem.cloneNode( true );

		// IE<=8 does not properly clone detached, unknown element nodes
		} else {
			fragmentDiv.innerHTML = elem.outerHTML;
			fragmentDiv.removeChild( clone = fragmentDiv.firstChild );
		}

		if ( (!jQuery.support.noCloneEvent || !jQuery.support.noCloneChecked) &&
				(elem.nodeType === 1 || elem.nodeType === 11) && !jQuery.isXMLDoc(elem) ) {

			// We eschew Sizzle here for performance reasons: http://jsperf.com/getall-vs-sizzle/2
			destElements = getAll( clone );
			srcElements = getAll( elem );

			// Fix all IE cloning issues
			for ( i = 0; (node = srcElements[i]) != null; ++i ) {
				// Ensure that the destination node is not null; Fixes #9587
				if ( destElements[i] ) {
					fixCloneNodeIssues( node, destElements[i] );
				}
			}
		}

		// Copy the events from the original to the clone
		if ( dataAndEvents ) {
			if ( deepDataAndEvents ) {
				srcElements = srcElements || getAll( elem );
				destElements = destElements || getAll( clone );

				for ( i = 0; (node = srcElements[i]) != null; i++ ) {
					cloneCopyEvent( node, destElements[i] );
				}
			} else {
				cloneCopyEvent( elem, clone );
			}
		}

		// Preserve script evaluation history
		destElements = getAll( clone, "script" );
		if ( destElements.length > 0 ) {
			setGlobalEval( destElements, !inPage && getAll( elem, "script" ) );
		}

		destElements = srcElements = node = null;

		// Return the cloned set
		return clone;
	},

	buildFragment: function( elems, context, scripts, selection ) {
		var j, elem, contains,
			tmp, tag, tbody, wrap,
			l = elems.length,

			// Ensure a safe fragment
			safe = createSafeFragment( context ),

			nodes = [],
			i = 0;

		for ( ; i < l; i++ ) {
			elem = elems[ i ];

			if ( elem || elem === 0 ) {

				// Add nodes directly
				if ( jQuery.type( elem ) === "object" ) {
					jQuery.merge( nodes, elem.nodeType ? [ elem ] : elem );

				// Convert non-html into a text node
				} else if ( !rhtml.test( elem ) ) {
					nodes.push( context.createTextNode( elem ) );

				// Convert html into DOM nodes
				} else {
					tmp = tmp || safe.appendChild( context.createElement("div") );

					// Deserialize a standard representation
					tag = ( rtagName.exec( elem ) || ["", ""] )[1].toLowerCase();
					wrap = wrapMap[ tag ] || wrapMap._default;

					tmp.innerHTML = wrap[1] + elem.replace( rxhtmlTag, "<$1></$2>" ) + wrap[2];

					// Descend through wrappers to the right content
					j = wrap[0];
					while ( j-- ) {
						tmp = tmp.lastChild;
					}

					// Manually add leading whitespace removed by IE
					if ( !jQuery.support.leadingWhitespace && rleadingWhitespace.test( elem ) ) {
						nodes.push( context.createTextNode( rleadingWhitespace.exec( elem )[0] ) );
					}

					// Remove IE's autoinserted <tbody> from table fragments
					if ( !jQuery.support.tbody ) {

						// String was a <table>, *may* have spurious <tbody>
						elem = tag === "table" && !rtbody.test( elem ) ?
							tmp.firstChild :

							// String was a bare <thead> or <tfoot>
							wrap[1] === "<table>" && !rtbody.test( elem ) ?
								tmp :
								0;

						j = elem && elem.childNodes.length;
						while ( j-- ) {
							if ( jQuery.nodeName( (tbody = elem.childNodes[j]), "tbody" ) && !tbody.childNodes.length ) {
								elem.removeChild( tbody );
							}
						}
					}

					jQuery.merge( nodes, tmp.childNodes );

					// Fix #12392 for WebKit and IE > 9
					tmp.textContent = "";

					// Fix #12392 for oldIE
					while ( tmp.firstChild ) {
						tmp.removeChild( tmp.firstChild );
					}

					// Remember the top-level container for proper cleanup
					tmp = safe.lastChild;
				}
			}
		}

		// Fix #11356: Clear elements from fragment
		if ( tmp ) {
			safe.removeChild( tmp );
		}

		// Reset defaultChecked for any radios and checkboxes
		// about to be appended to the DOM in IE 6/7 (#8060)
		if ( !jQuery.support.appendChecked ) {
			jQuery.grep( getAll( nodes, "input" ), fixDefaultChecked );
		}

		i = 0;
		while ( (elem = nodes[ i++ ]) ) {

			// #4087 - If origin and destination elements are the same, and this is
			// that element, do not do anything
			if ( selection && jQuery.inArray( elem, selection ) !== -1 ) {
				continue;
			}

			contains = jQuery.contains( elem.ownerDocument, elem );

			// Append to fragment
			tmp = getAll( safe.appendChild( elem ), "script" );

			// Preserve script evaluation history
			if ( contains ) {
				setGlobalEval( tmp );
			}

			// Capture executables
			if ( scripts ) {
				j = 0;
				while ( (elem = tmp[ j++ ]) ) {
					if ( rscriptType.test( elem.type || "" ) ) {
						scripts.push( elem );
					}
				}
			}
		}

		tmp = null;

		return safe;
	},

	cleanData: function( elems, /* internal */ acceptData ) {
		var elem, type, id, data,
			i = 0,
			internalKey = jQuery.expando,
			cache = jQuery.cache,
			deleteExpando = jQuery.support.deleteExpando,
			special = jQuery.event.special;

		for ( ; (elem = elems[i]) != null; i++ ) {

			if ( acceptData || jQuery.acceptData( elem ) ) {

				id = elem[ internalKey ];
				data = id && cache[ id ];

				if ( data ) {
					if ( data.events ) {
						for ( type in data.events ) {
							if ( special[ type ] ) {
								jQuery.event.remove( elem, type );

							// This is a shortcut to avoid jQuery.event.remove's overhead
							} else {
								jQuery.removeEvent( elem, type, data.handle );
							}
						}
					}

					// Remove cache only if it was not already removed by jQuery.event.remove
					if ( cache[ id ] ) {

						delete cache[ id ];

						// IE does not allow us to delete expando properties from nodes,
						// nor does it have a removeAttribute function on Document nodes;
						// we must handle all of these cases
						if ( deleteExpando ) {
							delete elem[ internalKey ];

						} else if ( typeof elem.removeAttribute !== core_strundefined ) {
							elem.removeAttribute( internalKey );

						} else {
							elem[ internalKey ] = null;
						}

						core_deletedIds.push( id );
					}
				}
			}
		}
	}
});
var iframe, getStyles, curCSS,
	ralpha = /alpha\([^)]*\)/i,
	ropacity = /opacity\s*=\s*([^)]*)/,
	rposition = /^(top|right|bottom|left)$/,
	// swappable if display is none or starts with table except "table", "table-cell", or "table-caption"
	// see here for display values: https://developer.mozilla.org/en-US/docs/CSS/display
	rdisplayswap = /^(none|table(?!-c[ea]).+)/,
	rmargin = /^margin/,
	rnumsplit = new RegExp( "^(" + core_pnum + ")(.*)$", "i" ),
	rnumnonpx = new RegExp( "^(" + core_pnum + ")(?!px)[a-z%]+$", "i" ),
	rrelNum = new RegExp( "^([+-])=(" + core_pnum + ")", "i" ),
	elemdisplay = { BODY: "block" },

	cssShow = { position: "absolute", visibility: "hidden", display: "block" },
	cssNormalTransform = {
		letterSpacing: 0,
		fontWeight: 400
	},

	cssExpand = [ "Top", "Right", "Bottom", "Left" ],
	cssPrefixes = [ "Webkit", "O", "Moz", "ms" ];

// return a css property mapped to a potentially vendor prefixed property
function vendorPropName( style, name ) {

	// shortcut for names that are not vendor prefixed
	if ( name in style ) {
		return name;
	}

	// check for vendor prefixed names
	var capName = name.charAt(0).toUpperCase() + name.slice(1),
		origName = name,
		i = cssPrefixes.length;

	while ( i-- ) {
		name = cssPrefixes[ i ] + capName;
		if ( name in style ) {
			return name;
		}
	}

	return origName;
}

function isHidden( elem, el ) {
	// isHidden might be called from jQuery#filter function;
	// in that case, element will be second argument
	elem = el || elem;
	return jQuery.css( elem, "display" ) === "none" || !jQuery.contains( elem.ownerDocument, elem );
}

function showHide( elements, show ) {
	var display, elem, hidden,
		values = [],
		index = 0,
		length = elements.length;

	for ( ; index < length; index++ ) {
		elem = elements[ index ];
		if ( !elem.style ) {
			continue;
		}

		values[ index ] = jQuery._data( elem, "olddisplay" );
		display = elem.style.display;
		if ( show ) {
			// Reset the inline display of this element to learn if it is
			// being hidden by cascaded rules or not
			if ( !values[ index ] && display === "none" ) {
				elem.style.display = "";
			}

			// Set elements which have been overridden with display: none
			// in a stylesheet to whatever the default browser style is
			// for such an element
			if ( elem.style.display === "" && isHidden( elem ) ) {
				values[ index ] = jQuery._data( elem, "olddisplay", css_defaultDisplay(elem.nodeName) );
			}
		} else {

			if ( !values[ index ] ) {
				hidden = isHidden( elem );

				if ( display && display !== "none" || !hidden ) {
					jQuery._data( elem, "olddisplay", hidden ? display : jQuery.css( elem, "display" ) );
				}
			}
		}
	}

	// Set the display of most of the elements in a second loop
	// to avoid the constant reflow
	for ( index = 0; index < length; index++ ) {
		elem = elements[ index ];
		if ( !elem.style ) {
			continue;
		}
		if ( !show || elem.style.display === "none" || elem.style.display === "" ) {
			elem.style.display = show ? values[ index ] || "" : "none";
		}
	}

	return elements;
}

jQuery.fn.extend({
	css: function( name, value ) {
		return jQuery.access( this, function( elem, name, value ) {
			var len, styles,
				map = {},
				i = 0;

			if ( jQuery.isArray( name ) ) {
				styles = getStyles( elem );
				len = name.length;

				for ( ; i < len; i++ ) {
					map[ name[ i ] ] = jQuery.css( elem, name[ i ], false, styles );
				}

				return map;
			}

			return value !== undefined ?
				jQuery.style( elem, name, value ) :
				jQuery.css( elem, name );
		}, name, value, arguments.length > 1 );
	},
	show: function() {
		return showHide( this, true );
	},
	hide: function() {
		return showHide( this );
	},
	toggle: function( state ) {
		var bool = typeof state === "boolean";

		return this.each(function() {
			if ( bool ? state : isHidden( this ) ) {
				jQuery( this ).show();
			} else {
				jQuery( this ).hide();
			}
		});
	}
});

jQuery.extend({
	// Add in style property hooks for overriding the default
	// behavior of getting and setting a style property
	cssHooks: {
		opacity: {
			get: function( elem, computed ) {
				if ( computed ) {
					// We should always get a number back from opacity
					var ret = curCSS( elem, "opacity" );
					return ret === "" ? "1" : ret;
				}
			}
		}
	},

	// Exclude the following css properties to add px
	cssNumber: {
		"columnCount": true,
		"fillOpacity": true,
		"fontWeight": true,
		"lineHeight": true,
		"opacity": true,
		"orphans": true,
		"widows": true,
		"zIndex": true,
		"zoom": true
	},

	// Add in properties whose names you wish to fix before
	// setting or getting the value
	cssProps: {
		// normalize float css property
		"float": jQuery.support.cssFloat ? "cssFloat" : "styleFloat"
	},

	// Get and set the style property on a DOM Node
	style: function( elem, name, value, extra ) {
		// Don't set styles on text and comment nodes
		if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) {
			return;
		}

		// Make sure that we're working with the right name
		var ret, type, hooks,
			origName = jQuery.camelCase( name ),
			style = elem.style;

		name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( style, origName ) );

		// gets hook for the prefixed version
		// followed by the unprefixed version
		hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ];

		// Check if we're setting a value
		if ( value !== undefined ) {
			type = typeof value;

			// convert relative number strings (+= or -=) to relative numbers. #7345
			if ( type === "string" && (ret = rrelNum.exec( value )) ) {
				value = ( ret[1] + 1 ) * ret[2] + parseFloat( jQuery.css( elem, name ) );
				// Fixes bug #9237
				type = "number";
			}

			// Make sure that NaN and null values aren't set. See: #7116
			if ( value == null || type === "number" && isNaN( value ) ) {
				return;
			}

			// If a number was passed in, add 'px' to the (except for certain CSS properties)
			if ( type === "number" && !jQuery.cssNumber[ origName ] ) {
				value += "px";
			}

			// Fixes #8908, it can be done more correctly by specifing setters in cssHooks,
			// but it would mean to define eight (for every problematic property) identical functions
			if ( !jQuery.support.clearCloneStyle && value === "" && name.indexOf("background") === 0 ) {
				style[ name ] = "inherit";
			}

			// If a hook was provided, use that value, otherwise just set the specified value
			if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value, extra )) !== undefined ) {

				// Wrapped to prevent IE from throwing errors when 'invalid' values are provided
				// Fixes bug #5509
				try {
					style[ name ] = value;
				} catch(e) {}
			}

		} else {
			// If a hook was provided get the non-computed value from there
			if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) {
				return ret;
			}

			// Otherwise just get the value from the style object
			return style[ name ];
		}
	},

	css: function( elem, name, extra, styles ) {
		var num, val, hooks,
			origName = jQuery.camelCase( name );

		// Make sure that we're working with the right name
		name = jQuery.cssProps[ origName ] || ( jQuery.cssProps[ origName ] = vendorPropName( elem.style, origName ) );

		// gets hook for the prefixed version
		// followed by the unprefixed version
		hooks = jQuery.cssHooks[ name ] || jQuery.cssHooks[ origName ];

		// If a hook was provided get the computed value from there
		if ( hooks && "get" in hooks ) {
			val = hooks.get( elem, true, extra );
		}

		// Otherwise, if a way to get the computed value exists, use that
		if ( val === undefined ) {
			val = curCSS( elem, name, styles );
		}

		//convert "normal" to computed value
		if ( val === "normal" && name in cssNormalTransform ) {
			val = cssNormalTransform[ name ];
		}

		// Return, converting to number if forced or a qualifier was provided and val looks numeric
		if ( extra === "" || extra ) {
			num = parseFloat( val );
			return extra === true || jQuery.isNumeric( num ) ? num || 0 : val;
		}
		return val;
	},

	// A method for quickly swapping in/out CSS properties to get correct calculations
	swap: function( elem, options, callback, args ) {
		var ret, name,
			old = {};

		// Remember the old values, and insert the new ones
		for ( name in options ) {
			old[ name ] = elem.style[ name ];
			elem.style[ name ] = options[ name ];
		}

		ret = callback.apply( elem, args || [] );

		// Revert the old values
		for ( name in options ) {
			elem.style[ name ] = old[ name ];
		}

		return ret;
	}
});

// NOTE: we've included the "window" in window.getComputedStyle
// because jsdom on node.js will break without it.
if ( window.getComputedStyle ) {
	getStyles = function( elem ) {
		return window.getComputedStyle( elem, null );
	};

	curCSS = function( elem, name, _computed ) {
		var width, minWidth, maxWidth,
			computed = _computed || getStyles( elem ),

			// getPropertyValue is only needed for .css('filter') in IE9, see #12537
			ret = computed ? computed.getPropertyValue( name ) || computed[ name ] : undefined,
			style = elem.style;

		if ( computed ) {

			if ( ret === "" && !jQuery.contains( elem.ownerDocument, elem ) ) {
				ret = jQuery.style( elem, name );
			}

			// A tribute to the "awesome hack by Dean Edwards"
			// Chrome < 17 and Safari 5.0 uses "computed value" instead of "used value" for margin-right
			// Safari 5.1.7 (at least) returns percentage for a larger set of values, but width seems to be reliably pixels
			// this is against the CSSOM draft spec: http://dev.w3.org/csswg/cssom/#resolved-values
			if ( rnumnonpx.test( ret ) && rmargin.test( name ) ) {

				// Remember the original values
				width = style.width;
				minWidth = style.minWidth;
				maxWidth = style.maxWidth;

				// Put in the new values to get a computed value out
				style.minWidth = style.maxWidth = style.width = ret;
				ret = computed.width;

				// Revert the changed values
				style.width = width;
				style.minWidth = minWidth;
				style.maxWidth = maxWidth;
			}
		}

		return ret;
	};
} else if ( document.documentElement.currentStyle ) {
	getStyles = function( elem ) {
		return elem.currentStyle;
	};

	curCSS = function( elem, name, _computed ) {
		var left, rs, rsLeft,
			computed = _computed || getStyles( elem ),
			ret = computed ? computed[ name ] : undefined,
			style = elem.style;

		// Avoid setting ret to empty string here
		// so we don't default to auto
		if ( ret == null && style && style[ name ] ) {
			ret = style[ name ];
		}

		// From the awesome hack by Dean Edwards
		// http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291

		// If we're not dealing with a regular pixel number
		// but a number that has a weird ending, we need to convert it to pixels
		// but not position css attributes, as those are proportional to the parent element instead
		// and we can't measure the parent instead because it might trigger a "stacking dolls" problem
		if ( rnumnonpx.test( ret ) && !rposition.test( name ) ) {

			// Remember the original values
			left = style.left;
			rs = elem.runtimeStyle;
			rsLeft = rs && rs.left;

			// Put in the new values to get a computed value out
			if ( rsLeft ) {
				rs.left = elem.currentStyle.left;
			}
			style.left = name === "fontSize" ? "1em" : ret;
			ret = style.pixelLeft + "px";

			// Revert the changed values
			style.left = left;
			if ( rsLeft ) {
				rs.left = rsLeft;
			}
		}

		return ret === "" ? "auto" : ret;
	};
}

function setPositiveNumber( elem, value, subtract ) {
	var matches = rnumsplit.exec( value );
	return matches ?
		// Guard against undefined "subtract", e.g., when used as in cssHooks
		Math.max( 0, matches[ 1 ] - ( subtract || 0 ) ) + ( matches[ 2 ] || "px" ) :
		value;
}

function augmentWidthOrHeight( elem, name, extra, isBorderBox, styles ) {
	var i = extra === ( isBorderBox ? "border" : "content" ) ?
		// If we already have the right measurement, avoid augmentation
		4 :
		// Otherwise initialize for horizontal or vertical properties
		name === "width" ? 1 : 0,

		val = 0;

	for ( ; i < 4; i += 2 ) {
		// both box models exclude margin, so add it if we want it
		if ( extra === "margin" ) {
			val += jQuery.css( elem, extra + cssExpand[ i ], true, styles );
		}

		if ( isBorderBox ) {
			// border-box includes padding, so remove it if we want content
			if ( extra === "content" ) {
				val -= jQuery.css( elem, "padding" + cssExpand[ i ], true, styles );
			}

			// at this point, extra isn't border nor margin, so remove border
			if ( extra !== "margin" ) {
				val -= jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles );
			}
		} else {
			// at this point, extra isn't content, so add padding
			val += jQuery.css( elem, "padding" + cssExpand[ i ], true, styles );

			// at this point, extra isn't content nor padding, so add border
			if ( extra !== "padding" ) {
				val += jQuery.css( elem, "border" + cssExpand[ i ] + "Width", true, styles );
			}
		}
	}

	return val;
}

function getWidthOrHeight( elem, name, extra ) {

	// Start with offset property, which is equivalent to the border-box value
	var valueIsBorderBox = true,
		val = name === "width" ? elem.offsetWidth : elem.offsetHeight,
		styles = getStyles( elem ),
		isBorderBox = jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box";

	// some non-html elements return undefined for offsetWidth, so check for null/undefined
	// svg - https://bugzilla.mozilla.org/show_bug.cgi?id=649285
	// MathML - https://bugzilla.mozilla.org/show_bug.cgi?id=491668
	if ( val <= 0 || val == null ) {
		// Fall back to computed then uncomputed css if necessary
		val = curCSS( elem, name, styles );
		if ( val < 0 || val == null ) {
			val = elem.style[ name ];
		}

		// Computed unit is not pixels. Stop here and return.
		if ( rnumnonpx.test(val) ) {
			return val;
		}

		// we need the check for style in case a browser which returns unreliable values
		// for getComputedStyle silently falls back to the reliable elem.style
		valueIsBorderBox = isBorderBox && ( jQuery.support.boxSizingReliable || val === elem.style[ name ] );

		// Normalize "", auto, and prepare for extra
		val = parseFloat( val ) || 0;
	}

	// use the active box-sizing model to add/subtract irrelevant styles
	return ( val +
		augmentWidthOrHeight(
			elem,
			name,
			extra || ( isBorderBox ? "border" : "content" ),
			valueIsBorderBox,
			styles
		)
	) + "px";
}

// Try to determine the default display value of an element
function css_defaultDisplay( nodeName ) {
	var doc = document,
		display = elemdisplay[ nodeName ];

	if ( !display ) {
		display = actualDisplay( nodeName, doc );

		// If the simple way fails, read from inside an iframe
		if ( display === "none" || !display ) {
			// Use the already-created iframe if possible
			iframe = ( iframe ||
				jQuery("<iframe frameborder='0' width='0' height='0'/>")
				.css( "cssText", "display:block !important" )
			).appendTo( doc.documentElement );

			// Always write a new HTML skeleton so Webkit and Firefox don't choke on reuse
			doc = ( iframe[0].contentWindow || iframe[0].contentDocument ).document;
			doc.write("<!doctype html><html><body>");
			doc.close();

			display = actualDisplay( nodeName, doc );
			iframe.detach();
		}

		// Store the correct default display
		elemdisplay[ nodeName ] = display;
	}

	return display;
}

// Called ONLY from within css_defaultDisplay
function actualDisplay( name, doc ) {
	var elem = jQuery( doc.createElement( name ) ).appendTo( doc.body ),
		display = jQuery.css( elem[0], "display" );
	elem.remove();
	return display;
}

jQuery.each([ "height", "width" ], function( i, name ) {
	jQuery.cssHooks[ name ] = {
		get: function( elem, computed, extra ) {
			if ( computed ) {
				// certain elements can have dimension info if we invisibly show them
				// however, it must have a current display style that would benefit from this
				return elem.offsetWidth === 0 && rdisplayswap.test( jQuery.css( elem, "display" ) ) ?
					jQuery.swap( elem, cssShow, function() {
						return getWidthOrHeight( elem, name, extra );
					}) :
					getWidthOrHeight( elem, name, extra );
			}
		},

		set: function( elem, value, extra ) {
			var styles = extra && getStyles( elem );
			return setPositiveNumber( elem, value, extra ?
				augmentWidthOrHeight(
					elem,
					name,
					extra,
					jQuery.support.boxSizing && jQuery.css( elem, "boxSizing", false, styles ) === "border-box",
					styles
				) : 0
			);
		}
	};
});

if ( !jQuery.support.opacity ) {
	jQuery.cssHooks.opacity = {
		get: function( elem, computed ) {
			// IE uses filters for opacity
			return ropacity.test( (computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "" ) ?
				( 0.01 * parseFloat( RegExp.$1 ) ) + "" :
				computed ? "1" : "";
		},

		set: function( elem, value ) {
			var style = elem.style,
				currentStyle = elem.currentStyle,
				opacity = jQuery.isNumeric( value ) ? "alpha(opacity=" + value * 100 + ")" : "",
				filter = currentStyle && currentStyle.filter || style.filter || "";

			// IE has trouble with opacity if it does not have layout
			// Force it by setting the zoom level
			style.zoom = 1;

			// if setting opacity to 1, and no other filters exist - attempt to remove filter attribute #6652
			// if value === "", then remove inline opacity #12685
			if ( ( value >= 1 || value === "" ) &&
					jQuery.trim( filter.replace( ralpha, "" ) ) === "" &&
					style.removeAttribute ) {

				// Setting style.filter to null, "" & " " still leave "filter:" in the cssText
				// if "filter:" is present at all, clearType is disabled, we want to avoid this
				// style.removeAttribute is IE Only, but so apparently is this code path...
				style.removeAttribute( "filter" );

				// if there is no filter style applied in a css rule or unset inline opacity, we are done
				if ( value === "" || currentStyle && !currentStyle.filter ) {
					return;
				}
			}

			// otherwise, set new filter values
			style.filter = ralpha.test( filter ) ?
				filter.replace( ralpha, opacity ) :
				filter + " " + opacity;
		}
	};
}

// These hooks cannot be added until DOM ready because the support test
// for it is not run until after DOM ready
jQuery(function() {
	if ( !jQuery.support.reliableMarginRight ) {
		jQuery.cssHooks.marginRight = {
			get: function( elem, computed ) {
				if ( computed ) {
					// WebKit Bug 13343 - getComputedStyle returns wrong value for margin-right
					// Work around by temporarily setting element display to inline-block
					return jQuery.swap( elem, { "display": "inline-block" },
						curCSS, [ elem, "marginRight" ] );
				}
			}
		};
	}

	// Webkit bug: https://bugs.webkit.org/show_bug.cgi?id=29084
	// getComputedStyle returns percent when specified for top/left/bottom/right
	// rather than make the css module depend on the offset module, we just check for it here
	if ( !jQuery.support.pixelPosition && jQuery.fn.position ) {
		jQuery.each( [ "top", "left" ], function( i, prop ) {
			jQuery.cssHooks[ prop ] = {
				get: function( elem, computed ) {
					if ( computed ) {
						computed = curCSS( elem, prop );
						// if curCSS returns percentage, fallback to offset
						return rnumnonpx.test( computed ) ?
							jQuery( elem ).position()[ prop ] + "px" :
							computed;
					}
				}
			};
		});
	}

});

if ( jQuery.expr && jQuery.expr.filters ) {
	jQuery.expr.filters.hidden = function( elem ) {
		// Support: Opera <= 12.12
		// Opera reports offsetWidths and offsetHeights less than zero on some elements
		return elem.offsetWidth <= 0 && elem.offsetHeight <= 0 ||
			(!jQuery.support.reliableHiddenOffsets && ((elem.style && elem.style.display) || jQuery.css( elem, "display" )) === "none");
	};

	jQuery.expr.filters.visible = function( elem ) {
		return !jQuery.expr.filters.hidden( elem );
	};
}

// These hooks are used by animate to expand properties
jQuery.each({
	margin: "",
	padding: "",
	border: "Width"
}, function( prefix, suffix ) {
	jQuery.cssHooks[ prefix + suffix ] = {
		expand: function( value ) {
			var i = 0,
				expanded = {},

				// assumes a single number if not a string
				parts = typeof value === "string" ? value.split(" ") : [ value ];

			for ( ; i < 4; i++ ) {
				expanded[ prefix + cssExpand[ i ] + suffix ] =
					parts[ i ] || parts[ i - 2 ] || parts[ 0 ];
			}

			return expanded;
		}
	};

	if ( !rmargin.test( prefix ) ) {
		jQuery.cssHooks[ prefix + suffix ].set = setPositiveNumber;
	}
});
var r20 = /%20/g,
	rbracket = /\[\]$/,
	rCRLF = /\r?\n/g,
	rsubmitterTypes = /^(?:submit|button|image|reset|file)$/i,
	rsubmittable = /^(?:input|select|textarea|keygen)/i;

jQuery.fn.extend({
	serialize: function() {
		return jQuery.param( this.serializeArray() );
	},
	serializeArray: function() {
		return this.map(function(){
			// Can add propHook for "elements" to filter or add form elements
			var elements = jQuery.prop( this, "elements" );
			return elements ? jQuery.makeArray( elements ) : this;
		})
		.filter(function(){
			var type = this.type;
			// Use .is(":disabled") so that fieldset[disabled] works
			return this.name && !jQuery( this ).is( ":disabled" ) &&
				rsubmittable.test( this.nodeName ) && !rsubmitterTypes.test( type ) &&
				( this.checked || !manipulation_rcheckableType.test( type ) );
		})
		.map(function( i, elem ){
			var val = jQuery( this ).val();

			return val == null ?
				null :
				jQuery.isArray( val ) ?
					jQuery.map( val, function( val ){
						return { name: elem.name, value: val.replace( rCRLF, "\r\n" ) };
					}) :
					{ name: elem.name, value: val.replace( rCRLF, "\r\n" ) };
		}).get();
	}
});

//Serialize an array of form elements or a set of
//key/values into a query string
jQuery.param = function( a, traditional ) {
	var prefix,
		s = [],
		add = function( key, value ) {
			// If value is a function, invoke it and return its value
			value = jQuery.isFunction( value ) ? value() : ( value == null ? "" : value );
			s[ s.length ] = encodeURIComponent( key ) + "=" + encodeURIComponent( value );
		};

	// Set traditional to true for jQuery <= 1.3.2 behavior.
	if ( traditional === undefined ) {
		traditional = jQuery.ajaxSettings && jQuery.ajaxSettings.traditional;
	}

	// If an array was passed in, assume that it is an array of form elements.
	if ( jQuery.isArray( a ) || ( a.jquery && !jQuery.isPlainObject( a ) ) ) {
		// Serialize the form elements
		jQuery.each( a, function() {
			add( this.name, this.value );
		});

	} else {
		// If traditional, encode the "old" way (the way 1.3.2 or older
		// did it), otherwise encode params recursively.
		for ( prefix in a ) {
			buildParams( prefix, a[ prefix ], traditional, add );
		}
	}

	// Return the resulting serialization
	return s.join( "&" ).replace( r20, "+" );
};

function buildParams( prefix, obj, traditional, add ) {
	var name;

	if ( jQuery.isArray( obj ) ) {
		// Serialize array item.
		jQuery.each( obj, function( i, v ) {
			if ( traditional || rbracket.test( prefix ) ) {
				// Treat each array item as a scalar.
				add( prefix, v );

			} else {
				// Item is non-scalar (array or object), encode its numeric index.
				buildParams( prefix + "[" + ( typeof v === "object" ? i : "" ) + "]", v, traditional, add );
			}
		});

	} else if ( !traditional && jQuery.type( obj ) === "object" ) {
		// Serialize object item.
		for ( name in obj ) {
			buildParams( prefix + "[" + name + "]", obj[ name ], traditional, add );
		}

	} else {
		// Serialize scalar item.
		add( prefix, obj );
	}
}
jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " +
	"mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " +
	"change select submit keydown keypress keyup error contextmenu").split(" "), function( i, name ) {

	// Handle event binding
	jQuery.fn[ name ] = function( data, fn ) {
		return arguments.length > 0 ?
			this.on( name, null, data, fn ) :
			this.trigger( name );
	};
});

jQuery.fn.hover = function( fnOver, fnOut ) {
	return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver );
};
var
	// Document location
	ajaxLocParts,
	ajaxLocation,
	ajax_nonce = jQuery.now(),

	ajax_rquery = /\?/,
	rhash = /#.*$/,
	rts = /([?&])_=[^&]*/,
	rheaders = /^(.*?):[ \t]*([^\r\n]*)\r?$/mg, // IE leaves an \r character at EOL
	// #7653, #8125, #8152: local protocol detection
	rlocalProtocol = /^(?:about|app|app-storage|.+-extension|file|res|widget):$/,
	rnoContent = /^(?:GET|HEAD)$/,
	rprotocol = /^\/\//,
	rurl = /^([\w.+-]+:)(?:\/\/([^\/?#:]*)(?::(\d+)|)|)/,

	// Keep a copy of the old load method
	_load = jQuery.fn.load,

	/* Prefilters
	 * 1) They are useful to introduce custom dataTypes (see ajax/jsonp.js for an example)
	 * 2) These are called:
	 *    - BEFORE asking for a transport
	 *    - AFTER param serialization (s.data is a string if s.processData is true)
	 * 3) key is the dataType
	 * 4) the catchall symbol "*" can be used
	 * 5) execution will start with transport dataType and THEN continue down to "*" if needed
	 */
	prefilters = {},

	/* Transports bindings
	 * 1) key is the dataType
	 * 2) the catchall symbol "*" can be used
	 * 3) selection will start with transport dataType and THEN go to "*" if needed
	 */
	transports = {},

	// Avoid comment-prolog char sequence (#10098); must appease lint and evade compression
	allTypes = "*/".concat("*");

// #8138, IE may throw an exception when accessing
// a field from window.location if document.domain has been set
try {
	ajaxLocation = location.href;
} catch( e ) {
	// Use the href attribute of an A element
	// since IE will modify it given document.location
	ajaxLocation = document.createElement( "a" );
	ajaxLocation.href = "";
	ajaxLocation = ajaxLocation.href;
}

// Segment location into parts
ajaxLocParts = rurl.exec( ajaxLocation.toLowerCase() ) || [];

// Base "constructor" for jQuery.ajaxPrefilter and jQuery.ajaxTransport
function addToPrefiltersOrTransports( structure ) {

	// dataTypeExpression is optional and defaults to "*"
	return function( dataTypeExpression, func ) {

		if ( typeof dataTypeExpression !== "string" ) {
			func = dataTypeExpression;
			dataTypeExpression = "*";
		}

		var dataType,
			i = 0,
			dataTypes = dataTypeExpression.toLowerCase().match( core_rnotwhite ) || [];

		if ( jQuery.isFunction( func ) ) {
			// For each dataType in the dataTypeExpression
			while ( (dataType = dataTypes[i++]) ) {
				// Prepend if requested
				if ( dataType[0] === "+" ) {
					dataType = dataType.slice( 1 ) || "*";
					(structure[ dataType ] = structure[ dataType ] || []).unshift( func );

				// Otherwise append
				} else {
					(structure[ dataType ] = structure[ dataType ] || []).push( func );
				}
			}
		}
	};
}

// Base inspection function for prefilters and transports
function inspectPrefiltersOrTransports( structure, options, originalOptions, jqXHR ) {

	var inspected = {},
		seekingTransport = ( structure === transports );

	function inspect( dataType ) {
		var selected;
		inspected[ dataType ] = true;
		jQuery.each( structure[ dataType ] || [], function( _, prefilterOrFactory ) {
			var dataTypeOrTransport = prefilterOrFactory( options, originalOptions, jqXHR );
			if( typeof dataTypeOrTransport === "string" && !seekingTransport && !inspected[ dataTypeOrTransport ] ) {
				options.dataTypes.unshift( dataTypeOrTransport );
				inspect( dataTypeOrTransport );
				return false;
			} else if ( seekingTransport ) {
				return !( selected = dataTypeOrTransport );
			}
		});
		return selected;
	}

	return inspect( options.dataTypes[ 0 ] ) || !inspected[ "*" ] && inspect( "*" );
}

// A special extend for ajax options
// that takes "flat" options (not to be deep extended)
// Fixes #9887
function ajaxExtend( target, src ) {
	var deep, key,
		flatOptions = jQuery.ajaxSettings.flatOptions || {};

	for ( key in src ) {
		if ( src[ key ] !== undefined ) {
			( flatOptions[ key ] ? target : ( deep || (deep = {}) ) )[ key ] = src[ key ];
		}
	}
	if ( deep ) {
		jQuery.extend( true, target, deep );
	}

	return target;
}

jQuery.fn.load = function( url, params, callback ) {
	if ( typeof url !== "string" && _load ) {
		return _load.apply( this, arguments );
	}

	var selector, response, type,
		self = this,
		off = url.indexOf(" ");

	if ( off >= 0 ) {
		selector = url.slice( off, url.length );
		url = url.slice( 0, off );
	}

	// If it's a function
	if ( jQuery.isFunction( params ) ) {

		// We assume that it's the callback
		callback = params;
		params = undefined;

	// Otherwise, build a param string
	} else if ( params && typeof params === "object" ) {
		type = "POST";
	}

	// If we have elements to modify, make the request
	if ( self.length > 0 ) {
		jQuery.ajax({
			url: url,

			// if "type" variable is undefined, then "GET" method will be used
			type: type,
			dataType: "html",
			data: params
		}).done(function( responseText ) {

			// Save response for use in complete callback
			response = arguments;

			self.html( selector ?

				// If a selector was specified, locate the right elements in a dummy div
				// Exclude scripts to avoid IE 'Permission Denied' errors
				jQuery("<div>").append( jQuery.parseHTML( responseText ) ).find( selector ) :

				// Otherwise use the full result
				responseText );

		}).complete( callback && function( jqXHR, status ) {
			self.each( callback, response || [ jqXHR.responseText, status, jqXHR ] );
		});
	}

	return this;
};

// Attach a bunch of functions for handling common AJAX events
jQuery.each( [ "ajaxStart", "ajaxStop", "ajaxComplete", "ajaxError", "ajaxSuccess", "ajaxSend" ], function( i, type ){
	jQuery.fn[ type ] = function( fn ){
		return this.on( type, fn );
	};
});

jQuery.each( [ "get", "post" ], function( i, method ) {
	jQuery[ method ] = function( url, data, callback, type ) {
		// shift arguments if data argument was omitted
		if ( jQuery.isFunction( data ) ) {
			type = type || callback;
			callback = data;
			data = undefined;
		}

		return jQuery.ajax({
			url: url,
			type: method,
			dataType: type,
			data: data,
			success: callback
		});
	};
});

jQuery.extend({

	// Counter for holding the number of active queries
	active: 0,

	// Last-Modified header cache for next request
	lastModified: {},
	etag: {},

	ajaxSettings: {
		url: ajaxLocation,
		type: "GET",
		isLocal: rlocalProtocol.test( ajaxLocParts[ 1 ] ),
		global: true,
		processData: true,
		async: true,
		contentType: "application/x-www-form-urlencoded; charset=UTF-8",
		/*
		timeout: 0,
		data: null,
		dataType: null,
		username: null,
		password: null,
		cache: null,
		throws: false,
		traditional: false,
		headers: {},
		*/

		accepts: {
			"*": allTypes,
			text: "text/plain",
			html: "text/html",
			xml: "application/xml, text/xml",
			json: "application/json, text/javascript"
		},

		contents: {
			xml: /xml/,
			html: /html/,
			json: /json/
		},

		responseFields: {
			xml: "responseXML",
			text: "responseText"
		},

		// Data converters
		// Keys separate source (or catchall "*") and destination types with a single space
		converters: {

			// Convert anything to text
			"* text": window.String,

			// Text to html (true = no transformation)
			"text html": true,

			// Evaluate text as a json expression
			"text json": jQuery.parseJSON,

			// Parse text as xml
			"text xml": jQuery.parseXML
		},

		// For options that shouldn't be deep extended:
		// you can add your own custom options here if
		// and when you create one that shouldn't be
		// deep extended (see ajaxExtend)
		flatOptions: {
			url: true,
			context: true
		}
	},

	// Creates a full fledged settings object into target
	// with both ajaxSettings and settings fields.
	// If target is omitted, writes into ajaxSettings.
	ajaxSetup: function( target, settings ) {
		return settings ?

			// Building a settings object
			ajaxExtend( ajaxExtend( target, jQuery.ajaxSettings ), settings ) :

			// Extending ajaxSettings
			ajaxExtend( jQuery.ajaxSettings, target );
	},

	ajaxPrefilter: addToPrefiltersOrTransports( prefilters ),
	ajaxTransport: addToPrefiltersOrTransports( transports ),

	// Main method
	ajax: function( url, options ) {

		// If url is an object, simulate pre-1.5 signature
		if ( typeof url === "object" ) {
			options = url;
			url = undefined;
		}

		// Force options to be an object
		options = options || {};

		var // Cross-domain detection vars
			parts,
			// Loop variable
			i,
			// URL without anti-cache param
			cacheURL,
			// Response headers as string
			responseHeadersString,
			// timeout handle
			timeoutTimer,

			// To know if global events are to be dispatched
			fireGlobals,

			transport,
			// Response headers
			responseHeaders,
			// Create the final options object
			s = jQuery.ajaxSetup( {}, options ),
			// Callbacks context
			callbackContext = s.context || s,
			// Context for global events is callbackContext if it is a DOM node or jQuery collection
			globalEventContext = s.context && ( callbackContext.nodeType || callbackContext.jquery ) ?
				jQuery( callbackContext ) :
				jQuery.event,
			// Deferreds
			deferred = jQuery.Deferred(),
			completeDeferred = jQuery.Callbacks("once memory"),
			// Status-dependent callbacks
			statusCode = s.statusCode || {},
			// Headers (they are sent all at once)
			requestHeaders = {},
			requestHeadersNames = {},
			// The jqXHR state
			state = 0,
			// Default abort message
			strAbort = "canceled",
			// Fake xhr
			jqXHR = {
				readyState: 0,

				// Builds headers hashtable if needed
				getResponseHeader: function( key ) {
					var match;
					if ( state === 2 ) {
						if ( !responseHeaders ) {
							responseHeaders = {};
							while ( (match = rheaders.exec( responseHeadersString )) ) {
								responseHeaders[ match[1].toLowerCase() ] = match[ 2 ];
							}
						}
						match = responseHeaders[ key.toLowerCase() ];
					}
					return match == null ? null : match;
				},

				// Raw string
				getAllResponseHeaders: function() {
					return state === 2 ? responseHeadersString : null;
				},

				// Caches the header
				setRequestHeader: function( name, value ) {
					var lname = name.toLowerCase();
					if ( !state ) {
						name = requestHeadersNames[ lname ] = requestHeadersNames[ lname ] || name;
						requestHeaders[ name ] = value;
					}
					return this;
				},

				// Overrides response content-type header
				overrideMimeType: function( type ) {
					if ( !state ) {
						s.mimeType = type;
					}
					return this;
				},

				// Status-dependent callbacks
				statusCode: function( map ) {
					var code;
					if ( map ) {
						if ( state < 2 ) {
							for ( code in map ) {
								// Lazy-add the new callback in a way that preserves old ones
								statusCode[ code ] = [ statusCode[ code ], map[ code ] ];
							}
						} else {
							// Execute the appropriate callbacks
							jqXHR.always( map[ jqXHR.status ] );
						}
					}
					return this;
				},

				// Cancel the request
				abort: function( statusText ) {
					var finalText = statusText || strAbort;
					if ( transport ) {
						transport.abort( finalText );
					}
					done( 0, finalText );
					return this;
				}
			};

		// Attach deferreds
		deferred.promise( jqXHR ).complete = completeDeferred.add;
		jqXHR.success = jqXHR.done;
		jqXHR.error = jqXHR.fail;

		// Remove hash character (#7531: and string promotion)
		// Add protocol if not provided (#5866: IE7 issue with protocol-less urls)
		// Handle falsy url in the settings object (#10093: consistency with old signature)
		// We also use the url parameter if available
		s.url = ( ( url || s.url || ajaxLocation ) + "" ).replace( rhash, "" ).replace( rprotocol, ajaxLocParts[ 1 ] + "//" );

		// Alias method option to type as per ticket #12004
		s.type = options.method || options.type || s.method || s.type;

		// Extract dataTypes list
		s.dataTypes = jQuery.trim( s.dataType || "*" ).toLowerCase().match( core_rnotwhite ) || [""];

		// A cross-domain request is in order when we have a protocol:host:port mismatch
		if ( s.crossDomain == null ) {
			parts = rurl.exec( s.url.toLowerCase() );
			s.crossDomain = !!( parts &&
				( parts[ 1 ] !== ajaxLocParts[ 1 ] || parts[ 2 ] !== ajaxLocParts[ 2 ] ||
					( parts[ 3 ] || ( parts[ 1 ] === "http:" ? 80 : 443 ) ) !=
						( ajaxLocParts[ 3 ] || ( ajaxLocParts[ 1 ] === "http:" ? 80 : 443 ) ) )
			);
		}

		// Convert data if not already a string
		if ( s.data && s.processData && typeof s.data !== "string" ) {
			s.data = jQuery.param( s.data, s.traditional );
		}

		// Apply prefilters
		inspectPrefiltersOrTransports( prefilters, s, options, jqXHR );

		// If request was aborted inside a prefilter, stop there
		if ( state === 2 ) {
			return jqXHR;
		}

		// We can fire global events as of now if asked to
		fireGlobals = s.global;

		// Watch for a new set of requests
		if ( fireGlobals && jQuery.active++ === 0 ) {
			jQuery.event.trigger("ajaxStart");
		}

		// Uppercase the type
		s.type = s.type.toUpperCase();

		// Determine if request has content
		s.hasContent = !rnoContent.test( s.type );

		// Save the URL in case we're toying with the If-Modified-Since
		// and/or If-None-Match header later on
		cacheURL = s.url;

		// More options handling for requests with no content
		if ( !s.hasContent ) {

			// If data is available, append data to url
			if ( s.data ) {
				cacheURL = ( s.url += ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + s.data );
				// #9682: remove data so that it's not used in an eventual retry
				delete s.data;
			}

			// Add anti-cache in url if needed
			if ( s.cache === false ) {
				s.url = rts.test( cacheURL ) ?

					// If there is already a '_' parameter, set its value
					cacheURL.replace( rts, "$1_=" + ajax_nonce++ ) :

					// Otherwise add one to the end
					cacheURL + ( ajax_rquery.test( cacheURL ) ? "&" : "?" ) + "_=" + ajax_nonce++;
			}
		}

		// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode.
		if ( s.ifModified ) {
			if ( jQuery.lastModified[ cacheURL ] ) {
				jqXHR.setRequestHeader( "If-Modified-Since", jQuery.lastModified[ cacheURL ] );
			}
			if ( jQuery.etag[ cacheURL ] ) {
				jqXHR.setRequestHeader( "If-None-Match", jQuery.etag[ cacheURL ] );
			}
		}

		// Set the correct header, if data is being sent
		if ( s.data && s.hasContent && s.contentType !== false || options.contentType ) {
			jqXHR.setRequestHeader( "Content-Type", s.contentType );
		}

		// Set the Accepts header for the server, depending on the dataType
		jqXHR.setRequestHeader(
			"Accept",
			s.dataTypes[ 0 ] && s.accepts[ s.dataTypes[0] ] ?
				s.accepts[ s.dataTypes[0] ] + ( s.dataTypes[ 0 ] !== "*" ? ", " + allTypes + "; q=0.01" : "" ) :
				s.accepts[ "*" ]
		);

		// Check for headers option
		for ( i in s.headers ) {
			jqXHR.setRequestHeader( i, s.headers[ i ] );
		}

		// Allow custom headers/mimetypes and early abort
		if ( s.beforeSend && ( s.beforeSend.call( callbackContext, jqXHR, s ) === false || state === 2 ) ) {
			// Abort if not done already and return
			return jqXHR.abort();
		}

		// aborting is no longer a cancellation
		strAbort = "abort";

		// Install callbacks on deferreds
		for ( i in { success: 1, error: 1, complete: 1 } ) {
			jqXHR[ i ]( s[ i ] );
		}

		// Get transport
		transport = inspectPrefiltersOrTransports( transports, s, options, jqXHR );

		// If no transport, we auto-abort
		if ( !transport ) {
			done( -1, "No Transport" );
		} else {
			jqXHR.readyState = 1;

			// Send global event
			if ( fireGlobals ) {
				globalEventContext.trigger( "ajaxSend", [ jqXHR, s ] );
			}
			// Timeout
			if ( s.async && s.timeout > 0 ) {
				timeoutTimer = setTimeout(function() {
					jqXHR.abort("timeout");
				}, s.timeout );
			}

			try {
				state = 1;
				transport.send( requestHeaders, done );
			} catch ( e ) {
				// Propagate exception as error if not done
				if ( state < 2 ) {
					done( -1, e );
				// Simply rethrow otherwise
				} else {
					throw e;
				}
			}
		}

		// Callback for when everything is done
		function done( status, nativeStatusText, responses, headers ) {
			var isSuccess, success, error, response, modified,
				statusText = nativeStatusText;

			// Called once
			if ( state === 2 ) {
				return;
			}

			// State is "done" now
			state = 2;

			// Clear timeout if it exists
			if ( timeoutTimer ) {
				clearTimeout( timeoutTimer );
			}

			// Dereference transport for early garbage collection
			// (no matter how long the jqXHR object will be used)
			transport = undefined;

			// Cache response headers
			responseHeadersString = headers || "";

			// Set readyState
			jqXHR.readyState = status > 0 ? 4 : 0;

			// Get response data
			if ( responses ) {
				response = ajaxHandleResponses( s, jqXHR, responses );
			}

			// If successful, handle type chaining
			if ( status >= 200 && status < 300 || status === 304 ) {

				// Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode.
				if ( s.ifModified ) {
					modified = jqXHR.getResponseHeader("Last-Modified");
					if ( modified ) {
						jQuery.lastModified[ cacheURL ] = modified;
					}
					modified = jqXHR.getResponseHeader("etag");
					if ( modified ) {
						jQuery.etag[ cacheURL ] = modified;
					}
				}

				// if no content
				if ( status === 204 ) {
					isSuccess = true;
					statusText = "nocontent";

				// if not modified
				} else if ( status === 304 ) {
					isSuccess = true;
					statusText = "notmodified";

				// If we have data, let's convert it
				} else {
					isSuccess = ajaxConvert( s, response );
					statusText = isSuccess.state;
					success = isSuccess.data;
					error = isSuccess.error;
					isSuccess = !error;
				}
			} else {
				// We extract error from statusText
				// then normalize statusText and status for non-aborts
				error = statusText;
				if ( status || !statusText ) {
					statusText = "error";
					if ( status < 0 ) {
						status = 0;
					}
				}
			}

			// Set data for the fake xhr object
			jqXHR.status = status;
			jqXHR.statusText = ( nativeStatusText || statusText ) + "";

			// Success/Error
			if ( isSuccess ) {
				deferred.resolveWith( callbackContext, [ success, statusText, jqXHR ] );
			} else {
				deferred.rejectWith( callbackContext, [ jqXHR, statusText, error ] );
			}

			// Status-dependent callbacks
			jqXHR.statusCode( statusCode );
			statusCode = undefined;

			if ( fireGlobals ) {
				globalEventContext.trigger( isSuccess ? "ajaxSuccess" : "ajaxError",
					[ jqXHR, s, isSuccess ? success : error ] );
			}

			// Complete
			completeDeferred.fireWith( callbackContext, [ jqXHR, statusText ] );

			if ( fireGlobals ) {
				globalEventContext.trigger( "ajaxComplete", [ jqXHR, s ] );
				// Handle the global AJAX counter
				if ( !( --jQuery.active ) ) {
					jQuery.event.trigger("ajaxStop");
				}
			}
		}

		return jqXHR;
	},

	getScript: function( url, callback ) {
		return jQuery.get( url, undefined, callback, "script" );
	},

	getJSON: function( url, data, callback ) {
		return jQuery.get( url, data, callback, "json" );
	}
});

/* Handles responses to an ajax request:
 * - sets all responseXXX fields accordingly
 * - finds the right dataType (mediates between content-type and expected dataType)
 * - returns the corresponding response
 */
function ajaxHandleResponses( s, jqXHR, responses ) {
	var firstDataType, ct, finalDataType, type,
		contents = s.contents,
		dataTypes = s.dataTypes,
		responseFields = s.responseFields;

	// Fill responseXXX fields
	for ( type in responseFields ) {
		if ( type in responses ) {
			jqXHR[ responseFields[type] ] = responses[ type ];
		}
	}

	// Remove auto dataType and get content-type in the process
	while( dataTypes[ 0 ] === "*" ) {
		dataTypes.shift();
		if ( ct === undefined ) {
			ct = s.mimeType || jqXHR.getResponseHeader("Content-Type");
		}
	}

	// Check if we're dealing with a known content-type
	if ( ct ) {
		for ( type in contents ) {
			if ( contents[ type ] && contents[ type ].test( ct ) ) {
				dataTypes.unshift( type );
				break;
			}
		}
	}

	// Check to see if we have a response for the expected dataType
	if ( dataTypes[ 0 ] in responses ) {
		finalDataType = dataTypes[ 0 ];
	} else {
		// Try convertible dataTypes
		for ( type in responses ) {
			if ( !dataTypes[ 0 ] || s.converters[ type + " " + dataTypes[0] ] ) {
				finalDataType = type;
				break;
			}
			if ( !firstDataType ) {
				firstDataType = type;
			}
		}
		// Or just use first one
		finalDataType = finalDataType || firstDataType;
	}

	// If we found a dataType
	// We add the dataType to the list if needed
	// and return the corresponding response
	if ( finalDataType ) {
		if ( finalDataType !== dataTypes[ 0 ] ) {
			dataTypes.unshift( finalDataType );
		}
		return responses[ finalDataType ];
	}
}

// Chain conversions given the request and the original response
function ajaxConvert( s, response ) {
	var conv2, current, conv, tmp,
		converters = {},
		i = 0,
		// Work with a copy of dataTypes in case we need to modify it for conversion
		dataTypes = s.dataTypes.slice(),
		prev = dataTypes[ 0 ];

	// Apply the dataFilter if provided
	if ( s.dataFilter ) {
		response = s.dataFilter( response, s.dataType );
	}

	// Create converters map with lowercased keys
	if ( dataTypes[ 1 ] ) {
		for ( conv in s.converters ) {
			converters[ conv.toLowerCase() ] = s.converters[ conv ];
		}
	}

	// Convert to each sequential dataType, tolerating list modification
	for ( ; (current = dataTypes[++i]); ) {

		// There's only work to do if current dataType is non-auto
		if ( current !== "*" ) {

			// Convert response if prev dataType is non-auto and differs from current
			if ( prev !== "*" && prev !== current ) {

				// Seek a direct converter
				conv = converters[ prev + " " + current ] || converters[ "* " + current ];

				// If none found, seek a pair
				if ( !conv ) {
					for ( conv2 in converters ) {

						// If conv2 outputs current
						tmp = conv2.split(" ");
						if ( tmp[ 1 ] === current ) {

							// If prev can be converted to accepted input
							conv = converters[ prev + " " + tmp[ 0 ] ] ||
								converters[ "* " + tmp[ 0 ] ];
							if ( conv ) {
								// Condense equivalence converters
								if ( conv === true ) {
									conv = converters[ conv2 ];

								// Otherwise, insert the intermediate dataType
								} else if ( converters[ conv2 ] !== true ) {
									current = tmp[ 0 ];
									dataTypes.splice( i--, 0, current );
								}

								break;
							}
						}
					}
				}

				// Apply converter (if not an equivalence)
				if ( conv !== true ) {

					// Unless errors are allowed to bubble, catch and return them
					if ( conv && s["throws"] ) {
						response = conv( response );
					} else {
						try {
							response = conv( response );
						} catch ( e ) {
							return { state: "parsererror", error: conv ? e : "No conversion from " + prev + " to " + current };
						}
					}
				}
			}

			// Update prev for next iteration
			prev = current;
		}
	}

	return { state: "success", data: response };
}
// Install script dataType
jQuery.ajaxSetup({
	accepts: {
		script: "text/javascript, application/javascript, application/ecmascript, application/x-ecmascript"
	},
	contents: {
		script: /(?:java|ecma)script/
	},
	converters: {
		"text script": function( text ) {
			jQuery.globalEval( text );
			return text;
		}
	}
});

// Handle cache's special case and global
jQuery.ajaxPrefilter( "script", function( s ) {
	if ( s.cache === undefined ) {
		s.cache = false;
	}
	if ( s.crossDomain ) {
		s.type = "GET";
		s.global = false;
	}
});

// Bind script tag hack transport
jQuery.ajaxTransport( "script", function(s) {

	// This transport only deals with cross domain requests
	if ( s.crossDomain ) {

		var script,
			head = document.head || jQuery("head")[0] || document.documentElement;

		return {

			send: function( _, callback ) {

				script = document.createElement("script");

				script.async = true;

				if ( s.scriptCharset ) {
					script.charset = s.scriptCharset;
				}

				script.src = s.url;

				// Attach handlers for all browsers
				script.onload = script.onreadystatechange = function( _, isAbort ) {

					if ( isAbort || !script.readyState || /loaded|complete/.test( script.readyState ) ) {

						// Handle memory leak in IE
						script.onload = script.onreadystatechange = null;

						// Remove the script
						if ( script.parentNode ) {
							script.parentNode.removeChild( script );
						}

						// Dereference the script
						script = null;

						// Callback if not abort
						if ( !isAbort ) {
							callback( 200, "success" );
						}
					}
				};

				// Circumvent IE6 bugs with base elements (#2709 and #4378) by prepending
				// Use native DOM manipulation to avoid our domManip AJAX trickery
				head.insertBefore( script, head.firstChild );
			},

			abort: function() {
				if ( script ) {
					script.onload( undefined, true );
				}
			}
		};
	}
});
var oldCallbacks = [],
	rjsonp = /(=)\?(?=&|$)|\?\?/;

// Default jsonp settings
jQuery.ajaxSetup({
	jsonp: "callback",
	jsonpCallback: function() {
		var callback = oldCallbacks.pop() || ( jQuery.expando + "_" + ( ajax_nonce++ ) );
		this[ callback ] = true;
		return callback;
	}
});

// Detect, normalize options and install callbacks for jsonp requests
jQuery.ajaxPrefilter( "json jsonp", function( s, originalSettings, jqXHR ) {

	var callbackName, overwritten, responseContainer,
		jsonProp = s.jsonp !== false && ( rjsonp.test( s.url ) ?
			"url" :
			typeof s.data === "string" && !( s.contentType || "" ).indexOf("application/x-www-form-urlencoded") && rjsonp.test( s.data ) && "data"
		);

	// Handle iff the expected data type is "jsonp" or we have a parameter to set
	if ( jsonProp || s.dataTypes[ 0 ] === "jsonp" ) {

		// Get callback name, remembering preexisting value associated with it
		callbackName = s.jsonpCallback = jQuery.isFunction( s.jsonpCallback ) ?
			s.jsonpCallback() :
			s.jsonpCallback;

		// Insert callback into url or form data
		if ( jsonProp ) {
			s[ jsonProp ] = s[ jsonProp ].replace( rjsonp, "$1" + callbackName );
		} else if ( s.jsonp !== false ) {
			s.url += ( ajax_rquery.test( s.url ) ? "&" : "?" ) + s.jsonp + "=" + callbackName;
		}

		// Use data converter to retrieve json after script execution
		s.converters["script json"] = function() {
			if ( !responseContainer ) {
				jQuery.error( callbackName + " was not called" );
			}
			return responseContainer[ 0 ];
		};

		// force json dataType
		s.dataTypes[ 0 ] = "json";

		// Install callback
		overwritten = window[ callbackName ];
		window[ callbackName ] = function() {
			responseContainer = arguments;
		};

		// Clean-up function (fires after converters)
		jqXHR.always(function() {
			// Restore preexisting value
			window[ callbackName ] = overwritten;

			// Save back as free
			if ( s[ callbackName ] ) {
				// make sure that re-using the options doesn't screw things around
				s.jsonpCallback = originalSettings.jsonpCallback;

				// save the callback name for future use
				oldCallbacks.push( callbackName );
			}

			// Call if it was a function and we have a response
			if ( responseContainer && jQuery.isFunction( overwritten ) ) {
				overwritten( responseContainer[ 0 ] );
			}

			responseContainer = overwritten = undefined;
		});

		// Delegate to script
		return "script";
	}
});
var xhrCallbacks, xhrSupported,
	xhrId = 0,
	// #5280: Internet Explorer will keep connections alive if we don't abort on unload
	xhrOnUnloadAbort = window.ActiveXObject && function() {
		// Abort all pending requests
		var key;
		for ( key in xhrCallbacks ) {
			xhrCallbacks[ key ]( undefined, true );
		}
	};

// Functions to create xhrs
function createStandardXHR() {
	try {
		return new window.XMLHttpRequest();
	} catch( e ) {}
}

function createActiveXHR() {
	try {
		return new window.ActiveXObject("Microsoft.XMLHTTP");
	} catch( e ) {}
}

// Create the request object
// (This is still attached to ajaxSettings for backward compatibility)
jQuery.ajaxSettings.xhr = window.ActiveXObject ?
	/* Microsoft failed to properly
	 * implement the XMLHttpRequest in IE7 (can't request local files),
	 * so we use the ActiveXObject when it is available
	 * Additionally XMLHttpRequest can be disabled in IE7/IE8 so
	 * we need a fallback.
	 */
	function() {
		return !this.isLocal && createStandardXHR() || createActiveXHR();
	} :
	// For all other browsers, use the standard XMLHttpRequest object
	createStandardXHR;

// Determine support properties
xhrSupported = jQuery.ajaxSettings.xhr();
jQuery.support.cors = !!xhrSupported && ( "withCredentials" in xhrSupported );
xhrSupported = jQuery.support.ajax = !!xhrSupported;

// Create transport if the browser can provide an xhr
if ( xhrSupported ) {

	jQuery.ajaxTransport(function( s ) {
		// Cross domain only allowed if supported through XMLHttpRequest
		if ( !s.crossDomain || jQuery.support.cors ) {

			var callback;

			return {
				send: function( headers, complete ) {

					// Get a new xhr
					var handle, i,
						xhr = s.xhr();

					// Open the socket
					// Passing null username, generates a login popup on Opera (#2865)
					if ( s.username ) {
						xhr.open( s.type, s.url, s.async, s.username, s.password );
					} else {
						xhr.open( s.type, s.url, s.async );
					}

					// Apply custom fields if provided
					if ( s.xhrFields ) {
						for ( i in s.xhrFields ) {
							xhr[ i ] = s.xhrFields[ i ];
						}
					}

					// Override mime type if needed
					if ( s.mimeType && xhr.overrideMimeType ) {
						xhr.overrideMimeType( s.mimeType );
					}

					// X-Requested-With header
					// For cross-domain requests, seeing as conditions for a preflight are
					// akin to a jigsaw puzzle, we simply never set it to be sure.
					// (it can always be set on a per-request basis or even using ajaxSetup)
					// For same-domain requests, won't change header if already provided.
					if ( !s.crossDomain && !headers["X-Requested-With"] ) {
						headers["X-Requested-With"] = "XMLHttpRequest";
					}

					// Need an extra try/catch for cross domain requests in Firefox 3
					try {
						for ( i in headers ) {
							xhr.setRequestHeader( i, headers[ i ] );
						}
					} catch( err ) {}

					// Do send the request
					// This may raise an exception which is actually
					// handled in jQuery.ajax (so no try/catch here)
					xhr.send( ( s.hasContent && s.data ) || null );

					// Listener
					callback = function( _, isAbort ) {
						var status, responseHeaders, statusText, responses;

						// Firefox throws exceptions when accessing properties
						// of an xhr when a network error occurred
						// http://helpful.knobs-dials.com/index.php/Component_returned_failure_code:_0x80040111_(NS_ERROR_NOT_AVAILABLE)
						try {

							// Was never called and is aborted or complete
							if ( callback && ( isAbort || xhr.readyState === 4 ) ) {

								// Only called once
								callback = undefined;

								// Do not keep as active anymore
								if ( handle ) {
									xhr.onreadystatechange = jQuery.noop;
									if ( xhrOnUnloadAbort ) {
										delete xhrCallbacks[ handle ];
									}
								}

								// If it's an abort
								if ( isAbort ) {
									// Abort it manually if needed
									if ( xhr.readyState !== 4 ) {
										xhr.abort();
									}
								} else {
									responses = {};
									status = xhr.status;
									responseHeaders = xhr.getAllResponseHeaders();

									// When requesting binary data, IE6-9 will throw an exception
									// on any attempt to access responseText (#11426)
									if ( typeof xhr.responseText === "string" ) {
										responses.text = xhr.responseText;
									}

									// Firefox throws an exception when accessing
									// statusText for faulty cross-domain requests
									try {
										statusText = xhr.statusText;
									} catch( e ) {
										// We normalize with Webkit giving an empty statusText
										statusText = "";
									}

									// Filter status for non standard behaviors

									// If the request is local and we have data: assume a success
									// (success with no data won't get notified, that's the best we
									// can do given current implementations)
									if ( !status && s.isLocal && !s.crossDomain ) {
										status = responses.text ? 200 : 404;
									// IE - #1450: sometimes returns 1223 when it should be 204
									} else if ( status === 1223 ) {
										status = 204;
									}
								}
							}
						} catch( firefoxAccessException ) {
							if ( !isAbort ) {
								complete( -1, firefoxAccessException );
							}
						}

						// Call complete if needed
						if ( responses ) {
							complete( status, statusText, responses, responseHeaders );
						}
					};

					if ( !s.async ) {
						// if we're in sync mode we fire the callback
						callback();
					} else if ( xhr.readyState === 4 ) {
						// (IE6 & IE7) if it's in cache and has been
						// retrieved directly we need to fire the callback
						setTimeout( callback );
					} else {
						handle = ++xhrId;
						if ( xhrOnUnloadAbort ) {
							// Create the active xhrs callbacks list if needed
							// and attach the unload handler
							if ( !xhrCallbacks ) {
								xhrCallbacks = {};
								jQuery( window ).unload( xhrOnUnloadAbort );
							}
							// Add to list of active xhrs callbacks
							xhrCallbacks[ handle ] = callback;
						}
						xhr.onreadystatechange = callback;
					}
				},

				abort: function() {
					if ( callback ) {
						callback( undefined, true );
					}
				}
			};
		}
	});
}
var fxNow, timerId,
	rfxtypes = /^(?:toggle|show|hide)$/,
	rfxnum = new RegExp( "^(?:([+-])=|)(" + core_pnum + ")([a-z%]*)$", "i" ),
	rrun = /queueHooks$/,
	animationPrefilters = [ defaultPrefilter ],
	tweeners = {
		"*": [function( prop, value ) {
			var end, unit,
				tween = this.createTween( prop, value ),
				parts = rfxnum.exec( value ),
				target = tween.cur(),
				start = +target || 0,
				scale = 1,
				maxIterations = 20;

			if ( parts ) {
				end = +parts[2];
				unit = parts[3] || ( jQuery.cssNumber[ prop ] ? "" : "px" );

				// We need to compute starting value
				if ( unit !== "px" && start ) {
					// Iteratively approximate from a nonzero starting point
					// Prefer the current property, because this process will be trivial if it uses the same units
					// Fallback to end or a simple constant
					start = jQuery.css( tween.elem, prop, true ) || end || 1;

					do {
						// If previous iteration zeroed out, double until we get *something*
						// Use a string for doubling factor so we don't accidentally see scale as unchanged below
						scale = scale || ".5";

						// Adjust and apply
						start = start / scale;
						jQuery.style( tween.elem, prop, start + unit );

					// Update scale, tolerating zero or NaN from tween.cur()
					// And breaking the loop if scale is unchanged or perfect, or if we've just had enough
					} while ( scale !== (scale = tween.cur() / target) && scale !== 1 && --maxIterations );
				}

				tween.unit = unit;
				tween.start = start;
				// If a +=/-= token was provided, we're doing a relative animation
				tween.end = parts[1] ? start + ( parts[1] + 1 ) * end : end;
			}
			return tween;
		}]
	};

// Animations created synchronously will run synchronously
function createFxNow() {
	setTimeout(function() {
		fxNow = undefined;
	});
	return ( fxNow = jQuery.now() );
}

function createTweens( animation, props ) {
	jQuery.each( props, function( prop, value ) {
		var collection = ( tweeners[ prop ] || [] ).concat( tweeners[ "*" ] ),
			index = 0,
			length = collection.length;
		for ( ; index < length; index++ ) {
			if ( collection[ index ].call( animation, prop, value ) ) {

				// we're done with this property
				return;
			}
		}
	});
}

function Animation( elem, properties, options ) {
	var result,
		stopped,
		index = 0,
		length = animationPrefilters.length,
		deferred = jQuery.Deferred().always( function() {
			// don't match elem in the :animated selector
			delete tick.elem;
		}),
		tick = function() {
			if ( stopped ) {
				return false;
			}
			var currentTime = fxNow || createFxNow(),
				remaining = Math.max( 0, animation.startTime + animation.duration - currentTime ),
				// archaic crash bug won't allow us to use 1 - ( 0.5 || 0 ) (#12497)
				temp = remaining / animation.duration || 0,
				percent = 1 - temp,
				index = 0,
				length = animation.tweens.length;

			for ( ; index < length ; index++ ) {
				animation.tweens[ index ].run( percent );
			}

			deferred.notifyWith( elem, [ animation, percent, remaining ]);

			if ( percent < 1 && length ) {
				return remaining;
			} else {
				deferred.resolveWith( elem, [ animation ] );
				return false;
			}
		},
		animation = deferred.promise({
			elem: elem,
			props: jQuery.extend( {}, properties ),
			opts: jQuery.extend( true, { specialEasing: {} }, options ),
			originalProperties: properties,
			originalOptions: options,
			startTime: fxNow || createFxNow(),
			duration: options.duration,
			tweens: [],
			createTween: function( prop, end ) {
				var tween = jQuery.Tween( elem, animation.opts, prop, end,
						animation.opts.specialEasing[ prop ] || animation.opts.easing );
				animation.tweens.push( tween );
				return tween;
			},
			stop: function( gotoEnd ) {
				var index = 0,
					// if we are going to the end, we want to run all the tweens
					// otherwise we skip this part
					length = gotoEnd ? animation.tweens.length : 0;
				if ( stopped ) {
					return this;
				}
				stopped = true;
				for ( ; index < length ; index++ ) {
					animation.tweens[ index ].run( 1 );
				}

				// resolve when we played the last frame
				// otherwise, reject
				if ( gotoEnd ) {
					deferred.resolveWith( elem, [ animation, gotoEnd ] );
				} else {
					deferred.rejectWith( elem, [ animation, gotoEnd ] );
				}
				return this;
			}
		}),
		props = animation.props;

	propFilter( props, animation.opts.specialEasing );

	for ( ; index < length ; index++ ) {
		result = animationPrefilters[ index ].call( animation, elem, props, animation.opts );
		if ( result ) {
			return result;
		}
	}

	createTweens( animation, props );

	if ( jQuery.isFunction( animation.opts.start ) ) {
		animation.opts.start.call( elem, animation );
	}

	jQuery.fx.timer(
		jQuery.extend( tick, {
			elem: elem,
			anim: animation,
			queue: animation.opts.queue
		})
	);

	// attach callbacks from options
	return animation.progress( animation.opts.progress )
		.done( animation.opts.done, animation.opts.complete )
		.fail( animation.opts.fail )
		.always( animation.opts.always );
}

function propFilter( props, specialEasing ) {
	var value, name, index, easing, hooks;

	// camelCase, specialEasing and expand cssHook pass
	for ( index in props ) {
		name = jQuery.camelCase( index );
		easing = specialEasing[ name ];
		value = props[ index ];
		if ( jQuery.isArray( value ) ) {
			easing = value[ 1 ];
			value = props[ index ] = value[ 0 ];
		}

		if ( index !== name ) {
			props[ name ] = value;
			delete props[ index ];
		}

		hooks = jQuery.cssHooks[ name ];
		if ( hooks && "expand" in hooks ) {
			value = hooks.expand( value );
			delete props[ name ];

			// not quite $.extend, this wont overwrite keys already present.
			// also - reusing 'index' from above because we have the correct "name"
			for ( index in value ) {
				if ( !( index in props ) ) {
					props[ index ] = value[ index ];
					specialEasing[ index ] = easing;
				}
			}
		} else {
			specialEasing[ name ] = easing;
		}
	}
}

jQuery.Animation = jQuery.extend( Animation, {

	tweener: function( props, callback ) {
		if ( jQuery.isFunction( props ) ) {
			callback = props;
			props = [ "*" ];
		} else {
			props = props.split(" ");
		}

		var prop,
			index = 0,
			length = props.length;

		for ( ; index < length ; index++ ) {
			prop = props[ index ];
			tweeners[ prop ] = tweeners[ prop ] || [];
			tweeners[ prop ].unshift( callback );
		}
	},

	prefilter: function( callback, prepend ) {
		if ( prepend ) {
			animationPrefilters.unshift( callback );
		} else {
			animationPrefilters.push( callback );
		}
	}
});

function defaultPrefilter( elem, props, opts ) {
	/*jshint validthis:true */
	var prop, index, length,
		value, dataShow, toggle,
		tween, hooks, oldfire,
		anim = this,
		style = elem.style,
		orig = {},
		handled = [],
		hidden = elem.nodeType && isHidden( elem );

	// handle queue: false promises
	if ( !opts.queue ) {
		hooks = jQuery._queueHooks( elem, "fx" );
		if ( hooks.unqueued == null ) {
			hooks.unqueued = 0;
			oldfire = hooks.empty.fire;
			hooks.empty.fire = function() {
				if ( !hooks.unqueued ) {
					oldfire();
				}
			};
		}
		hooks.unqueued++;

		anim.always(function() {
			// doing this makes sure that the complete handler will be called
			// before this completes
			anim.always(function() {
				hooks.unqueued--;
				if ( !jQuery.queue( elem, "fx" ).length ) {
					hooks.empty.fire();
				}
			});
		});
	}

	// height/width overflow pass
	if ( elem.nodeType === 1 && ( "height" in props || "width" in props ) ) {
		// Make sure that nothing sneaks out
		// Record all 3 overflow attributes because IE does not
		// change the overflow attribute when overflowX and
		// overflowY are set to the same value
		opts.overflow = [ style.overflow, style.overflowX, style.overflowY ];

		// Set display property to inline-block for height/width
		// animations on inline elements that are having width/height animated
		if ( jQuery.css( elem, "display" ) === "inline" &&
				jQuery.css( elem, "float" ) === "none" ) {

			// inline-level elements accept inline-block;
			// block-level elements need to be inline with layout
			if ( !jQuery.support.inlineBlockNeedsLayout || css_defaultDisplay( elem.nodeName ) === "inline" ) {
				style.display = "inline-block";

			} else {
				style.zoom = 1;
			}
		}
	}

	if ( opts.overflow ) {
		style.overflow = "hidden";
		if ( !jQuery.support.shrinkWrapBlocks ) {
			anim.always(function() {
				style.overflow = opts.overflow[ 0 ];
				style.overflowX = opts.overflow[ 1 ];
				style.overflowY = opts.overflow[ 2 ];
			});
		}
	}


	// show/hide pass
	for ( index in props ) {
		value = props[ index ];
		if ( rfxtypes.exec( value ) ) {
			delete props[ index ];
			toggle = toggle || value === "toggle";
			if ( value === ( hidden ? "hide" : "show" ) ) {
				continue;
			}
			handled.push( index );
		}
	}

	length = handled.length;
	if ( length ) {
		dataShow = jQuery._data( elem, "fxshow" ) || jQuery._data( elem, "fxshow", {} );
		if ( "hidden" in dataShow ) {
			hidden = dataShow.hidden;
		}

		// store state if its toggle - enables .stop().toggle() to "reverse"
		if ( toggle ) {
			dataShow.hidden = !hidden;
		}
		if ( hidden ) {
			jQuery( elem ).show();
		} else {
			anim.done(function() {
				jQuery( elem ).hide();
			});
		}
		anim.done(function() {
			var prop;
			jQuery._removeData( elem, "fxshow" );
			for ( prop in orig ) {
				jQuery.style( elem, prop, orig[ prop ] );
			}
		});
		for ( index = 0 ; index < length ; index++ ) {
			prop = handled[ index ];
			tween = anim.createTween( prop, hidden ? dataShow[ prop ] : 0 );
			orig[ prop ] = dataShow[ prop ] || jQuery.style( elem, prop );

			if ( !( prop in dataShow ) ) {
				dataShow[ prop ] = tween.start;
				if ( hidden ) {
					tween.end = tween.start;
					tween.start = prop === "width" || prop === "height" ? 1 : 0;
				}
			}
		}
	}
}

function Tween( elem, options, prop, end, easing ) {
	return new Tween.prototype.init( elem, options, prop, end, easing );
}
jQuery.Tween = Tween;

Tween.prototype = {
	constructor: Tween,
	init: function( elem, options, prop, end, easing, unit ) {
		this.elem = elem;
		this.prop = prop;
		this.easing = easing || "swing";
		this.options = options;
		this.start = this.now = this.cur();
		this.end = end;
		this.unit = unit || ( jQuery.cssNumber[ prop ] ? "" : "px" );
	},
	cur: function() {
		var hooks = Tween.propHooks[ this.prop ];

		return hooks && hooks.get ?
			hooks.get( this ) :
			Tween.propHooks._default.get( this );
	},
	run: function( percent ) {
		var eased,
			hooks = Tween.propHooks[ this.prop ];

		if ( this.options.duration ) {
			this.pos = eased = jQuery.easing[ this.easing ](
				percent, this.options.duration * percent, 0, 1, this.options.duration
			);
		} else {
			this.pos = eased = percent;
		}
		this.now = ( this.end - this.start ) * eased + this.start;

		if ( this.options.step ) {
			this.options.step.call( this.elem, this.now, this );
		}

		if ( hooks && hooks.set ) {
			hooks.set( this );
		} else {
			Tween.propHooks._default.set( this );
		}
		return this;
	}
};

Tween.prototype.init.prototype = Tween.prototype;

Tween.propHooks = {
	_default: {
		get: function( tween ) {
			var result;

			if ( tween.elem[ tween.prop ] != null &&
				(!tween.elem.style || tween.elem.style[ tween.prop ] == null) ) {
				return tween.elem[ tween.prop ];
			}

			// passing an empty string as a 3rd parameter to .css will automatically
			// attempt a parseFloat and fallback to a string if the parse fails
			// so, simple values such as "10px" are parsed to Float.
			// complex values such as "rotate(1rad)" are returned as is.
			result = jQuery.css( tween.elem, tween.prop, "" );
			// Empty strings, null, undefined and "auto" are converted to 0.
			return !result || result === "auto" ? 0 : result;
		},
		set: function( tween ) {
			// use step hook for back compat - use cssHook if its there - use .style if its
			// available and use plain properties where available
			if ( jQuery.fx.step[ tween.prop ] ) {
				jQuery.fx.step[ tween.prop ]( tween );
			} else if ( tween.elem.style && ( tween.elem.style[ jQuery.cssProps[ tween.prop ] ] != null || jQuery.cssHooks[ tween.prop ] ) ) {
				jQuery.style( tween.elem, tween.prop, tween.now + tween.unit );
			} else {
				tween.elem[ tween.prop ] = tween.now;
			}
		}
	}
};

// Remove in 2.0 - this supports IE8's panic based approach
// to setting things on disconnected nodes

Tween.propHooks.scrollTop = Tween.propHooks.scrollLeft = {
	set: function( tween ) {
		if ( tween.elem.nodeType && tween.elem.parentNode ) {
			tween.elem[ tween.prop ] = tween.now;
		}
	}
};

jQuery.each([ "toggle", "show", "hide" ], function( i, name ) {
	var cssFn = jQuery.fn[ name ];
	jQuery.fn[ name ] = function( speed, easing, callback ) {
		return speed == null || typeof speed === "boolean" ?
			cssFn.apply( this, arguments ) :
			this.animate( genFx( name, true ), speed, easing, callback );
	};
});

jQuery.fn.extend({
	fadeTo: function( speed, to, easing, callback ) {

		// show any hidden elements after setting opacity to 0
		return this.filter( isHidden ).css( "opacity", 0 ).show()

			// animate to the value specified
			.end().animate({ opacity: to }, speed, easing, callback );
	},
	animate: function( prop, speed, easing, callback ) {
		var empty = jQuery.isEmptyObject( prop ),
			optall = jQuery.speed( speed, easing, callback ),
			doAnimation = function() {
				// Operate on a copy of prop so per-property easing won't be lost
				var anim = Animation( this, jQuery.extend( {}, prop ), optall );
				doAnimation.finish = function() {
					anim.stop( true );
				};
				// Empty animations, or finishing resolves immediately
				if ( empty || jQuery._data( this, "finish" ) ) {
					anim.stop( true );
				}
			};
			doAnimation.finish = doAnimation;

		return empty || optall.queue === false ?
			this.each( doAnimation ) :
			this.queue( optall.queue, doAnimation );
	},
	stop: function( type, clearQueue, gotoEnd ) {
		var stopQueue = function( hooks ) {
			var stop = hooks.stop;
			delete hooks.stop;
			stop( gotoEnd );
		};

		if ( typeof type !== "string" ) {
			gotoEnd = clearQueue;
			clearQueue = type;
			type = undefined;
		}
		if ( clearQueue && type !== false ) {
			this.queue( type || "fx", [] );
		}

		return this.each(function() {
			var dequeue = true,
				index = type != null && type + "queueHooks",
				timers = jQuery.timers,
				data = jQuery._data( this );

			if ( index ) {
				if ( data[ index ] && data[ index ].stop ) {
					stopQueue( data[ index ] );
				}
			} else {
				for ( index in data ) {
					if ( data[ index ] && data[ index ].stop && rrun.test( index ) ) {
						stopQueue( data[ index ] );
					}
				}
			}

			for ( index = timers.length; index--; ) {
				if ( timers[ index ].elem === this && (type == null || timers[ index ].queue === type) ) {
					timers[ index ].anim.stop( gotoEnd );
					dequeue = false;
					timers.splice( index, 1 );
				}
			}

			// start the next in the queue if the last step wasn't forced
			// timers currently will call their complete callbacks, which will dequeue
			// but only if they were gotoEnd
			if ( dequeue || !gotoEnd ) {
				jQuery.dequeue( this, type );
			}
		});
	},
	finish: function( type ) {
		if ( type !== false ) {
			type = type || "fx";
		}
		return this.each(function() {
			var index,
				data = jQuery._data( this ),
				queue = data[ type + "queue" ],
				hooks = data[ type + "queueHooks" ],
				timers = jQuery.timers,
				length = queue ? queue.length : 0;

			// enable finishing flag on private data
			data.finish = true;

			// empty the queue first
			jQuery.queue( this, type, [] );

			if ( hooks && hooks.cur && hooks.cur.finish ) {
				hooks.cur.finish.call( this );
			}

			// look for any active animations, and finish them
			for ( index = timers.length; index--; ) {
				if ( timers[ index ].elem === this && timers[ index ].queue === type ) {
					timers[ index ].anim.stop( true );
					timers.splice( index, 1 );
				}
			}

			// look for any animations in the old queue and finish them
			for ( index = 0; index < length; index++ ) {
				if ( queue[ index ] && queue[ index ].finish ) {
					queue[ index ].finish.call( this );
				}
			}

			// turn off finishing flag
			delete data.finish;
		});
	}
});

// Generate parameters to create a standard animation
function genFx( type, includeWidth ) {
	var which,
		attrs = { height: type },
		i = 0;

	// if we include width, step value is 1 to do all cssExpand values,
	// if we don't include width, step value is 2 to skip over Left and Right
	includeWidth = includeWidth? 1 : 0;
	for( ; i < 4 ; i += 2 - includeWidth ) {
		which = cssExpand[ i ];
		attrs[ "margin" + which ] = attrs[ "padding" + which ] = type;
	}

	if ( includeWidth ) {
		attrs.opacity = attrs.width = type;
	}

	return attrs;
}

// Generate shortcuts for custom animations
jQuery.each({
	slideDown: genFx("show"),
	slideUp: genFx("hide"),
	slideToggle: genFx("toggle"),
	fadeIn: { opacity: "show" },
	fadeOut: { opacity: "hide" },
	fadeToggle: { opacity: "toggle" }
}, function( name, props ) {
	jQuery.fn[ name ] = function( speed, easing, callback ) {
		return this.animate( props, speed, easing, callback );
	};
});

jQuery.speed = function( speed, easing, fn ) {
	var opt = speed && typeof speed === "object" ? jQuery.extend( {}, speed ) : {
		complete: fn || !fn && easing ||
			jQuery.isFunction( speed ) && speed,
		duration: speed,
		easing: fn && easing || easing && !jQuery.isFunction( easing ) && easing
	};

	opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration :
		opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[ opt.duration ] : jQuery.fx.speeds._default;

	// normalize opt.queue - true/undefined/null -> "fx"
	if ( opt.queue == null || opt.queue === true ) {
		opt.queue = "fx";
	}

	// Queueing
	opt.old = opt.complete;

	opt.complete = function() {
		if ( jQuery.isFunction( opt.old ) ) {
			opt.old.call( this );
		}

		if ( opt.queue ) {
			jQuery.dequeue( this, opt.queue );
		}
	};

	return opt;
};

jQuery.easing = {
	linear: function( p ) {
		return p;
	},
	swing: function( p ) {
		return 0.5 - Math.cos( p*Math.PI ) / 2;
	}
};

jQuery.timers = [];
jQuery.fx = Tween.prototype.init;
jQuery.fx.tick = function() {
	var timer,
		timers = jQuery.timers,
		i = 0;

	fxNow = jQuery.now();

	for ( ; i < timers.length; i++ ) {
		timer = timers[ i ];
		// Checks the timer has not already been removed
		if ( !timer() && timers[ i ] === timer ) {
			timers.splice( i--, 1 );
		}
	}

	if ( !timers.length ) {
		jQuery.fx.stop();
	}
	fxNow = undefined;
};

jQuery.fx.timer = function( timer ) {
	if ( timer() && jQuery.timers.push( timer ) ) {
		jQuery.fx.start();
	}
};

jQuery.fx.interval = 13;

jQuery.fx.start = function() {
	if ( !timerId ) {
		timerId = setInterval( jQuery.fx.tick, jQuery.fx.interval );
	}
};

jQuery.fx.stop = function() {
	clearInterval( timerId );
	timerId = null;
};

jQuery.fx.speeds = {
	slow: 600,
	fast: 200,
	// Default speed
	_default: 400
};

// Back Compat <1.8 extension point
jQuery.fx.step = {};

if ( jQuery.expr && jQuery.expr.filters ) {
	jQuery.expr.filters.animated = function( elem ) {
		return jQuery.grep(jQuery.timers, function( fn ) {
			return elem === fn.elem;
		}).length;
	};
}
jQuery.fn.offset = function( options ) {
	if ( arguments.length ) {
		return options === undefined ?
			this :
			this.each(function( i ) {
				jQuery.offset.setOffset( this, options, i );
			});
	}

	var docElem, win,
		box = { top: 0, left: 0 },
		elem = this[ 0 ],
		doc = elem && elem.ownerDocument;

	if ( !doc ) {
		return;
	}

	docElem = doc.documentElement;

	// Make sure it's not a disconnected DOM node
	if ( !jQuery.contains( docElem, elem ) ) {
		return box;
	}

	// If we don't have gBCR, just use 0,0 rather than error
	// BlackBerry 5, iOS 3 (original iPhone)
	if ( typeof elem.getBoundingClientRect !== core_strundefined ) {
		box = elem.getBoundingClientRect();
	}
	win = getWindow( doc );
	return {
		top: box.top  + ( win.pageYOffset || docElem.scrollTop )  - ( docElem.clientTop  || 0 ),
		left: box.left + ( win.pageXOffset || docElem.scrollLeft ) - ( docElem.clientLeft || 0 )
	};
};

jQuery.offset = {

	setOffset: function( elem, options, i ) {
		var position = jQuery.css( elem, "position" );

		// set position first, in-case top/left are set even on static elem
		if ( position === "static" ) {
			elem.style.position = "relative";
		}

		var curElem = jQuery( elem ),
			curOffset = curElem.offset(),
			curCSSTop = jQuery.css( elem, "top" ),
			curCSSLeft = jQuery.css( elem, "left" ),
			calculatePosition = ( position === "absolute" || position === "fixed" ) && jQuery.inArray("auto", [curCSSTop, curCSSLeft]) > -1,
			props = {}, curPosition = {}, curTop, curLeft;

		// need to be able to calculate position if either top or left is auto and position is either absolute or fixed
		if ( calculatePosition ) {
			curPosition = curElem.position();
			curTop = curPosition.top;
			curLeft = curPosition.left;
		} else {
			curTop = parseFloat( curCSSTop ) || 0;
			curLeft = parseFloat( curCSSLeft ) || 0;
		}

		if ( jQuery.isFunction( options ) ) {
			options = options.call( elem, i, curOffset );
		}

		if ( options.top != null ) {
			props.top = ( options.top - curOffset.top ) + curTop;
		}
		if ( options.left != null ) {
			props.left = ( options.left - curOffset.left ) + curLeft;
		}

		if ( "using" in options ) {
			options.using.call( elem, props );
		} else {
			curElem.css( props );
		}
	}
};


jQuery.fn.extend({

	position: function() {
		if ( !this[ 0 ] ) {
			return;
		}

		var offsetParent, offset,
			parentOffset = { top: 0, left: 0 },
			elem = this[ 0 ];

		// fixed elements are offset from window (parentOffset = {top:0, left: 0}, because it is it's only offset parent
		if ( jQuery.css( elem, "position" ) === "fixed" ) {
			// we assume that getBoundingClientRect is available when computed position is fixed
			offset = elem.getBoundingClientRect();
		} else {
			// Get *real* offsetParent
			offsetParent = this.offsetParent();

			// Get correct offsets
			offset = this.offset();
			if ( !jQuery.nodeName( offsetParent[ 0 ], "html" ) ) {
				parentOffset = offsetParent.offset();
			}

			// Add offsetParent borders
			parentOffset.top  += jQuery.css( offsetParent[ 0 ], "borderTopWidth", true );
			parentOffset.left += jQuery.css( offsetParent[ 0 ], "borderLeftWidth", true );
		}

		// Subtract parent offsets and element margins
		// note: when an element has margin: auto the offsetLeft and marginLeft
		// are the same in Safari causing offset.left to incorrectly be 0
		return {
			top:  offset.top  - parentOffset.top - jQuery.css( elem, "marginTop", true ),
			left: offset.left - parentOffset.left - jQuery.css( elem, "marginLeft", true)
		};
	},

	offsetParent: function() {
		return this.map(function() {
			var offsetParent = this.offsetParent || document.documentElement;
			while ( offsetParent && ( !jQuery.nodeName( offsetParent, "html" ) && jQuery.css( offsetParent, "position") === "static" ) ) {
				offsetParent = offsetParent.offsetParent;
			}
			return offsetParent || document.documentElement;
		});
	}
});


// Create scrollLeft and scrollTop methods
jQuery.each( {scrollLeft: "pageXOffset", scrollTop: "pageYOffset"}, function( method, prop ) {
	var top = /Y/.test( prop );

	jQuery.fn[ method ] = function( val ) {
		return jQuery.access( this, function( elem, method, val ) {
			var win = getWindow( elem );

			if ( val === undefined ) {
				return win ? (prop in win) ? win[ prop ] :
					win.document.documentElement[ method ] :
					elem[ method ];
			}

			if ( win ) {
				win.scrollTo(
					!top ? val : jQuery( win ).scrollLeft(),
					top ? val : jQuery( win ).scrollTop()
				);

			} else {
				elem[ method ] = val;
			}
		}, method, val, arguments.length, null );
	};
});

function getWindow( elem ) {
	return jQuery.isWindow( elem ) ?
		elem :
		elem.nodeType === 9 ?
			elem.defaultView || elem.parentWindow :
			false;
}
// Create innerHeight, innerWidth, height, width, outerHeight and outerWidth methods
jQuery.each( { Height: "height", Width: "width" }, function( name, type ) {
	jQuery.each( { padding: "inner" + name, content: type, "": "outer" + name }, function( defaultExtra, funcName ) {
		// margin is only for outerHeight, outerWidth
		jQuery.fn[ funcName ] = function( margin, value ) {
			var chainable = arguments.length && ( defaultExtra || typeof margin !== "boolean" ),
				extra = defaultExtra || ( margin === true || value === true ? "margin" : "border" );

			return jQuery.access( this, function( elem, type, value ) {
				var doc;

				if ( jQuery.isWindow( elem ) ) {
					// As of 5/8/2012 this will yield incorrect results for Mobile Safari, but there
					// isn't a whole lot we can do. See pull request at this URL for discussion:
					// https://github.com/jquery/jquery/pull/764
					return elem.document.documentElement[ "client" + name ];
				}

				// Get document width or height
				if ( elem.nodeType === 9 ) {
					doc = elem.documentElement;

					// Either scroll[Width/Height] or offset[Width/Height] or client[Width/Height], whichever is greatest
					// unfortunately, this causes bug #3838 in IE6/8 only, but there is currently no good, small way to fix it.
					return Math.max(
						elem.body[ "scroll" + name ], doc[ "scroll" + name ],
						elem.body[ "offset" + name ], doc[ "offset" + name ],
						doc[ "client" + name ]
					);
				}

				return value === undefined ?
					// Get width or height on the element, requesting but not forcing parseFloat
					jQuery.css( elem, type, extra ) :

					// Set width or height on the element
					jQuery.style( elem, type, value, extra );
			}, type, chainable ? margin : undefined, chainable, null );
		};
	});
});
// Limit scope pollution from any deprecated API
// (function() {

// })();
// Expose jQuery to the global object
window.jQuery = window.$ = jQuery;

// Expose jQuery as an AMD module, but only for AMD loaders that
// understand the issues with loading multiple versions of jQuery
// in a page that all might call define(). The loader will indicate
// they have special allowances for multiple jQuery versions by
// specifying define.amd.jQuery = true. Register as a named module,
// since jQuery can be concatenated with other files that may use define,
// but not use a proper concatenation script that understands anonymous
// AMD modules. A named AMD is safest and most robust way to register.
// Lowercase jquery is used because AMD module names are derived from
// file names, and jQuery is normally delivered in a lowercase file name.
// Do this after creating the global so that if an AMD module wants to call
// noConflict to hide this version of jQuery, it will work.
if ( typeof define === "function" && define.amd && define.amd.jQuery ) {
	define( "jquery", [], function () { return jQuery; } );
}

})( window );/**
 * @license
 * Lodash (Custom Build) <https://lodash.com/>
 * Build: `lodash core plus="debounce,throttle,get,findIndex,findLastIndex,findKey,findLastKey,isArrayLike,invert,invertBy,uniq,uniqBy,omit,omitBy,zip,unzip,rest,range,random,reject,intersection,drop,countBy,union,zipObject,initial,cloneDeep,clamp,isPlainObject,take,takeRight,without,difference,defaultsDeep"`
 * Copyright JS Foundation and other contributors <https://js.foundation/>
 * Released under MIT license <https://lodash.com/license>
 * Based on Underscore.js 1.8.3 <http://underscorejs.org/LICENSE>
 * Copyright Jeremy Ashkenas, DocumentCloud and Investigative Reporters & Editors
 */
;(function() {

  /** Used as a safe reference for `undefined` in pre-ES5 environments. */
  var undefined;

  /** Used as the semantic version number. */
  var VERSION = '4.17.5';

  /** Used as the size to enable large array optimizations. */
  var LARGE_ARRAY_SIZE = 200;

  /** Error message constants. */
  var FUNC_ERROR_TEXT = 'Expected a function';

  /** Used to stand-in for `undefined` hash values. */
  var HASH_UNDEFINED = '__lodash_hash_undefined__';

  /** Used as the maximum memoize cache size. */
  var MAX_MEMOIZE_SIZE = 500;

  /** Used as the internal argument placeholder. */
  var PLACEHOLDER = '__lodash_placeholder__';

  /** Used to compose bitmasks for cloning. */
  var CLONE_DEEP_FLAG = 1,
      CLONE_FLAT_FLAG = 2,
      CLONE_SYMBOLS_FLAG = 4;

  /** Used to compose bitmasks for value comparisons. */
  var COMPARE_PARTIAL_FLAG = 1,
      COMPARE_UNORDERED_FLAG = 2;

  /** Used to compose bitmasks for function metadata. */
  var WRAP_BIND_FLAG = 1,
      WRAP_BIND_KEY_FLAG = 2,
      WRAP_CURRY_BOUND_FLAG = 4,
      WRAP_CURRY_FLAG = 8,
      WRAP_CURRY_RIGHT_FLAG = 16,
      WRAP_PARTIAL_FLAG = 32,
      WRAP_PARTIAL_RIGHT_FLAG = 64,
      WRAP_ARY_FLAG = 128,
      WRAP_REARG_FLAG = 256,
      WRAP_FLIP_FLAG = 512;

  /** Used to detect hot functions by number of calls within a span of milliseconds. */
  var HOT_COUNT = 800,
      HOT_SPAN = 16;

  /** Used to indicate the type of lazy iteratees. */
  var LAZY_FILTER_FLAG = 1,
      LAZY_MAP_FLAG = 2,
      LAZY_WHILE_FLAG = 3;

  /** Used as references for various `Number` constants. */
  var INFINITY = 1 / 0,
      MAX_SAFE_INTEGER = 9007199254740991,
      MAX_INTEGER = 1.7976931348623157e+308,
      NAN = 0 / 0;

  /** Used as references for the maximum length and index of an array. */
  var MAX_ARRAY_LENGTH = 4294967295;

  /** Used to associate wrap methods with their bit flags. */
  var wrapFlags = [
    ['ary', WRAP_ARY_FLAG],
    ['bind', WRAP_BIND_FLAG],
    ['bindKey', WRAP_BIND_KEY_FLAG],
    ['curry', WRAP_CURRY_FLAG],
    ['curryRight', WRAP_CURRY_RIGHT_FLAG],
    ['flip', WRAP_FLIP_FLAG],
    ['partial', WRAP_PARTIAL_FLAG],
    ['partialRight', WRAP_PARTIAL_RIGHT_FLAG],
    ['rearg', WRAP_REARG_FLAG]
  ];

  /** `Object#toString` result references. */
  var argsTag = '[object Arguments]',
      arrayTag = '[object Array]',
      asyncTag = '[object AsyncFunction]',
      boolTag = '[object Boolean]',
      dateTag = '[object Date]',
      errorTag = '[object Error]',
      funcTag = '[object Function]',
      genTag = '[object GeneratorFunction]',
      mapTag = '[object Map]',
      numberTag = '[object Number]',
      nullTag = '[object Null]',
      objectTag = '[object Object]',
      promiseTag = '[object Promise]',
      proxyTag = '[object Proxy]',
      regexpTag = '[object RegExp]',
      setTag = '[object Set]',
      stringTag = '[object String]',
      symbolTag = '[object Symbol]',
      undefinedTag = '[object Undefined]',
      weakMapTag = '[object WeakMap]';

  var arrayBufferTag = '[object ArrayBuffer]',
      dataViewTag = '[object DataView]',
      float32Tag = '[object Float32Array]',
      float64Tag = '[object Float64Array]',
      int8Tag = '[object Int8Array]',
      int16Tag = '[object Int16Array]',
      int32Tag = '[object Int32Array]',
      uint8Tag = '[object Uint8Array]',
      uint8ClampedTag = '[object Uint8ClampedArray]',
      uint16Tag = '[object Uint16Array]',
      uint32Tag = '[object Uint32Array]';

  /** Used to match HTML entities and HTML characters. */
  var reUnescapedHtml = /[&<>"']/g,
      reHasUnescapedHtml = RegExp(reUnescapedHtml.source);

  /** Used to match property names within property paths. */
  var reIsDeepProp = /\.|\[(?:[^[\]]*|(["'])(?:(?!\1)[^\\]|\\.)*?\1)\]/,
      reIsPlainProp = /^\w*$/,
      rePropName = /[^.[\]]+|\[(?:(-?\d+(?:\.\d+)?)|(["'])((?:(?!\2)[^\\]|\\.)*?)\2)\]|(?=(?:\.|\[\])(?:\.|\[\]|$))/g;

  /**
   * Used to match `RegExp`
   * [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns).
   */
  var reRegExpChar = /[\\^$.*+?()[\]{}|]/g;

  /** Used to match leading and trailing whitespace. */
  var reTrim = /^\s+|\s+$/g;

  /** Used to match wrap detail comments. */
  var reWrapComment = /\{(?:\n\/\* \[wrapped with .+\] \*\/)?\n?/,
      reWrapDetails = /\{\n\/\* \[wrapped with (.+)\] \*/,
      reSplitDetails = /,? & /;

  /** Used to match backslashes in property paths. */
  var reEscapeChar = /\\(\\)?/g;

  /** Used to match `RegExp` flags from their coerced string values. */
  var reFlags = /\w*$/;

  /** Used to detect bad signed hexadecimal string values. */
  var reIsBadHex = /^[-+]0x[0-9a-f]+$/i;

  /** Used to detect binary string values. */
  var reIsBinary = /^0b[01]+$/i;

  /** Used to detect host constructors (Safari). */
  var reIsHostCtor = /^\[object .+?Constructor\]$/;

  /** Used to detect octal string values. */
  var reIsOctal = /^0o[0-7]+$/i;

  /** Used to detect unsigned integer values. */
  var reIsUint = /^(?:0|[1-9]\d*)$/;

  /** Used to compose unicode character classes. */
  var rsAstralRange = '\\ud800-\\udfff',
      rsComboMarksRange = '\\u0300-\\u036f',
      reComboHalfMarksRange = '\\ufe20-\\ufe2f',
      rsComboSymbolsRange = '\\u20d0-\\u20ff',
      rsComboRange = rsComboMarksRange + reComboHalfMarksRange + rsComboSymbolsRange,
      rsVarRange = '\\ufe0e\\ufe0f';

  /** Used to compose unicode capture groups. */
  var rsAstral = '[' + rsAstralRange + ']',
      rsCombo = '[' + rsComboRange + ']',
      rsFitz = '\\ud83c[\\udffb-\\udfff]',
      rsModifier = '(?:' + rsCombo + '|' + rsFitz + ')',
      rsNonAstral = '[^' + rsAstralRange + ']',
      rsRegional = '(?:\\ud83c[\\udde6-\\uddff]){2}',
      rsSurrPair = '[\\ud800-\\udbff][\\udc00-\\udfff]',
      rsZWJ = '\\u200d';

  /** Used to compose unicode regexes. */
  var reOptMod = rsModifier + '?',
      rsOptVar = '[' + rsVarRange + ']?',
      rsOptJoin = '(?:' + rsZWJ + '(?:' + [rsNonAstral, rsRegional, rsSurrPair].join('|') + ')' + rsOptVar + reOptMod + ')*',
      rsSeq = rsOptVar + reOptMod + rsOptJoin,
      rsSymbol = '(?:' + [rsNonAstral + rsCombo + '?', rsCombo, rsRegional, rsSurrPair, rsAstral].join('|') + ')';

  /** Used to match [string symbols](https://mathiasbynens.be/notes/javascript-unicode). */
  var reUnicode = RegExp(rsFitz + '(?=' + rsFitz + ')|' + rsSymbol + rsSeq, 'g');

  /** Used to detect strings with [zero-width joiners or code points from the astral planes](http://eev.ee/blog/2015/09/12/dark-corners-of-unicode/). */
  var reHasUnicode = RegExp('[' + rsZWJ + rsAstralRange  + rsComboRange + rsVarRange + ']');

  /** Used to identify `toStringTag` values of typed arrays. */
  var typedArrayTags = {};
  typedArrayTags[float32Tag] = typedArrayTags[float64Tag] =
  typedArrayTags[int8Tag] = typedArrayTags[int16Tag] =
  typedArrayTags[int32Tag] = typedArrayTags[uint8Tag] =
  typedArrayTags[uint8ClampedTag] = typedArrayTags[uint16Tag] =
  typedArrayTags[uint32Tag] = true;
  typedArrayTags[argsTag] = typedArrayTags[arrayTag] =
  typedArrayTags[arrayBufferTag] = typedArrayTags[boolTag] =
  typedArrayTags[dataViewTag] = typedArrayTags[dateTag] =
  typedArrayTags[errorTag] = typedArrayTags[funcTag] =
  typedArrayTags[mapTag] = typedArrayTags[numberTag] =
  typedArrayTags[objectTag] = typedArrayTags[regexpTag] =
  typedArrayTags[setTag] = typedArrayTags[stringTag] =
  typedArrayTags[weakMapTag] = false;

  /** Used to identify `toStringTag` values supported by `_.clone`. */
  var cloneableTags = {};
  cloneableTags[argsTag] = cloneableTags[arrayTag] =
  cloneableTags[arrayBufferTag] = cloneableTags[dataViewTag] =
  cloneableTags[boolTag] = cloneableTags[dateTag] =
  cloneableTags[float32Tag] = cloneableTags[float64Tag] =
  cloneableTags[int8Tag] = cloneableTags[int16Tag] =
  cloneableTags[int32Tag] = cloneableTags[mapTag] =
  cloneableTags[numberTag] = cloneableTags[objectTag] =
  cloneableTags[regexpTag] = cloneableTags[setTag] =
  cloneableTags[stringTag] = cloneableTags[symbolTag] =
  cloneableTags[uint8Tag] = cloneableTags[uint8ClampedTag] =
  cloneableTags[uint16Tag] = cloneableTags[uint32Tag] = true;
  cloneableTags[errorTag] = cloneableTags[funcTag] =
  cloneableTags[weakMapTag] = false;

  /** Used to map characters to HTML entities. */
  var htmlEscapes = {
    '&': '&amp;',
    '<': '&lt;',
    '>': '&gt;',
    '"': '&quot;',
    "'": '&#39;'
  };

  /** Built-in method references without a dependency on `root`. */
  var freeParseFloat = parseFloat,
      freeParseInt = parseInt;

  /** Detect free variable `global` from Node.js. */
  var freeGlobal = typeof global == 'object' && global && global.Object === Object && global;

  /** Detect free variable `self`. */
  var freeSelf = typeof self == 'object' && self && self.Object === Object && self;

  /** Used as a reference to the global object. */
  var root = freeGlobal || freeSelf || Function('return this')();

  /** Detect free variable `exports`. */
  var freeExports = typeof exports == 'object' && exports && !exports.nodeType && exports;

  /** Detect free variable `module`. */
  var freeModule = freeExports && typeof module == 'object' && module && !module.nodeType && module;

  /** Detect the popular CommonJS extension `module.exports`. */
  var moduleExports = freeModule && freeModule.exports === freeExports;

  /** Detect free variable `process` from Node.js. */
  var freeProcess = moduleExports && freeGlobal.process;

  /** Used to access faster Node.js helpers. */
  var nodeUtil = (function() {
    try {
      return freeProcess && freeProcess.binding && freeProcess.binding('util');
    } catch (e) {}
  }());

  /* Node.js helper references. */
  var nodeIsDate = nodeUtil && nodeUtil.isDate,
      nodeIsMap = nodeUtil && nodeUtil.isMap,
      nodeIsRegExp = nodeUtil && nodeUtil.isRegExp,
      nodeIsSet = nodeUtil && nodeUtil.isSet,
      nodeIsTypedArray = nodeUtil && nodeUtil.isTypedArray;

  /*--------------------------------------------------------------------------*/

  /**
   * A faster alternative to `Function#apply`, this function invokes `func`
   * with the `this` binding of `thisArg` and the arguments of `args`.
   *
   * @private
   * @param {Function} func The function to invoke.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {Array} args The arguments to invoke `func` with.
   * @returns {*} Returns the result of `func`.
   */
  function apply(func, thisArg, args) {
    switch (args.length) {
      case 0: return func.call(thisArg);
      case 1: return func.call(thisArg, args[0]);
      case 2: return func.call(thisArg, args[0], args[1]);
      case 3: return func.call(thisArg, args[0], args[1], args[2]);
    }
    return func.apply(thisArg, args);
  }

  /**
   * A specialized version of `baseAggregator` for arrays.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform keys.
   * @param {Object} accumulator The initial aggregated object.
   * @returns {Function} Returns `accumulator`.
   */
  function arrayAggregator(array, setter, iteratee, accumulator) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      var value = array[index];
      setter(accumulator, value, iteratee(value), array);
    }
    return accumulator;
  }

  /**
   * A specialized version of `_.forEach` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns `array`.
   */
  function arrayEach(array, iteratee) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (iteratee(array[index], index, array) === false) {
        break;
      }
    }
    return array;
  }

  /**
   * A specialized version of `_.every` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`.
   */
  function arrayEvery(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (!predicate(array[index], index, array)) {
        return false;
      }
    }
    return true;
  }

  /**
   * A specialized version of `_.filter` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   */
  function arrayFilter(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (predicate(value, index, array)) {
        result[resIndex++] = value;
      }
    }
    return result;
  }

  /**
   * A specialized version of `_.includes` for arrays without support for
   * specifying an index to search from.
   *
   * @private
   * @param {Array} [array] The array to inspect.
   * @param {*} target The value to search for.
   * @returns {boolean} Returns `true` if `target` is found, else `false`.
   */
  function arrayIncludes(array, value) {
    var length = array == null ? 0 : array.length;
    return !!length && baseIndexOf(array, value, 0) > -1;
  }

  /**
   * This function is like `arrayIncludes` except that it accepts a comparator.
   *
   * @private
   * @param {Array} [array] The array to inspect.
   * @param {*} target The value to search for.
   * @param {Function} comparator The comparator invoked per element.
   * @returns {boolean} Returns `true` if `target` is found, else `false`.
   */
  function arrayIncludesWith(array, value, comparator) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (comparator(value, array[index])) {
        return true;
      }
    }
    return false;
  }

  /**
   * A specialized version of `_.map` for arrays without support for iteratee
   * shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   */
  function arrayMap(array, iteratee) {
    var index = -1,
        length = array == null ? 0 : array.length,
        result = Array(length);

    while (++index < length) {
      result[index] = iteratee(array[index], index, array);
    }
    return result;
  }

  /**
   * Appends the elements of `values` to `array`.
   *
   * @private
   * @param {Array} array The array to modify.
   * @param {Array} values The values to append.
   * @returns {Array} Returns `array`.
   */
  function arrayPush(array, values) {
    var index = -1,
        length = values.length,
        offset = array.length;

    while (++index < length) {
      array[offset + index] = values[index];
    }
    return array;
  }

  /**
   * A specialized version of `_.reduce` for arrays without support for
   * iteratee shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {*} [accumulator] The initial value.
   * @param {boolean} [initAccum] Specify using the first element of `array` as
   *  the initial value.
   * @returns {*} Returns the accumulated value.
   */
  function arrayReduce(array, iteratee, accumulator, initAccum) {
    var index = -1,
        length = array == null ? 0 : array.length;

    if (initAccum && length) {
      accumulator = array[++index];
    }
    while (++index < length) {
      accumulator = iteratee(accumulator, array[index], index, array);
    }
    return accumulator;
  }

  /**
   * A specialized version of `_.some` for arrays without support for iteratee
   * shorthands.
   *
   * @private
   * @param {Array} [array] The array to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   */
  function arraySome(array, predicate) {
    var index = -1,
        length = array == null ? 0 : array.length;

    while (++index < length) {
      if (predicate(array[index], index, array)) {
        return true;
      }
    }
    return false;
  }

  /**
   * Gets the size of an ASCII `string`.
   *
   * @private
   * @param {string} string The string inspect.
   * @returns {number} Returns the string size.
   */
  var asciiSize = baseProperty('length');

  /**
   * Converts an ASCII `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function asciiToArray(string) {
    return string.split('');
  }

  /**
   * The base implementation of methods like `_.findKey` and `_.findLastKey`,
   * without support for iteratee shorthands, which iterates over `collection`
   * using `eachFunc`.
   *
   * @private
   * @param {Array|Object} collection The collection to inspect.
   * @param {Function} predicate The function invoked per iteration.
   * @param {Function} eachFunc The function to iterate over `collection`.
   * @returns {*} Returns the found element or its key, else `undefined`.
   */
  function baseFindKey(collection, predicate, eachFunc) {
    var result;
    eachFunc(collection, function(value, key, collection) {
      if (predicate(value, key, collection)) {
        result = key;
        return false;
      }
    });
    return result;
  }

  /**
   * The base implementation of `_.findIndex` and `_.findLastIndex` without
   * support for iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Function} predicate The function invoked per iteration.
   * @param {number} fromIndex The index to search from.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function baseFindIndex(array, predicate, fromIndex, fromRight) {
    var length = array.length,
        index = fromIndex + (fromRight ? 1 : -1);

    while ((fromRight ? index-- : ++index < length)) {
      if (predicate(array[index], index, array)) {
        return index;
      }
    }
    return -1;
  }

  /**
   * The base implementation of `_.indexOf` without `fromIndex` bounds checks.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} fromIndex The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function baseIndexOf(array, value, fromIndex) {
    return value === value
      ? strictIndexOf(array, value, fromIndex)
      : baseFindIndex(array, baseIsNaN, fromIndex);
  }

  /**
   * The base implementation of `_.isNaN` without support for number objects.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.
   */
  function baseIsNaN(value) {
    return value !== value;
  }

  /**
   * The base implementation of `_.property` without support for deep paths.
   *
   * @private
   * @param {string} key The key of the property to get.
   * @returns {Function} Returns the new accessor function.
   */
  function baseProperty(key) {
    return function(object) {
      return object == null ? undefined : object[key];
    };
  }

  /**
   * The base implementation of `_.propertyOf` without support for deep paths.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Function} Returns the new accessor function.
   */
  function basePropertyOf(object) {
    return function(key) {
      return object == null ? undefined : object[key];
    };
  }

  /**
   * The base implementation of `_.reduce` and `_.reduceRight`, without support
   * for iteratee shorthands, which iterates over `collection` using `eachFunc`.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {*} accumulator The initial value.
   * @param {boolean} initAccum Specify using the first or last element of
   *  `collection` as the initial value.
   * @param {Function} eachFunc The function to iterate over `collection`.
   * @returns {*} Returns the accumulated value.
   */
  function baseReduce(collection, iteratee, accumulator, initAccum, eachFunc) {
    eachFunc(collection, function(value, index, collection) {
      accumulator = initAccum
        ? (initAccum = false, value)
        : iteratee(accumulator, value, index, collection);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.sortBy` which uses `comparer` to define the
   * sort order of `array` and replaces criteria objects with their corresponding
   * values.
   *
   * @private
   * @param {Array} array The array to sort.
   * @param {Function} comparer The function to define sort order.
   * @returns {Array} Returns `array`.
   */
  function baseSortBy(array, comparer) {
    var length = array.length;

    array.sort(comparer);
    while (length--) {
      array[length] = array[length].value;
    }
    return array;
  }

  /**
   * The base implementation of `_.times` without support for iteratee shorthands
   * or max array length checks.
   *
   * @private
   * @param {number} n The number of times to invoke `iteratee`.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the array of results.
   */
  function baseTimes(n, iteratee) {
    var index = -1,
        result = Array(n);

    while (++index < n) {
      result[index] = iteratee(index);
    }
    return result;
  }

  /**
   * The base implementation of `_.unary` without support for storing metadata.
   *
   * @private
   * @param {Function} func The function to cap arguments for.
   * @returns {Function} Returns the new capped function.
   */
  function baseUnary(func) {
    return function(value) {
      return func(value);
    };
  }

  /**
   * The base implementation of `_.values` and `_.valuesIn` which creates an
   * array of `object` property values corresponding to the property names
   * of `props`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array} props The property names to get values for.
   * @returns {Object} Returns the array of property values.
   */
  function baseValues(object, props) {
    return arrayMap(props, function(key) {
      return object[key];
    });
  }

  /**
   * Checks if a `cache` value for `key` exists.
   *
   * @private
   * @param {Object} cache The cache to query.
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function cacheHas(cache, key) {
    return cache.has(key);
  }

  /**
   * Gets the number of `placeholder` occurrences in `array`.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} placeholder The placeholder to search for.
   * @returns {number} Returns the placeholder count.
   */
  function countHolders(array, placeholder) {
    var length = array.length,
        result = 0;

    while (length--) {
      if (array[length] === placeholder) {
        ++result;
      }
    }
    return result;
  }

  /**
   * Used by `_.escape` to convert characters to HTML entities.
   *
   * @private
   * @param {string} chr The matched character to escape.
   * @returns {string} Returns the escaped character.
   */
  var escapeHtmlChar = basePropertyOf(htmlEscapes);

  /**
   * Gets the value at `key` of `object`.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {string} key The key of the property to get.
   * @returns {*} Returns the property value.
   */
  function getValue(object, key) {
    return object == null ? undefined : object[key];
  }

  /**
   * Checks if `string` contains Unicode symbols.
   *
   * @private
   * @param {string} string The string to inspect.
   * @returns {boolean} Returns `true` if a symbol is found, else `false`.
   */
  function hasUnicode(string) {
    return reHasUnicode.test(string);
  }

  /**
   * Converts `iterator` to an array.
   *
   * @private
   * @param {Object} iterator The iterator to convert.
   * @returns {Array} Returns the converted array.
   */
  function iteratorToArray(iterator) {
    var data,
        result = [];

    while (!(data = iterator.next()).done) {
      result.push(data.value);
    }
    return result;
  }

  /**
   * Converts `map` to its key-value pairs.
   *
   * @private
   * @param {Object} map The map to convert.
   * @returns {Array} Returns the key-value pairs.
   */
  function mapToArray(map) {
    var index = -1,
        result = Array(map.size);

    map.forEach(function(value, key) {
      result[++index] = [key, value];
    });
    return result;
  }

  /**
   * Creates a unary function that invokes `func` with its argument transformed.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {Function} transform The argument transform.
   * @returns {Function} Returns the new function.
   */
  function overArg(func, transform) {
    return function(arg) {
      return func(transform(arg));
    };
  }

  /**
   * Replaces all `placeholder` elements in `array` with an internal placeholder
   * and returns an array of their indexes.
   *
   * @private
   * @param {Array} array The array to modify.
   * @param {*} placeholder The placeholder to replace.
   * @returns {Array} Returns the new array of placeholder indexes.
   */
  function replaceHolders(array, placeholder) {
    var index = -1,
        length = array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (value === placeholder || value === PLACEHOLDER) {
        array[index] = PLACEHOLDER;
        result[resIndex++] = index;
      }
    }
    return result;
  }

  /**
   * Gets the value at `key`, unless `key` is "__proto__".
   *
   * @private
   * @param {Object} object The object to query.
   * @param {string} key The key of the property to get.
   * @returns {*} Returns the property value.
   */
  function safeGet(object, key) {
    return key == '__proto__'
      ? undefined
      : object[key];
  }

  /**
   * Converts `set` to an array of its values.
   *
   * @private
   * @param {Object} set The set to convert.
   * @returns {Array} Returns the values.
   */
  function setToArray(set) {
    var index = -1,
        result = Array(set.size);

    set.forEach(function(value) {
      result[++index] = value;
    });
    return result;
  }

  /**
   * A specialized version of `_.indexOf` which performs strict equality
   * comparisons of values, i.e. `===`.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} fromIndex The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function strictIndexOf(array, value, fromIndex) {
    var index = fromIndex - 1,
        length = array.length;

    while (++index < length) {
      if (array[index] === value) {
        return index;
      }
    }
    return -1;
  }

  /**
   * Gets the number of symbols in `string`.
   *
   * @private
   * @param {string} string The string to inspect.
   * @returns {number} Returns the string size.
   */
  function stringSize(string) {
    return hasUnicode(string)
      ? unicodeSize(string)
      : asciiSize(string);
  }

  /**
   * Converts `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function stringToArray(string) {
    return hasUnicode(string)
      ? unicodeToArray(string)
      : asciiToArray(string);
  }

  /**
   * Gets the size of a Unicode `string`.
   *
   * @private
   * @param {string} string The string inspect.
   * @returns {number} Returns the string size.
   */
  function unicodeSize(string) {
    var result = reUnicode.lastIndex = 0;
    while (reUnicode.test(string)) {
      ++result;
    }
    return result;
  }

  /**
   * Converts a Unicode `string` to an array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the converted array.
   */
  function unicodeToArray(string) {
    return string.match(reUnicode) || [];
  }

  /*--------------------------------------------------------------------------*/

  /** Used for built-in method references. */
  var arrayProto = Array.prototype,
      funcProto = Function.prototype,
      objectProto = Object.prototype;

  /** Used to detect overreaching core-js shims. */
  var coreJsData = root['__core-js_shared__'];

  /** Used to resolve the decompiled source of functions. */
  var funcToString = funcProto.toString;

  /** Used to check objects for own properties. */
  var hasOwnProperty = objectProto.hasOwnProperty;

  /** Used to generate unique IDs. */
  var idCounter = 0;

  /** Used to detect methods masquerading as native. */
  var maskSrcKey = (function() {
    var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || '');
    return uid ? ('Symbol(src)_1.' + uid) : '';
  }());

  /**
   * Used to resolve the
   * [`toStringTag`](http://ecma-international.org/ecma-262/7.0/#sec-object.prototype.tostring)
   * of values.
   */
  var nativeObjectToString = objectProto.toString;

  /** Used to infer the `Object` constructor. */
  var objectCtorString = funcToString.call(Object);

  /** Used to restore the original `_` reference in `_.noConflict`. */
  var oldDash = root._;

  /** Used to detect if a method is native. */
  var reIsNative = RegExp('^' +
    funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\$&')
    .replace(/hasOwnProperty|(function).*?(?=\\\()| for .+?(?=\\\])/g, '$1.*?') + '$'
  );

  /** Built-in value references. */
  var Buffer = moduleExports ? root.Buffer : undefined,
      Symbol = root.Symbol,
      Uint8Array = root.Uint8Array,
      allocUnsafe = Buffer ? Buffer.allocUnsafe : undefined,
      getPrototype = overArg(Object.getPrototypeOf, Object),
      objectCreate = Object.create,
      propertyIsEnumerable = objectProto.propertyIsEnumerable,
      splice = arrayProto.splice,
      spreadableSymbol = Symbol ? Symbol.isConcatSpreadable : undefined,
      symIterator = Symbol ? Symbol.iterator : undefined,
      symToStringTag = Symbol ? Symbol.toStringTag : undefined;

  var defineProperty = (function() {
    try {
      var func = getNative(Object, 'defineProperty');
      func({}, '', {});
      return func;
    } catch (e) {}
  }());

  /* Built-in method references for those with the same name as other `lodash` methods. */
  var nativeCeil = Math.ceil,
      nativeFloor = Math.floor,
      nativeGetSymbols = Object.getOwnPropertySymbols,
      nativeIsBuffer = Buffer ? Buffer.isBuffer : undefined,
      nativeIsFinite = root.isFinite,
      nativeKeys = overArg(Object.keys, Object),
      nativeMax = Math.max,
      nativeMin = Math.min,
      nativeNow = Date.now,
      nativeRandom = Math.random,
      nativeReverse = arrayProto.reverse;

  /* Built-in method references that are verified to be native. */
  var DataView = getNative(root, 'DataView'),
      Map = getNative(root, 'Map'),
      Promise = getNative(root, 'Promise'),
      Set = getNative(root, 'Set'),
      WeakMap = getNative(root, 'WeakMap'),
      nativeCreate = getNative(Object, 'create');

  /** Used to store function metadata. */
  var metaMap = WeakMap && new WeakMap;

  /** Used to lookup unminified function names. */
  var realNames = {};

  /** Used to detect maps, sets, and weakmaps. */
  var dataViewCtorString = toSource(DataView),
      mapCtorString = toSource(Map),
      promiseCtorString = toSource(Promise),
      setCtorString = toSource(Set),
      weakMapCtorString = toSource(WeakMap);

  /** Used to convert symbols to primitives and strings. */
  var symbolProto = Symbol ? Symbol.prototype : undefined,
      symbolValueOf = symbolProto ? symbolProto.valueOf : undefined,
      symbolToString = symbolProto ? symbolProto.toString : undefined;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a `lodash` object which wraps `value` to enable implicit method
   * chain sequences. Methods that operate on and return arrays, collections,
   * and functions can be chained together. Methods that retrieve a single value
   * or may return a primitive value will automatically end the chain sequence
   * and return the unwrapped value. Otherwise, the value must be unwrapped
   * with `_#value`.
   *
   * Explicit chain sequences, which must be unwrapped with `_#value`, may be
   * enabled using `_.chain`.
   *
   * The execution of chained methods is lazy, that is, it's deferred until
   * `_#value` is implicitly or explicitly called.
   *
   * Lazy evaluation allows several methods to support shortcut fusion.
   * Shortcut fusion is an optimization to merge iteratee calls; this avoids
   * the creation of intermediate arrays and can greatly reduce the number of
   * iteratee executions. Sections of a chain sequence qualify for shortcut
   * fusion if the section is applied to an array and iteratees accept only
   * one argument. The heuristic for whether a section qualifies for shortcut
   * fusion is subject to change.
   *
   * Chaining is supported in custom builds as long as the `_#value` method is
   * directly or indirectly included in the build.
   *
   * In addition to lodash methods, wrappers have `Array` and `String` methods.
   *
   * The wrapper `Array` methods are:
   * `concat`, `join`, `pop`, `push`, `shift`, `sort`, `splice`, and `unshift`
   *
   * The wrapper `String` methods are:
   * `replace` and `split`
   *
   * The wrapper methods that support shortcut fusion are:
   * `at`, `compact`, `drop`, `dropRight`, `dropWhile`, `filter`, `find`,
   * `findLast`, `head`, `initial`, `last`, `map`, `reject`, `reverse`, `slice`,
   * `tail`, `take`, `takeRight`, `takeRightWhile`, `takeWhile`, and `toArray`
   *
   * The chainable wrapper methods are:
   * `after`, `ary`, `assign`, `assignIn`, `assignInWith`, `assignWith`, `at`,
   * `before`, `bind`, `bindAll`, `bindKey`, `castArray`, `chain`, `chunk`,
   * `commit`, `compact`, `concat`, `conforms`, `constant`, `countBy`, `create`,
   * `curry`, `debounce`, `defaults`, `defaultsDeep`, `defer`, `delay`,
   * `difference`, `differenceBy`, `differenceWith`, `drop`, `dropRight`,
   * `dropRightWhile`, `dropWhile`, `extend`, `extendWith`, `fill`, `filter`,
   * `flatMap`, `flatMapDeep`, `flatMapDepth`, `flatten`, `flattenDeep`,
   * `flattenDepth`, `flip`, `flow`, `flowRight`, `fromPairs`, `functions`,
   * `functionsIn`, `groupBy`, `initial`, `intersection`, `intersectionBy`,
   * `intersectionWith`, `invert`, `invertBy`, `invokeMap`, `iteratee`, `keyBy`,
   * `keys`, `keysIn`, `map`, `mapKeys`, `mapValues`, `matches`, `matchesProperty`,
   * `memoize`, `merge`, `mergeWith`, `method`, `methodOf`, `mixin`, `negate`,
   * `nthArg`, `omit`, `omitBy`, `once`, `orderBy`, `over`, `overArgs`,
   * `overEvery`, `overSome`, `partial`, `partialRight`, `partition`, `pick`,
   * `pickBy`, `plant`, `property`, `propertyOf`, `pull`, `pullAll`, `pullAllBy`,
   * `pullAllWith`, `pullAt`, `push`, `range`, `rangeRight`, `rearg`, `reject`,
   * `remove`, `rest`, `reverse`, `sampleSize`, `set`, `setWith`, `shuffle`,
   * `slice`, `sort`, `sortBy`, `splice`, `spread`, `tail`, `take`, `takeRight`,
   * `takeRightWhile`, `takeWhile`, `tap`, `throttle`, `thru`, `toArray`,
   * `toPairs`, `toPairsIn`, `toPath`, `toPlainObject`, `transform`, `unary`,
   * `union`, `unionBy`, `unionWith`, `uniq`, `uniqBy`, `uniqWith`, `unset`,
   * `unshift`, `unzip`, `unzipWith`, `update`, `updateWith`, `values`,
   * `valuesIn`, `without`, `wrap`, `xor`, `xorBy`, `xorWith`, `zip`,
   * `zipObject`, `zipObjectDeep`, and `zipWith`
   *
   * The wrapper methods that are **not** chainable by default are:
   * `add`, `attempt`, `camelCase`, `capitalize`, `ceil`, `clamp`, `clone`,
   * `cloneDeep`, `cloneDeepWith`, `cloneWith`, `conformsTo`, `deburr`,
   * `defaultTo`, `divide`, `each`, `eachRight`, `endsWith`, `eq`, `escape`,
   * `escapeRegExp`, `every`, `find`, `findIndex`, `findKey`, `findLast`,
   * `findLastIndex`, `findLastKey`, `first`, `floor`, `forEach`, `forEachRight`,
   * `forIn`, `forInRight`, `forOwn`, `forOwnRight`, `get`, `gt`, `gte`, `has`,
   * `hasIn`, `head`, `identity`, `includes`, `indexOf`, `inRange`, `invoke`,
   * `isArguments`, `isArray`, `isArrayBuffer`, `isArrayLike`, `isArrayLikeObject`,
   * `isBoolean`, `isBuffer`, `isDate`, `isElement`, `isEmpty`, `isEqual`,
   * `isEqualWith`, `isError`, `isFinite`, `isFunction`, `isInteger`, `isLength`,
   * `isMap`, `isMatch`, `isMatchWith`, `isNaN`, `isNative`, `isNil`, `isNull`,
   * `isNumber`, `isObject`, `isObjectLike`, `isPlainObject`, `isRegExp`,
   * `isSafeInteger`, `isSet`, `isString`, `isUndefined`, `isTypedArray`,
   * `isWeakMap`, `isWeakSet`, `join`, `kebabCase`, `last`, `lastIndexOf`,
   * `lowerCase`, `lowerFirst`, `lt`, `lte`, `max`, `maxBy`, `mean`, `meanBy`,
   * `min`, `minBy`, `multiply`, `noConflict`, `noop`, `now`, `nth`, `pad`,
   * `padEnd`, `padStart`, `parseInt`, `pop`, `random`, `reduce`, `reduceRight`,
   * `repeat`, `result`, `round`, `runInContext`, `sample`, `shift`, `size`,
   * `snakeCase`, `some`, `sortedIndex`, `sortedIndexBy`, `sortedLastIndex`,
   * `sortedLastIndexBy`, `startCase`, `startsWith`, `stubArray`, `stubFalse`,
   * `stubObject`, `stubString`, `stubTrue`, `subtract`, `sum`, `sumBy`,
   * `template`, `times`, `toFinite`, `toInteger`, `toJSON`, `toLength`,
   * `toLower`, `toNumber`, `toSafeInteger`, `toString`, `toUpper`, `trim`,
   * `trimEnd`, `trimStart`, `truncate`, `unescape`, `uniqueId`, `upperCase`,
   * `upperFirst`, `value`, and `words`
   *
   * @name _
   * @constructor
   * @category Seq
   * @param {*} value The value to wrap in a `lodash` instance.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * var wrapped = _([1, 2, 3]);
   *
   * // Returns an unwrapped value.
   * wrapped.reduce(_.add);
   * // => 6
   *
   * // Returns a wrapped value.
   * var squares = wrapped.map(square);
   *
   * _.isArray(squares);
   * // => false
   *
   * _.isArray(squares.value());
   * // => true
   */
  function lodash(value) {
    if (isObjectLike(value) && !isArray(value) && !(value instanceof LazyWrapper)) {
      if (value instanceof LodashWrapper) {
        return value;
      }
      if (hasOwnProperty.call(value, '__wrapped__')) {
        return wrapperClone(value);
      }
    }
    return new LodashWrapper(value);
  }

  /**
   * The base implementation of `_.create` without support for assigning
   * properties to the created object.
   *
   * @private
   * @param {Object} proto The object to inherit from.
   * @returns {Object} Returns the new object.
   */
  var baseCreate = (function() {
    function object() {}
    return function(proto) {
      if (!isObject(proto)) {
        return {};
      }
      if (objectCreate) {
        return objectCreate(proto);
      }
      object.prototype = proto;
      var result = new object;
      object.prototype = undefined;
      return result;
    };
  }());

  /**
   * The function whose prototype chain sequence wrappers inherit from.
   *
   * @private
   */
  function baseLodash() {
    // No operation performed.
  }

  /**
   * The base constructor for creating `lodash` wrapper objects.
   *
   * @private
   * @param {*} value The value to wrap.
   * @param {boolean} [chainAll] Enable explicit method chain sequences.
   */
  function LodashWrapper(value, chainAll) {
    this.__wrapped__ = value;
    this.__actions__ = [];
    this.__chain__ = !!chainAll;
    this.__index__ = 0;
    this.__values__ = undefined;
  }

  // Ensure wrappers are instances of `baseLodash`.
  lodash.prototype = baseLodash.prototype;
  lodash.prototype.constructor = lodash;

  LodashWrapper.prototype = baseCreate(baseLodash.prototype);
  LodashWrapper.prototype.constructor = LodashWrapper;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a lazy wrapper object which wraps `value` to enable lazy evaluation.
   *
   * @private
   * @constructor
   * @param {*} value The value to wrap.
   */
  function LazyWrapper(value) {
    this.__wrapped__ = value;
    this.__actions__ = [];
    this.__dir__ = 1;
    this.__filtered__ = false;
    this.__iteratees__ = [];
    this.__takeCount__ = MAX_ARRAY_LENGTH;
    this.__views__ = [];
  }

  /**
   * Creates a clone of the lazy wrapper object.
   *
   * @private
   * @name clone
   * @memberOf LazyWrapper
   * @returns {Object} Returns the cloned `LazyWrapper` object.
   */
  function lazyClone() {
    var result = new LazyWrapper(this.__wrapped__);
    result.__actions__ = copyArray(this.__actions__);
    result.__dir__ = this.__dir__;
    result.__filtered__ = this.__filtered__;
    result.__iteratees__ = copyArray(this.__iteratees__);
    result.__takeCount__ = this.__takeCount__;
    result.__views__ = copyArray(this.__views__);
    return result;
  }

  /**
   * Reverses the direction of lazy iteration.
   *
   * @private
   * @name reverse
   * @memberOf LazyWrapper
   * @returns {Object} Returns the new reversed `LazyWrapper` object.
   */
  function lazyReverse() {
    if (this.__filtered__) {
      var result = new LazyWrapper(this);
      result.__dir__ = -1;
      result.__filtered__ = true;
    } else {
      result = this.clone();
      result.__dir__ *= -1;
    }
    return result;
  }

  /**
   * Extracts the unwrapped value from its lazy wrapper.
   *
   * @private
   * @name value
   * @memberOf LazyWrapper
   * @returns {*} Returns the unwrapped value.
   */
  function lazyValue() {
    var array = this.__wrapped__.value(),
        dir = this.__dir__,
        isArr = isArray(array),
        isRight = dir < 0,
        arrLength = isArr ? array.length : 0,
        view = getView(0, arrLength, this.__views__),
        start = view.start,
        end = view.end,
        length = end - start,
        index = isRight ? end : (start - 1),
        iteratees = this.__iteratees__,
        iterLength = iteratees.length,
        resIndex = 0,
        takeCount = nativeMin(length, this.__takeCount__);

    if (!isArr || (!isRight && arrLength == length && takeCount == length)) {
      return baseWrapperValue(array, this.__actions__);
    }
    var result = [];

    outer:
    while (length-- && resIndex < takeCount) {
      index += dir;

      var iterIndex = -1,
          value = array[index];

      while (++iterIndex < iterLength) {
        var data = iteratees[iterIndex],
            iteratee = data.iteratee,
            type = data.type,
            computed = iteratee(value);

        if (type == LAZY_MAP_FLAG) {
          value = computed;
        } else if (!computed) {
          if (type == LAZY_FILTER_FLAG) {
            continue outer;
          } else {
            break outer;
          }
        }
      }
      result[resIndex++] = value;
    }
    return result;
  }

  // Ensure `LazyWrapper` is an instance of `baseLodash`.
  LazyWrapper.prototype = baseCreate(baseLodash.prototype);
  LazyWrapper.prototype.constructor = LazyWrapper;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a hash object.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function Hash(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the hash.
   *
   * @private
   * @name clear
   * @memberOf Hash
   */
  function hashClear() {
    this.__data__ = nativeCreate ? nativeCreate(null) : {};
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the hash.
   *
   * @private
   * @name delete
   * @memberOf Hash
   * @param {Object} hash The hash to modify.
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function hashDelete(key) {
    var result = this.has(key) && delete this.__data__[key];
    this.size -= result ? 1 : 0;
    return result;
  }

  /**
   * Gets the hash value for `key`.
   *
   * @private
   * @name get
   * @memberOf Hash
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function hashGet(key) {
    var data = this.__data__;
    if (nativeCreate) {
      var result = data[key];
      return result === HASH_UNDEFINED ? undefined : result;
    }
    return hasOwnProperty.call(data, key) ? data[key] : undefined;
  }

  /**
   * Checks if a hash value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf Hash
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function hashHas(key) {
    var data = this.__data__;
    return nativeCreate ? (data[key] !== undefined) : hasOwnProperty.call(data, key);
  }

  /**
   * Sets the hash `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf Hash
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the hash instance.
   */
  function hashSet(key, value) {
    var data = this.__data__;
    this.size += this.has(key) ? 0 : 1;
    data[key] = (nativeCreate && value === undefined) ? HASH_UNDEFINED : value;
    return this;
  }

  // Add methods to `Hash`.
  Hash.prototype.clear = hashClear;
  Hash.prototype['delete'] = hashDelete;
  Hash.prototype.get = hashGet;
  Hash.prototype.has = hashHas;
  Hash.prototype.set = hashSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates an list cache object.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function ListCache(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the list cache.
   *
   * @private
   * @name clear
   * @memberOf ListCache
   */
  function listCacheClear() {
    this.__data__ = [];
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the list cache.
   *
   * @private
   * @name delete
   * @memberOf ListCache
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function listCacheDelete(key) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    if (index < 0) {
      return false;
    }
    var lastIndex = data.length - 1;
    if (index == lastIndex) {
      data.pop();
    } else {
      splice.call(data, index, 1);
    }
    --this.size;
    return true;
  }

  /**
   * Gets the list cache value for `key`.
   *
   * @private
   * @name get
   * @memberOf ListCache
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function listCacheGet(key) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    return index < 0 ? undefined : data[index][1];
  }

  /**
   * Checks if a list cache value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf ListCache
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function listCacheHas(key) {
    return assocIndexOf(this.__data__, key) > -1;
  }

  /**
   * Sets the list cache `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf ListCache
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the list cache instance.
   */
  function listCacheSet(key, value) {
    var data = this.__data__,
        index = assocIndexOf(data, key);

    if (index < 0) {
      ++this.size;
      data.push([key, value]);
    } else {
      data[index][1] = value;
    }
    return this;
  }

  // Add methods to `ListCache`.
  ListCache.prototype.clear = listCacheClear;
  ListCache.prototype['delete'] = listCacheDelete;
  ListCache.prototype.get = listCacheGet;
  ListCache.prototype.has = listCacheHas;
  ListCache.prototype.set = listCacheSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a map cache object to store key-value pairs.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function MapCache(entries) {
    var index = -1,
        length = entries == null ? 0 : entries.length;

    this.clear();
    while (++index < length) {
      var entry = entries[index];
      this.set(entry[0], entry[1]);
    }
  }

  /**
   * Removes all key-value entries from the map.
   *
   * @private
   * @name clear
   * @memberOf MapCache
   */
  function mapCacheClear() {
    this.size = 0;
    this.__data__ = {
      'hash': new Hash,
      'map': new (Map || ListCache),
      'string': new Hash
    };
  }

  /**
   * Removes `key` and its value from the map.
   *
   * @private
   * @name delete
   * @memberOf MapCache
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function mapCacheDelete(key) {
    var result = getMapData(this, key)['delete'](key);
    this.size -= result ? 1 : 0;
    return result;
  }

  /**
   * Gets the map value for `key`.
   *
   * @private
   * @name get
   * @memberOf MapCache
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function mapCacheGet(key) {
    return getMapData(this, key).get(key);
  }

  /**
   * Checks if a map value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf MapCache
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function mapCacheHas(key) {
    return getMapData(this, key).has(key);
  }

  /**
   * Sets the map `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf MapCache
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the map cache instance.
   */
  function mapCacheSet(key, value) {
    var data = getMapData(this, key),
        size = data.size;

    data.set(key, value);
    this.size += data.size == size ? 0 : 1;
    return this;
  }

  // Add methods to `MapCache`.
  MapCache.prototype.clear = mapCacheClear;
  MapCache.prototype['delete'] = mapCacheDelete;
  MapCache.prototype.get = mapCacheGet;
  MapCache.prototype.has = mapCacheHas;
  MapCache.prototype.set = mapCacheSet;

  /*------------------------------------------------------------------------*/

  /**
   *
   * Creates an array cache object to store unique values.
   *
   * @private
   * @constructor
   * @param {Array} [values] The values to cache.
   */
  function SetCache(values) {
    var index = -1,
        length = values == null ? 0 : values.length;

    this.__data__ = new MapCache;
    while (++index < length) {
      this.add(values[index]);
    }
  }

  /**
   * Adds `value` to the array cache.
   *
   * @private
   * @name add
   * @memberOf SetCache
   * @alias push
   * @param {*} value The value to cache.
   * @returns {Object} Returns the cache instance.
   */
  function setCacheAdd(value) {
    this.__data__.set(value, HASH_UNDEFINED);
    return this;
  }

  /**
   * Checks if `value` is in the array cache.
   *
   * @private
   * @name has
   * @memberOf SetCache
   * @param {*} value The value to search for.
   * @returns {number} Returns `true` if `value` is found, else `false`.
   */
  function setCacheHas(value) {
    return this.__data__.has(value);
  }

  // Add methods to `SetCache`.
  SetCache.prototype.add = SetCache.prototype.push = setCacheAdd;
  SetCache.prototype.has = setCacheHas;

  /*------------------------------------------------------------------------*/

  /**
   * Creates a stack cache object to store key-value pairs.
   *
   * @private
   * @constructor
   * @param {Array} [entries] The key-value pairs to cache.
   */
  function Stack(entries) {
    var data = this.__data__ = new ListCache(entries);
    this.size = data.size;
  }

  /**
   * Removes all key-value entries from the stack.
   *
   * @private
   * @name clear
   * @memberOf Stack
   */
  function stackClear() {
    this.__data__ = new ListCache;
    this.size = 0;
  }

  /**
   * Removes `key` and its value from the stack.
   *
   * @private
   * @name delete
   * @memberOf Stack
   * @param {string} key The key of the value to remove.
   * @returns {boolean} Returns `true` if the entry was removed, else `false`.
   */
  function stackDelete(key) {
    var data = this.__data__,
        result = data['delete'](key);

    this.size = data.size;
    return result;
  }

  /**
   * Gets the stack value for `key`.
   *
   * @private
   * @name get
   * @memberOf Stack
   * @param {string} key The key of the value to get.
   * @returns {*} Returns the entry value.
   */
  function stackGet(key) {
    return this.__data__.get(key);
  }

  /**
   * Checks if a stack value for `key` exists.
   *
   * @private
   * @name has
   * @memberOf Stack
   * @param {string} key The key of the entry to check.
   * @returns {boolean} Returns `true` if an entry for `key` exists, else `false`.
   */
  function stackHas(key) {
    return this.__data__.has(key);
  }

  /**
   * Sets the stack `key` to `value`.
   *
   * @private
   * @name set
   * @memberOf Stack
   * @param {string} key The key of the value to set.
   * @param {*} value The value to set.
   * @returns {Object} Returns the stack cache instance.
   */
  function stackSet(key, value) {
    var data = this.__data__;
    if (data instanceof ListCache) {
      var pairs = data.__data__;
      if (!Map || (pairs.length < LARGE_ARRAY_SIZE - 1)) {
        pairs.push([key, value]);
        this.size = ++data.size;
        return this;
      }
      data = this.__data__ = new MapCache(pairs);
    }
    data.set(key, value);
    this.size = data.size;
    return this;
  }

  // Add methods to `Stack`.
  Stack.prototype.clear = stackClear;
  Stack.prototype['delete'] = stackDelete;
  Stack.prototype.get = stackGet;
  Stack.prototype.has = stackHas;
  Stack.prototype.set = stackSet;

  /*------------------------------------------------------------------------*/

  /**
   * Creates an array of the enumerable property names of the array-like `value`.
   *
   * @private
   * @param {*} value The value to query.
   * @param {boolean} inherited Specify returning inherited property names.
   * @returns {Array} Returns the array of property names.
   */
  function arrayLikeKeys(value, inherited) {
    var isArr = isArray(value),
        isArg = !isArr && isArguments(value),
        isBuff = !isArr && !isArg && isBuffer(value),
        isType = !isArr && !isArg && !isBuff && isTypedArray(value),
        skipIndexes = isArr || isArg || isBuff || isType,
        result = skipIndexes ? baseTimes(value.length, String) : [],
        length = result.length;

    for (var key in value) {
      if ((inherited || hasOwnProperty.call(value, key)) &&
          !(skipIndexes && (
             // Safari 9 has enumerable `arguments.length` in strict mode.
             key == 'length' ||
             // Node.js 0.10 has enumerable non-index properties on buffers.
             (isBuff && (key == 'offset' || key == 'parent')) ||
             // PhantomJS 2 has enumerable non-index properties on typed arrays.
             (isType && (key == 'buffer' || key == 'byteLength' || key == 'byteOffset')) ||
             // Skip index properties.
             isIndex(key, length)
          ))) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * This function is like `assignValue` except that it doesn't assign
   * `undefined` values.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function assignMergeValue(object, key, value) {
    if ((value !== undefined && !eq(object[key], value)) ||
        (value === undefined && !(key in object))) {
      baseAssignValue(object, key, value);
    }
  }

  /**
   * Assigns `value` to `key` of `object` if the existing value is not equivalent
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function assignValue(object, key, value) {
    var objValue = object[key];
    if (!(hasOwnProperty.call(object, key) && eq(objValue, value)) ||
        (value === undefined && !(key in object))) {
      baseAssignValue(object, key, value);
    }
  }

  /**
   * Gets the index at which the `key` is found in `array` of key-value pairs.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {*} key The key to search for.
   * @returns {number} Returns the index of the matched value, else `-1`.
   */
  function assocIndexOf(array, key) {
    var length = array.length;
    while (length--) {
      if (eq(array[length][0], key)) {
        return length;
      }
    }
    return -1;
  }

  /**
   * Aggregates elements of `collection` on `accumulator` with keys transformed
   * by `iteratee` and values set by `setter`.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform keys.
   * @param {Object} accumulator The initial aggregated object.
   * @returns {Function} Returns `accumulator`.
   */
  function baseAggregator(collection, setter, iteratee, accumulator) {
    baseEach(collection, function(value, key, collection) {
      setter(accumulator, value, iteratee(value), collection);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.assign` without support for multiple sources
   * or `customizer` functions.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @returns {Object} Returns `object`.
   */
  function baseAssign(object, source) {
    return object && copyObject(source, keys(source), object);
  }

  /**
   * The base implementation of `_.assignIn` without support for multiple sources
   * or `customizer` functions.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @returns {Object} Returns `object`.
   */
  function baseAssignIn(object, source) {
    return object && copyObject(source, keysIn(source), object);
  }

  /**
   * The base implementation of `assignValue` and `assignMergeValue` without
   * value checks.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {string} key The key of the property to assign.
   * @param {*} value The value to assign.
   */
  function baseAssignValue(object, key, value) {
    if (key == '__proto__' && defineProperty) {
      defineProperty(object, key, {
        'configurable': true,
        'enumerable': true,
        'value': value,
        'writable': true
      });
    } else {
      object[key] = value;
    }
  }

  /**
   * The base implementation of `_.at` without support for individual paths.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {string[]} paths The property paths to pick.
   * @returns {Array} Returns the picked elements.
   */
  function baseAt(object, paths) {
    var index = -1,
        length = paths.length,
        result = Array(length),
        skip = object == null;

    while (++index < length) {
      result[index] = skip ? undefined : get(object, paths[index]);
    }
    return result;
  }

  /**
   * The base implementation of `_.clamp` which doesn't coerce arguments.
   *
   * @private
   * @param {number} number The number to clamp.
   * @param {number} [lower] The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the clamped number.
   */
  function baseClamp(number, lower, upper) {
    if (number === number) {
      if (upper !== undefined) {
        number = number <= upper ? number : upper;
      }
      if (lower !== undefined) {
        number = number >= lower ? number : lower;
      }
    }
    return number;
  }

  /**
   * The base implementation of `_.clone` and `_.cloneDeep` which tracks
   * traversed objects.
   *
   * @private
   * @param {*} value The value to clone.
   * @param {boolean} bitmask The bitmask flags.
   *  1 - Deep clone
   *  2 - Flatten inherited properties
   *  4 - Clone symbols
   * @param {Function} [customizer] The function to customize cloning.
   * @param {string} [key] The key of `value`.
   * @param {Object} [object] The parent object of `value`.
   * @param {Object} [stack] Tracks traversed objects and their clone counterparts.
   * @returns {*} Returns the cloned value.
   */
  function baseClone(value, bitmask, customizer, key, object, stack) {
    var result,
        isDeep = bitmask & CLONE_DEEP_FLAG,
        isFlat = bitmask & CLONE_FLAT_FLAG,
        isFull = bitmask & CLONE_SYMBOLS_FLAG;

    if (customizer) {
      result = object ? customizer(value, key, object, stack) : customizer(value);
    }
    if (result !== undefined) {
      return result;
    }
    if (!isObject(value)) {
      return value;
    }
    var isArr = isArray(value);
    if (isArr) {
      result = initCloneArray(value);
      if (!isDeep) {
        return copyArray(value, result);
      }
    } else {
      var tag = getTag(value),
          isFunc = tag == funcTag || tag == genTag;

      if (isBuffer(value)) {
        return cloneBuffer(value, isDeep);
      }
      if (tag == objectTag || tag == argsTag || (isFunc && !object)) {
        result = (isFlat || isFunc) ? {} : initCloneObject(value);
        if (!isDeep) {
          return isFlat
            ? copySymbolsIn(value, baseAssignIn(result, value))
            : copySymbols(value, baseAssign(result, value));
        }
      } else {
        if (!cloneableTags[tag]) {
          return object ? value : {};
        }
        result = initCloneByTag(value, tag, isDeep);
      }
    }
    // Check for circular references and return its corresponding clone.
    stack || (stack = new Stack);
    var stacked = stack.get(value);
    if (stacked) {
      return stacked;
    }
    stack.set(value, result);

    if (isSet(value)) {
      value.forEach(function(subValue) {
        result.add(baseClone(subValue, bitmask, customizer, subValue, value, stack));
      });

      return result;
    }

    if (isMap(value)) {
      value.forEach(function(subValue, key) {
        result.set(key, baseClone(subValue, bitmask, customizer, key, value, stack));
      });

      return result;
    }

    var keysFunc = isFull
      ? (isFlat ? getAllKeysIn : getAllKeys)
      : (isFlat ? keysIn : keys);

    var props = isArr ? undefined : keysFunc(value);
    arrayEach(props || value, function(subValue, key) {
      if (props) {
        key = subValue;
        subValue = value[key];
      }
      // Recursively populate clone (susceptible to call stack limits).
      assignValue(result, key, baseClone(subValue, bitmask, customizer, key, value, stack));
    });
    return result;
  }

  /**
   * The base implementation of `_.delay` and `_.defer` which accepts `args`
   * to provide to `func`.
   *
   * @private
   * @param {Function} func The function to delay.
   * @param {number} wait The number of milliseconds to delay invocation.
   * @param {Array} args The arguments to provide to `func`.
   * @returns {number|Object} Returns the timer id or timeout object.
   */
  function baseDelay(func, wait, args) {
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    return setTimeout(function() { func.apply(undefined, args); }, wait);
  }

  /**
   * The base implementation of methods like `_.difference` without support
   * for excluding multiple arrays or iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Array} values The values to exclude.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new array of filtered values.
   */
  function baseDifference(array, values, iteratee, comparator) {
    var index = -1,
        includes = arrayIncludes,
        isCommon = true,
        length = array.length,
        result = [],
        valuesLength = values.length;

    if (!length) {
      return result;
    }
    if (iteratee) {
      values = arrayMap(values, baseUnary(iteratee));
    }
    if (comparator) {
      includes = arrayIncludesWith;
      isCommon = false;
    }
    else if (values.length >= LARGE_ARRAY_SIZE) {
      includes = cacheHas;
      isCommon = false;
      values = new SetCache(values);
    }
    outer:
    while (++index < length) {
      var value = array[index],
          computed = iteratee == null ? value : iteratee(value);

      value = (comparator || value !== 0) ? value : 0;
      if (isCommon && computed === computed) {
        var valuesIndex = valuesLength;
        while (valuesIndex--) {
          if (values[valuesIndex] === computed) {
            continue outer;
          }
        }
        result.push(value);
      }
      else if (!includes(values, computed, comparator)) {
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.forEach` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array|Object} Returns `collection`.
   */
  var baseEach = createBaseEach(baseForOwn);

  /**
   * The base implementation of `_.every` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`
   */
  function baseEvery(collection, predicate) {
    var result = true;
    baseEach(collection, function(value, index, collection) {
      result = !!predicate(value, index, collection);
      return result;
    });
    return result;
  }

  /**
   * The base implementation of methods like `_.max` and `_.min` which accepts a
   * `comparator` to determine the extremum value.
   *
   * @private
   * @param {Array} array The array to iterate over.
   * @param {Function} iteratee The iteratee invoked per iteration.
   * @param {Function} comparator The comparator used to compare values.
   * @returns {*} Returns the extremum value.
   */
  function baseExtremum(array, iteratee, comparator) {
    var index = -1,
        length = array.length;

    while (++index < length) {
      var value = array[index],
          current = iteratee(value);

      if (current != null && (computed === undefined
            ? (current === current && !isSymbol(current))
            : comparator(current, computed)
          )) {
        var computed = current,
            result = value;
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.filter` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   */
  function baseFilter(collection, predicate) {
    var result = [];
    baseEach(collection, function(value, index, collection) {
      if (predicate(value, index, collection)) {
        result.push(value);
      }
    });
    return result;
  }

  /**
   * The base implementation of `_.flatten` with support for restricting flattening.
   *
   * @private
   * @param {Array} array The array to flatten.
   * @param {number} depth The maximum recursion depth.
   * @param {boolean} [predicate=isFlattenable] The function invoked per iteration.
   * @param {boolean} [isStrict] Restrict to values that pass `predicate` checks.
   * @param {Array} [result=[]] The initial result value.
   * @returns {Array} Returns the new flattened array.
   */
  function baseFlatten(array, depth, predicate, isStrict, result) {
    var index = -1,
        length = array.length;

    predicate || (predicate = isFlattenable);
    result || (result = []);

    while (++index < length) {
      var value = array[index];
      if (depth > 0 && predicate(value)) {
        if (depth > 1) {
          // Recursively flatten arrays (susceptible to call stack limits).
          baseFlatten(value, depth - 1, predicate, isStrict, result);
        } else {
          arrayPush(result, value);
        }
      } else if (!isStrict) {
        result[result.length] = value;
      }
    }
    return result;
  }

  /**
   * The base implementation of `baseForOwn` which iterates over `object`
   * properties returned by `keysFunc` and invokes `iteratee` for each property.
   * Iteratee functions may exit iteration early by explicitly returning `false`.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @returns {Object} Returns `object`.
   */
  var baseFor = createBaseFor();

  /**
   * This function is like `baseFor` except that it iterates over properties
   * in the opposite order.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @returns {Object} Returns `object`.
   */
  var baseForRight = createBaseFor(true);

  /**
   * The base implementation of `_.forOwn` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Object} Returns `object`.
   */
  function baseForOwn(object, iteratee) {
    return object && baseFor(object, iteratee, keys);
  }

  /**
   * The base implementation of `_.forOwnRight` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Object} Returns `object`.
   */
  function baseForOwnRight(object, iteratee) {
    return object && baseForRight(object, iteratee, keys);
  }

  /**
   * The base implementation of `_.functions` which creates an array of
   * `object` function property names filtered from `props`.
   *
   * @private
   * @param {Object} object The object to inspect.
   * @param {Array} props The property names to filter.
   * @returns {Array} Returns the function names.
   */
  function baseFunctions(object, props) {
    return arrayFilter(props, function(key) {
      return isFunction(object[key]);
    });
  }

  /**
   * The base implementation of `_.get` without support for default values.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to get.
   * @returns {*} Returns the resolved value.
   */
  function baseGet(object, path) {
    path = castPath(path, object);

    var index = 0,
        length = path.length;

    while (object != null && index < length) {
      object = object[toKey(path[index++])];
    }
    return (index && index == length) ? object : undefined;
  }

  /**
   * The base implementation of `getAllKeys` and `getAllKeysIn` which uses
   * `keysFunc` and `symbolsFunc` to get the enumerable property names and
   * symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Function} keysFunc The function to get the keys of `object`.
   * @param {Function} symbolsFunc The function to get the symbols of `object`.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function baseGetAllKeys(object, keysFunc, symbolsFunc) {
    var result = keysFunc(object);
    return isArray(object) ? result : arrayPush(result, symbolsFunc(object));
  }

  /**
   * The base implementation of `getTag` without fallbacks for buggy environments.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the `toStringTag`.
   */
  function baseGetTag(value) {
    if (value == null) {
      return value === undefined ? undefinedTag : nullTag;
    }
    return (symToStringTag && symToStringTag in Object(value))
      ? getRawTag(value)
      : objectToString(value);
  }

  /**
   * The base implementation of `_.gt` which doesn't coerce arguments.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if `value` is greater than `other`,
   *  else `false`.
   */
  function baseGt(value, other) {
    return value > other;
  }

  /**
   * The base implementation of `_.has` without support for deep paths.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {Array|string} key The key to check.
   * @returns {boolean} Returns `true` if `key` exists, else `false`.
   */
  function baseHas(object, key) {
    return object != null && hasOwnProperty.call(object, key);
  }

  /**
   * The base implementation of `_.hasIn` without support for deep paths.
   *
   * @private
   * @param {Object} [object] The object to query.
   * @param {Array|string} key The key to check.
   * @returns {boolean} Returns `true` if `key` exists, else `false`.
   */
  function baseHasIn(object, key) {
    return object != null && key in Object(object);
  }

  /**
   * The base implementation of methods like `_.intersection`, without support
   * for iteratee shorthands, that accepts an array of arrays to inspect.
   *
   * @private
   * @param {Array} arrays The arrays to inspect.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new array of shared values.
   */
  function baseIntersection(arrays, iteratee, comparator) {
    var includes = comparator ? arrayIncludesWith : arrayIncludes,
        length = arrays[0].length,
        othLength = arrays.length,
        othIndex = othLength,
        caches = Array(othLength),
        maxLength = Infinity,
        result = [];

    while (othIndex--) {
      var array = arrays[othIndex];
      if (othIndex && iteratee) {
        array = arrayMap(array, baseUnary(iteratee));
      }
      maxLength = nativeMin(array.length, maxLength);
      caches[othIndex] = !comparator && (iteratee || (length >= 120 && array.length >= 120))
        ? new SetCache(othIndex && array)
        : undefined;
    }
    array = arrays[0];

    var index = -1,
        seen = caches[0];

    outer:
    while (++index < length && result.length < maxLength) {
      var value = array[index],
          computed = iteratee ? iteratee(value) : value;

      value = (comparator || value !== 0) ? value : 0;
      if (!(seen
            ? cacheHas(seen, computed)
            : includes(result, computed, comparator)
          )) {
        othIndex = othLength;
        while (--othIndex) {
          var cache = caches[othIndex];
          if (!(cache
                ? cacheHas(cache, computed)
                : includes(arrays[othIndex], computed, comparator))
              ) {
            continue outer;
          }
        }
        if (seen) {
          seen.push(computed);
        }
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.invert` and `_.invertBy` which inverts
   * `object` with values transformed by `iteratee` and set by `setter`.
   *
   * @private
   * @param {Object} object The object to iterate over.
   * @param {Function} setter The function to set `accumulator` values.
   * @param {Function} iteratee The iteratee to transform values.
   * @param {Object} accumulator The initial inverted object.
   * @returns {Function} Returns `accumulator`.
   */
  function baseInverter(object, setter, iteratee, accumulator) {
    baseForOwn(object, function(value, key, object) {
      setter(accumulator, iteratee(value), key, object);
    });
    return accumulator;
  }

  /**
   * The base implementation of `_.invoke` without support for individual
   * method arguments.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the method to invoke.
   * @param {Array} args The arguments to invoke the method with.
   * @returns {*} Returns the result of the invoked method.
   */
  function baseInvoke(object, path, args) {
    path = castPath(path, object);
    object = parent(object, path);
    var func = object == null ? object : object[toKey(last(path))];
    return func == null ? undefined : apply(func, object, args);
  }

  /**
   * The base implementation of `_.isArguments`.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an `arguments` object,
   */
  function baseIsArguments(value) {
    return isObjectLike(value) && baseGetTag(value) == argsTag;
  }

  /**
   * The base implementation of `_.isDate` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.
   */
  function baseIsDate(value) {
    return isObjectLike(value) && baseGetTag(value) == dateTag;
  }

  /**
   * The base implementation of `_.isEqual` which supports partial comparisons
   * and tracks traversed objects.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @param {boolean} bitmask The bitmask flags.
   *  1 - Unordered comparison
   *  2 - Partial comparison
   * @param {Function} [customizer] The function to customize comparisons.
   * @param {Object} [stack] Tracks traversed `value` and `other` objects.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   */
  function baseIsEqual(value, other, bitmask, customizer, stack) {
    if (value === other) {
      return true;
    }
    if (value == null || other == null || (!isObjectLike(value) && !isObjectLike(other))) {
      return value !== value && other !== other;
    }
    return baseIsEqualDeep(value, other, bitmask, customizer, baseIsEqual, stack);
  }

  /**
   * A specialized version of `baseIsEqual` for arrays and objects which performs
   * deep comparisons and tracks traversed objects enabling objects with circular
   * references to be compared.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} [stack] Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function baseIsEqualDeep(object, other, bitmask, customizer, equalFunc, stack) {
    var objIsArr = isArray(object),
        othIsArr = isArray(other),
        objTag = objIsArr ? arrayTag : getTag(object),
        othTag = othIsArr ? arrayTag : getTag(other);

    objTag = objTag == argsTag ? objectTag : objTag;
    othTag = othTag == argsTag ? objectTag : othTag;

    var objIsObj = objTag == objectTag,
        othIsObj = othTag == objectTag,
        isSameTag = objTag == othTag;

    if (isSameTag && isBuffer(object)) {
      if (!isBuffer(other)) {
        return false;
      }
      objIsArr = true;
      objIsObj = false;
    }
    if (isSameTag && !objIsObj) {
      stack || (stack = new Stack);
      return (objIsArr || isTypedArray(object))
        ? equalArrays(object, other, bitmask, customizer, equalFunc, stack)
        : equalByTag(object, other, objTag, bitmask, customizer, equalFunc, stack);
    }
    if (!(bitmask & COMPARE_PARTIAL_FLAG)) {
      var objIsWrapped = objIsObj && hasOwnProperty.call(object, '__wrapped__'),
          othIsWrapped = othIsObj && hasOwnProperty.call(other, '__wrapped__');

      if (objIsWrapped || othIsWrapped) {
        var objUnwrapped = objIsWrapped ? object.value() : object,
            othUnwrapped = othIsWrapped ? other.value() : other;

        stack || (stack = new Stack);
        return equalFunc(objUnwrapped, othUnwrapped, bitmask, customizer, stack);
      }
    }
    if (!isSameTag) {
      return false;
    }
    stack || (stack = new Stack);
    return equalObjects(object, other, bitmask, customizer, equalFunc, stack);
  }

  /**
   * The base implementation of `_.isMap` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a map, else `false`.
   */
  function baseIsMap(value) {
    return isObjectLike(value) && getTag(value) == mapTag;
  }

  /**
   * The base implementation of `_.isMatch` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The object to inspect.
   * @param {Object} source The object of property values to match.
   * @param {Array} matchData The property names, values, and compare flags to match.
   * @param {Function} [customizer] The function to customize comparisons.
   * @returns {boolean} Returns `true` if `object` is a match, else `false`.
   */
  function baseIsMatch(object, source, matchData, customizer) {
    var index = matchData.length,
        length = index,
        noCustomizer = !customizer;

    if (object == null) {
      return !length;
    }
    object = Object(object);
    while (index--) {
      var data = matchData[index];
      if ((noCustomizer && data[2])
            ? data[1] !== object[data[0]]
            : !(data[0] in object)
          ) {
        return false;
      }
    }
    while (++index < length) {
      data = matchData[index];
      var key = data[0],
          objValue = object[key],
          srcValue = data[1];

      if (noCustomizer && data[2]) {
        if (objValue === undefined && !(key in object)) {
          return false;
        }
      } else {
        var stack = new Stack;
        if (customizer) {
          var result = customizer(objValue, srcValue, key, object, source, stack);
        }
        if (!(result === undefined
              ? baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG, customizer, stack)
              : result
            )) {
          return false;
        }
      }
    }
    return true;
  }

  /**
   * The base implementation of `_.isNative` without bad shim checks.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a native function,
   *  else `false`.
   */
  function baseIsNative(value) {
    if (!isObject(value) || isMasked(value)) {
      return false;
    }
    var pattern = isFunction(value) ? reIsNative : reIsHostCtor;
    return pattern.test(toSource(value));
  }

  /**
   * The base implementation of `_.isRegExp` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.
   */
  function baseIsRegExp(value) {
    return isObjectLike(value) && baseGetTag(value) == regexpTag;
  }

  /**
   * The base implementation of `_.isSet` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a set, else `false`.
   */
  function baseIsSet(value) {
    return isObjectLike(value) && getTag(value) == setTag;
  }

  /**
   * The base implementation of `_.isTypedArray` without Node.js optimizations.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.
   */
  function baseIsTypedArray(value) {
    return isObjectLike(value) &&
      isLength(value.length) && !!typedArrayTags[baseGetTag(value)];
  }

  /**
   * The base implementation of `_.iteratee`.
   *
   * @private
   * @param {*} [value=_.identity] The value to convert to an iteratee.
   * @returns {Function} Returns the iteratee.
   */
  function baseIteratee(value) {
    // Don't store the `typeof` result in a variable to avoid a JIT bug in Safari 9.
    // See https://bugs.webkit.org/show_bug.cgi?id=156034 for more details.
    if (typeof value == 'function') {
      return value;
    }
    if (value == null) {
      return identity;
    }
    if (typeof value == 'object') {
      return isArray(value)
        ? baseMatchesProperty(value[0], value[1])
        : baseMatches(value);
    }
    return property(value);
  }

  /**
   * The base implementation of `_.keys` which doesn't treat sparse arrays as dense.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function baseKeys(object) {
    if (!isPrototype(object)) {
      return nativeKeys(object);
    }
    var result = [];
    for (var key in Object(object)) {
      if (hasOwnProperty.call(object, key) && key != 'constructor') {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.keysIn` which doesn't treat sparse arrays as dense.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function baseKeysIn(object) {
    if (!isObject(object)) {
      return nativeKeysIn(object);
    }
    var isProto = isPrototype(object),
        result = [];

    for (var key in object) {
      if (!(key == 'constructor' && (isProto || !hasOwnProperty.call(object, key)))) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.lt` which doesn't coerce arguments.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if `value` is less than `other`,
   *  else `false`.
   */
  function baseLt(value, other) {
    return value < other;
  }

  /**
   * The base implementation of `_.map` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} iteratee The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   */
  function baseMap(collection, iteratee) {
    var index = -1,
        result = isArrayLike(collection) ? Array(collection.length) : [];

    baseEach(collection, function(value, key, collection) {
      result[++index] = iteratee(value, key, collection);
    });
    return result;
  }

  /**
   * The base implementation of `_.matches` which doesn't clone `source`.
   *
   * @private
   * @param {Object} source The object of property values to match.
   * @returns {Function} Returns the new spec function.
   */
  function baseMatches(source) {
    var matchData = getMatchData(source);
    if (matchData.length == 1 && matchData[0][2]) {
      return matchesStrictComparable(matchData[0][0], matchData[0][1]);
    }
    return function(object) {
      return object === source || baseIsMatch(object, source, matchData);
    };
  }

  /**
   * The base implementation of `_.matchesProperty` which doesn't clone `srcValue`.
   *
   * @private
   * @param {string} path The path of the property to get.
   * @param {*} srcValue The value to match.
   * @returns {Function} Returns the new spec function.
   */
  function baseMatchesProperty(path, srcValue) {
    if (isKey(path) && isStrictComparable(srcValue)) {
      return matchesStrictComparable(toKey(path), srcValue);
    }
    return function(object) {
      var objValue = get(object, path);
      return (objValue === undefined && objValue === srcValue)
        ? hasIn(object, path)
        : baseIsEqual(srcValue, objValue, COMPARE_PARTIAL_FLAG | COMPARE_UNORDERED_FLAG);
    };
  }

  /**
   * The base implementation of `_.merge` without support for multiple sources.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @param {number} srcIndex The index of `source`.
   * @param {Function} [customizer] The function to customize merged values.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   */
  function baseMerge(object, source, srcIndex, customizer, stack) {
    if (object === source) {
      return;
    }
    baseFor(source, function(srcValue, key) {
      if (isObject(srcValue)) {
        stack || (stack = new Stack);
        baseMergeDeep(object, source, key, srcIndex, baseMerge, customizer, stack);
      }
      else {
        var newValue = customizer
          ? customizer(safeGet(object, key), srcValue, (key + ''), object, source, stack)
          : undefined;

        if (newValue === undefined) {
          newValue = srcValue;
        }
        assignMergeValue(object, key, newValue);
      }
    }, keysIn);
  }

  /**
   * A specialized version of `baseMerge` for arrays and objects which performs
   * deep merges and tracks traversed objects enabling objects with circular
   * references to be merged.
   *
   * @private
   * @param {Object} object The destination object.
   * @param {Object} source The source object.
   * @param {string} key The key of the value to merge.
   * @param {number} srcIndex The index of `source`.
   * @param {Function} mergeFunc The function to merge values.
   * @param {Function} [customizer] The function to customize assigned values.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   */
  function baseMergeDeep(object, source, key, srcIndex, mergeFunc, customizer, stack) {
    var objValue = safeGet(object, key),
        srcValue = safeGet(source, key),
        stacked = stack.get(srcValue);

    if (stacked) {
      assignMergeValue(object, key, stacked);
      return;
    }
    var newValue = customizer
      ? customizer(objValue, srcValue, (key + ''), object, source, stack)
      : undefined;

    var isCommon = newValue === undefined;

    if (isCommon) {
      var isArr = isArray(srcValue),
          isBuff = !isArr && isBuffer(srcValue),
          isTyped = !isArr && !isBuff && isTypedArray(srcValue);

      newValue = srcValue;
      if (isArr || isBuff || isTyped) {
        if (isArray(objValue)) {
          newValue = objValue;
        }
        else if (isArrayLikeObject(objValue)) {
          newValue = copyArray(objValue);
        }
        else if (isBuff) {
          isCommon = false;
          newValue = cloneBuffer(srcValue, true);
        }
        else if (isTyped) {
          isCommon = false;
          newValue = cloneTypedArray(srcValue, true);
        }
        else {
          newValue = [];
        }
      }
      else if (isPlainObject(srcValue) || isArguments(srcValue)) {
        newValue = objValue;
        if (isArguments(objValue)) {
          newValue = toPlainObject(objValue);
        }
        else if (!isObject(objValue) || (srcIndex && isFunction(objValue))) {
          newValue = initCloneObject(srcValue);
        }
      }
      else {
        isCommon = false;
      }
    }
    if (isCommon) {
      // Recursively merge objects and arrays (susceptible to call stack limits).
      stack.set(srcValue, newValue);
      mergeFunc(newValue, srcValue, srcIndex, customizer, stack);
      stack['delete'](srcValue);
    }
    assignMergeValue(object, key, newValue);
  }

  /**
   * The base implementation of `_.orderBy` without param guards.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function[]|Object[]|string[]} iteratees The iteratees to sort by.
   * @param {string[]} orders The sort orders of `iteratees`.
   * @returns {Array} Returns the new sorted array.
   */
  function baseOrderBy(collection, iteratees, orders) {
    var index = -1;
    iteratees = arrayMap(iteratees.length ? iteratees : [identity], baseUnary(baseIteratee));

    var result = baseMap(collection, function(value, key, collection) {
      var criteria = arrayMap(iteratees, function(iteratee) {
        return iteratee(value);
      });
      return { 'criteria': criteria, 'index': ++index, 'value': value };
    });

    return baseSortBy(result, function(object, other) {
      return compareMultiple(object, other, orders);
    });
  }

  /**
   * The base implementation of `_.pick` without support for individual
   * property identifiers.
   *
   * @private
   * @param {Object} object The source object.
   * @param {string[]} paths The property paths to pick.
   * @returns {Object} Returns the new object.
   */
  function basePick(object, paths) {
    return basePickBy(object, paths, function(value, path) {
      return hasIn(object, path);
    });
  }

  /**
   * The base implementation of  `_.pickBy` without support for iteratee shorthands.
   *
   * @private
   * @param {Object} object The source object.
   * @param {string[]} paths The property paths to pick.
   * @param {Function} predicate The function invoked per property.
   * @returns {Object} Returns the new object.
   */
  function basePickBy(object, paths, predicate) {
    var index = -1,
        length = paths.length,
        result = {};

    while (++index < length) {
      var path = paths[index],
          value = baseGet(object, path);

      if (predicate(value, path)) {
        baseSet(result, castPath(path, object), value);
      }
    }
    return result;
  }

  /**
   * A specialized version of `baseProperty` which supports deep paths.
   *
   * @private
   * @param {Array|string} path The path of the property to get.
   * @returns {Function} Returns the new accessor function.
   */
  function basePropertyDeep(path) {
    return function(object) {
      return baseGet(object, path);
    };
  }

  /**
   * The base implementation of `_.random` without support for returning
   * floating-point numbers.
   *
   * @private
   * @param {number} lower The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the random number.
   */
  function baseRandom(lower, upper) {
    return lower + nativeFloor(nativeRandom() * (upper - lower + 1));
  }

  /**
   * The base implementation of `_.range` and `_.rangeRight` which doesn't
   * coerce arguments.
   *
   * @private
   * @param {number} start The start of the range.
   * @param {number} end The end of the range.
   * @param {number} step The value to increment or decrement by.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Array} Returns the range of numbers.
   */
  function baseRange(start, end, step, fromRight) {
    var index = -1,
        length = nativeMax(nativeCeil((end - start) / (step || 1)), 0),
        result = Array(length);

    while (length--) {
      result[fromRight ? length : ++index] = start;
      start += step;
    }
    return result;
  }

  /**
   * The base implementation of `_.rest` which doesn't validate or coerce arguments.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @returns {Function} Returns the new function.
   */
  function baseRest(func, start) {
    return setToString(overRest(func, start, identity), func + '');
  }

  /**
   * The base implementation of `_.set`.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {Array|string} path The path of the property to set.
   * @param {*} value The value to set.
   * @param {Function} [customizer] The function to customize path creation.
   * @returns {Object} Returns `object`.
   */
  function baseSet(object, path, value, customizer) {
    if (!isObject(object)) {
      return object;
    }
    path = castPath(path, object);

    var index = -1,
        length = path.length,
        lastIndex = length - 1,
        nested = object;

    while (nested != null && ++index < length) {
      var key = toKey(path[index]),
          newValue = value;

      if (index != lastIndex) {
        var objValue = nested[key];
        newValue = customizer ? customizer(objValue, key, nested) : undefined;
        if (newValue === undefined) {
          newValue = isObject(objValue)
            ? objValue
            : (isIndex(path[index + 1]) ? [] : {});
        }
      }
      assignValue(nested, key, newValue);
      nested = nested[key];
    }
    return object;
  }

  /**
   * The base implementation of `setData` without support for hot loop shorting.
   *
   * @private
   * @param {Function} func The function to associate metadata with.
   * @param {*} data The metadata.
   * @returns {Function} Returns `func`.
   */
  var baseSetData = !metaMap ? identity : function(func, data) {
    metaMap.set(func, data);
    return func;
  };

  /**
   * The base implementation of `setToString` without support for hot loop shorting.
   *
   * @private
   * @param {Function} func The function to modify.
   * @param {Function} string The `toString` result.
   * @returns {Function} Returns `func`.
   */
  var baseSetToString = !defineProperty ? identity : function(func, string) {
    return defineProperty(func, 'toString', {
      'configurable': true,
      'enumerable': false,
      'value': constant(string),
      'writable': true
    });
  };

  /**
   * The base implementation of `_.slice` without an iteratee call guard.
   *
   * @private
   * @param {Array} array The array to slice.
   * @param {number} [start=0] The start position.
   * @param {number} [end=array.length] The end position.
   * @returns {Array} Returns the slice of `array`.
   */
  function baseSlice(array, start, end) {
    var index = -1,
        length = array.length;

    if (start < 0) {
      start = -start > length ? 0 : (length + start);
    }
    end = end > length ? length : end;
    if (end < 0) {
      end += length;
    }
    length = start > end ? 0 : ((end - start) >>> 0);
    start >>>= 0;

    var result = Array(length);
    while (++index < length) {
      result[index] = array[index + start];
    }
    return result;
  }

  /**
   * The base implementation of `_.some` without support for iteratee shorthands.
   *
   * @private
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} predicate The function invoked per iteration.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   */
  function baseSome(collection, predicate) {
    var result;

    baseEach(collection, function(value, index, collection) {
      result = predicate(value, index, collection);
      return !result;
    });
    return !!result;
  }

  /**
   * The base implementation of `_.toString` which doesn't convert nullish
   * values to empty strings.
   *
   * @private
   * @param {*} value The value to process.
   * @returns {string} Returns the string.
   */
  function baseToString(value) {
    // Exit early for strings to avoid a performance hit in some environments.
    if (typeof value == 'string') {
      return value;
    }
    if (isArray(value)) {
      // Recursively convert values (susceptible to call stack limits).
      return arrayMap(value, baseToString) + '';
    }
    if (isSymbol(value)) {
      return symbolToString ? symbolToString.call(value) : '';
    }
    var result = (value + '');
    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;
  }

  /**
   * The base implementation of `_.uniqBy` without support for iteratee shorthands.
   *
   * @private
   * @param {Array} array The array to inspect.
   * @param {Function} [iteratee] The iteratee invoked per element.
   * @param {Function} [comparator] The comparator invoked per element.
   * @returns {Array} Returns the new duplicate free array.
   */
  function baseUniq(array, iteratee, comparator) {
    var index = -1,
        includes = arrayIncludes,
        length = array.length,
        isCommon = true,
        result = [],
        seen = result;

    if (comparator) {
      isCommon = false;
      includes = arrayIncludesWith;
    }
    else if (length >= LARGE_ARRAY_SIZE) {
      var set = iteratee ? null : createSet(array);
      if (set) {
        return setToArray(set);
      }
      isCommon = false;
      includes = cacheHas;
      seen = new SetCache;
    }
    else {
      seen = iteratee ? [] : result;
    }
    outer:
    while (++index < length) {
      var value = array[index],
          computed = iteratee ? iteratee(value) : value;

      value = (comparator || value !== 0) ? value : 0;
      if (isCommon && computed === computed) {
        var seenIndex = seen.length;
        while (seenIndex--) {
          if (seen[seenIndex] === computed) {
            continue outer;
          }
        }
        if (iteratee) {
          seen.push(computed);
        }
        result.push(value);
      }
      else if (!includes(seen, computed, comparator)) {
        if (seen !== result) {
          seen.push(computed);
        }
        result.push(value);
      }
    }
    return result;
  }

  /**
   * The base implementation of `_.unset`.
   *
   * @private
   * @param {Object} object The object to modify.
   * @param {Array|string} path The property path to unset.
   * @returns {boolean} Returns `true` if the property is deleted, else `false`.
   */
  function baseUnset(object, path) {
    path = castPath(path, object);
    object = parent(object, path);
    return object == null || delete object[toKey(last(path))];
  }

  /**
   * The base implementation of `wrapperValue` which returns the result of
   * performing a sequence of actions on the unwrapped `value`, where each
   * successive action is supplied the return value of the previous.
   *
   * @private
   * @param {*} value The unwrapped value.
   * @param {Array} actions Actions to perform to resolve the unwrapped value.
   * @returns {*} Returns the resolved value.
   */
  function baseWrapperValue(value, actions) {
    var result = value;
    if (result instanceof LazyWrapper) {
      result = result.value();
    }
    return arrayReduce(actions, function(result, action) {
      return action.func.apply(action.thisArg, arrayPush([result], action.args));
    }, result);
  }

  /**
   * This base implementation of `_.zipObject` which assigns values using `assignFunc`.
   *
   * @private
   * @param {Array} props The property identifiers.
   * @param {Array} values The property values.
   * @param {Function} assignFunc The function to assign values.
   * @returns {Object} Returns the new object.
   */
  function baseZipObject(props, values, assignFunc) {
    var index = -1,
        length = props.length,
        valsLength = values.length,
        result = {};

    while (++index < length) {
      var value = index < valsLength ? values[index] : undefined;
      assignFunc(result, props[index], value);
    }
    return result;
  }

  /**
   * Casts `value` to an empty array if it's not an array like object.
   *
   * @private
   * @param {*} value The value to inspect.
   * @returns {Array|Object} Returns the cast array-like object.
   */
  function castArrayLikeObject(value) {
    return isArrayLikeObject(value) ? value : [];
  }

  /**
   * Casts `value` to a path array if it's not one.
   *
   * @private
   * @param {*} value The value to inspect.
   * @param {Object} [object] The object to query keys on.
   * @returns {Array} Returns the cast property path array.
   */
  function castPath(value, object) {
    if (isArray(value)) {
      return value;
    }
    return isKey(value, object) ? [value] : stringToPath(toString(value));
  }

  /**
   * Creates a clone of  `buffer`.
   *
   * @private
   * @param {Buffer} buffer The buffer to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Buffer} Returns the cloned buffer.
   */
  function cloneBuffer(buffer, isDeep) {
    if (isDeep) {
      return buffer.slice();
    }
    var length = buffer.length,
        result = allocUnsafe ? allocUnsafe(length) : new buffer.constructor(length);

    buffer.copy(result);
    return result;
  }

  /**
   * Creates a clone of `arrayBuffer`.
   *
   * @private
   * @param {ArrayBuffer} arrayBuffer The array buffer to clone.
   * @returns {ArrayBuffer} Returns the cloned array buffer.
   */
  function cloneArrayBuffer(arrayBuffer) {
    var result = new arrayBuffer.constructor(arrayBuffer.byteLength);
    new Uint8Array(result).set(new Uint8Array(arrayBuffer));
    return result;
  }

  /**
   * Creates a clone of `dataView`.
   *
   * @private
   * @param {Object} dataView The data view to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the cloned data view.
   */
  function cloneDataView(dataView, isDeep) {
    var buffer = isDeep ? cloneArrayBuffer(dataView.buffer) : dataView.buffer;
    return new dataView.constructor(buffer, dataView.byteOffset, dataView.byteLength);
  }

  /**
   * Creates a clone of `regexp`.
   *
   * @private
   * @param {Object} regexp The regexp to clone.
   * @returns {Object} Returns the cloned regexp.
   */
  function cloneRegExp(regexp) {
    var result = new regexp.constructor(regexp.source, reFlags.exec(regexp));
    result.lastIndex = regexp.lastIndex;
    return result;
  }

  /**
   * Creates a clone of the `symbol` object.
   *
   * @private
   * @param {Object} symbol The symbol object to clone.
   * @returns {Object} Returns the cloned symbol object.
   */
  function cloneSymbol(symbol) {
    return symbolValueOf ? Object(symbolValueOf.call(symbol)) : {};
  }

  /**
   * Creates a clone of `typedArray`.
   *
   * @private
   * @param {Object} typedArray The typed array to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the cloned typed array.
   */
  function cloneTypedArray(typedArray, isDeep) {
    var buffer = isDeep ? cloneArrayBuffer(typedArray.buffer) : typedArray.buffer;
    return new typedArray.constructor(buffer, typedArray.byteOffset, typedArray.length);
  }

  /**
   * Compares values to sort them in ascending order.
   *
   * @private
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {number} Returns the sort order indicator for `value`.
   */
  function compareAscending(value, other) {
    if (value !== other) {
      var valIsDefined = value !== undefined,
          valIsNull = value === null,
          valIsReflexive = value === value,
          valIsSymbol = isSymbol(value);

      var othIsDefined = other !== undefined,
          othIsNull = other === null,
          othIsReflexive = other === other,
          othIsSymbol = isSymbol(other);

      if ((!othIsNull && !othIsSymbol && !valIsSymbol && value > other) ||
          (valIsSymbol && othIsDefined && othIsReflexive && !othIsNull && !othIsSymbol) ||
          (valIsNull && othIsDefined && othIsReflexive) ||
          (!valIsDefined && othIsReflexive) ||
          !valIsReflexive) {
        return 1;
      }
      if ((!valIsNull && !valIsSymbol && !othIsSymbol && value < other) ||
          (othIsSymbol && valIsDefined && valIsReflexive && !valIsNull && !valIsSymbol) ||
          (othIsNull && valIsDefined && valIsReflexive) ||
          (!othIsDefined && valIsReflexive) ||
          !othIsReflexive) {
        return -1;
      }
    }
    return 0;
  }

  /**
   * Used by `_.orderBy` to compare multiple properties of a value to another
   * and stable sort them.
   *
   * If `orders` is unspecified, all values are sorted in ascending order. Otherwise,
   * specify an order of "desc" for descending or "asc" for ascending sort order
   * of corresponding values.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {boolean[]|string[]} orders The order to sort by for each property.
   * @returns {number} Returns the sort order indicator for `object`.
   */
  function compareMultiple(object, other, orders) {
    var index = -1,
        objCriteria = object.criteria,
        othCriteria = other.criteria,
        length = objCriteria.length,
        ordersLength = orders.length;

    while (++index < length) {
      var result = compareAscending(objCriteria[index], othCriteria[index]);
      if (result) {
        if (index >= ordersLength) {
          return result;
        }
        var order = orders[index];
        return result * (order == 'desc' ? -1 : 1);
      }
    }
    // Fixes an `Array#sort` bug in the JS engine embedded in Adobe applications
    // that causes it, under certain circumstances, to provide the same value for
    // `object` and `other`. See https://github.com/jashkenas/underscore/pull/1247
    // for more details.
    //
    // This also ensures a stable sort in V8 and other engines.
    // See https://bugs.chromium.org/p/v8/issues/detail?id=90 for more details.
    return object.index - other.index;
  }

  /**
   * Creates an array that is the composition of partially applied arguments,
   * placeholders, and provided arguments into a single array of arguments.
   *
   * @private
   * @param {Array} args The provided arguments.
   * @param {Array} partials The arguments to prepend to those provided.
   * @param {Array} holders The `partials` placeholder indexes.
   * @params {boolean} [isCurried] Specify composing for a curried function.
   * @returns {Array} Returns the new array of composed arguments.
   */
  function composeArgs(args, partials, holders, isCurried) {
    var argsIndex = -1,
        argsLength = args.length,
        holdersLength = holders.length,
        leftIndex = -1,
        leftLength = partials.length,
        rangeLength = nativeMax(argsLength - holdersLength, 0),
        result = Array(leftLength + rangeLength),
        isUncurried = !isCurried;

    while (++leftIndex < leftLength) {
      result[leftIndex] = partials[leftIndex];
    }
    while (++argsIndex < holdersLength) {
      if (isUncurried || argsIndex < argsLength) {
        result[holders[argsIndex]] = args[argsIndex];
      }
    }
    while (rangeLength--) {
      result[leftIndex++] = args[argsIndex++];
    }
    return result;
  }

  /**
   * This function is like `composeArgs` except that the arguments composition
   * is tailored for `_.partialRight`.
   *
   * @private
   * @param {Array} args The provided arguments.
   * @param {Array} partials The arguments to append to those provided.
   * @param {Array} holders The `partials` placeholder indexes.
   * @params {boolean} [isCurried] Specify composing for a curried function.
   * @returns {Array} Returns the new array of composed arguments.
   */
  function composeArgsRight(args, partials, holders, isCurried) {
    var argsIndex = -1,
        argsLength = args.length,
        holdersIndex = -1,
        holdersLength = holders.length,
        rightIndex = -1,
        rightLength = partials.length,
        rangeLength = nativeMax(argsLength - holdersLength, 0),
        result = Array(rangeLength + rightLength),
        isUncurried = !isCurried;

    while (++argsIndex < rangeLength) {
      result[argsIndex] = args[argsIndex];
    }
    var offset = argsIndex;
    while (++rightIndex < rightLength) {
      result[offset + rightIndex] = partials[rightIndex];
    }
    while (++holdersIndex < holdersLength) {
      if (isUncurried || argsIndex < argsLength) {
        result[offset + holders[holdersIndex]] = args[argsIndex++];
      }
    }
    return result;
  }

  /**
   * Copies the values of `source` to `array`.
   *
   * @private
   * @param {Array} source The array to copy values from.
   * @param {Array} [array=[]] The array to copy values to.
   * @returns {Array} Returns `array`.
   */
  function copyArray(source, array) {
    var index = -1,
        length = source.length;

    array || (array = Array(length));
    while (++index < length) {
      array[index] = source[index];
    }
    return array;
  }

  /**
   * Copies properties of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy properties from.
   * @param {Array} props The property identifiers to copy.
   * @param {Object} [object={}] The object to copy properties to.
   * @param {Function} [customizer] The function to customize copied values.
   * @returns {Object} Returns `object`.
   */
  function copyObject(source, props, object, customizer) {
    var isNew = !object;
    object || (object = {});

    var index = -1,
        length = props.length;

    while (++index < length) {
      var key = props[index];

      var newValue = customizer
        ? customizer(object[key], source[key], key, object, source)
        : undefined;

      if (newValue === undefined) {
        newValue = source[key];
      }
      if (isNew) {
        baseAssignValue(object, key, newValue);
      } else {
        assignValue(object, key, newValue);
      }
    }
    return object;
  }

  /**
   * Copies own symbols of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy symbols from.
   * @param {Object} [object={}] The object to copy symbols to.
   * @returns {Object} Returns `object`.
   */
  function copySymbols(source, object) {
    return copyObject(source, getSymbols(source), object);
  }

  /**
   * Copies own and inherited symbols of `source` to `object`.
   *
   * @private
   * @param {Object} source The object to copy symbols from.
   * @param {Object} [object={}] The object to copy symbols to.
   * @returns {Object} Returns `object`.
   */
  function copySymbolsIn(source, object) {
    return copyObject(source, getSymbolsIn(source), object);
  }

  /**
   * Creates a function like `_.groupBy`.
   *
   * @private
   * @param {Function} setter The function to set accumulator values.
   * @param {Function} [initializer] The accumulator object initializer.
   * @returns {Function} Returns the new aggregator function.
   */
  function createAggregator(setter, initializer) {
    return function(collection, iteratee) {
      var func = isArray(collection) ? arrayAggregator : baseAggregator,
          accumulator = initializer ? initializer() : {};

      return func(collection, setter, baseIteratee(iteratee, 2), accumulator);
    };
  }

  /**
   * Creates a function like `_.assign`.
   *
   * @private
   * @param {Function} assigner The function to assign values.
   * @returns {Function} Returns the new assigner function.
   */
  function createAssigner(assigner) {
    return baseRest(function(object, sources) {
      var index = -1,
          length = sources.length,
          customizer = length > 1 ? sources[length - 1] : undefined,
          guard = length > 2 ? sources[2] : undefined;

      customizer = (assigner.length > 3 && typeof customizer == 'function')
        ? (length--, customizer)
        : undefined;

      if (guard && isIterateeCall(sources[0], sources[1], guard)) {
        customizer = length < 3 ? undefined : customizer;
        length = 1;
      }
      object = Object(object);
      while (++index < length) {
        var source = sources[index];
        if (source) {
          assigner(object, source, index, customizer);
        }
      }
      return object;
    });
  }

  /**
   * Creates a `baseEach` or `baseEachRight` function.
   *
   * @private
   * @param {Function} eachFunc The function to iterate over a collection.
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new base function.
   */
  function createBaseEach(eachFunc, fromRight) {
    return function(collection, iteratee) {
      if (collection == null) {
        return collection;
      }
      if (!isArrayLike(collection)) {
        return eachFunc(collection, iteratee);
      }
      var length = collection.length,
          index = fromRight ? length : -1,
          iterable = Object(collection);

      while ((fromRight ? index-- : ++index < length)) {
        if (iteratee(iterable[index], index, iterable) === false) {
          break;
        }
      }
      return collection;
    };
  }

  /**
   * Creates a base function for methods like `_.forIn` and `_.forOwn`.
   *
   * @private
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new base function.
   */
  function createBaseFor(fromRight) {
    return function(object, iteratee, keysFunc) {
      var index = -1,
          iterable = Object(object),
          props = keysFunc(object),
          length = props.length;

      while (length--) {
        var key = props[fromRight ? length : ++index];
        if (iteratee(iterable[key], key, iterable) === false) {
          break;
        }
      }
      return object;
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with the optional `this`
   * binding of `thisArg`.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createBind(func, bitmask, thisArg) {
    var isBind = bitmask & WRAP_BIND_FLAG,
        Ctor = createCtor(func);

    function wrapper() {
      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;
      return fn.apply(isBind ? thisArg : this, arguments);
    }
    return wrapper;
  }

  /**
   * Creates a function that produces an instance of `Ctor` regardless of
   * whether it was invoked as part of a `new` expression or by `call` or `apply`.
   *
   * @private
   * @param {Function} Ctor The constructor to wrap.
   * @returns {Function} Returns the new wrapped function.
   */
  function createCtor(Ctor) {
    return function() {
      // Use a `switch` statement to work with class constructors. See
      // http://ecma-international.org/ecma-262/7.0/#sec-ecmascript-function-objects-call-thisargument-argumentslist
      // for more details.
      var args = arguments;
      switch (args.length) {
        case 0: return new Ctor;
        case 1: return new Ctor(args[0]);
        case 2: return new Ctor(args[0], args[1]);
        case 3: return new Ctor(args[0], args[1], args[2]);
        case 4: return new Ctor(args[0], args[1], args[2], args[3]);
        case 5: return new Ctor(args[0], args[1], args[2], args[3], args[4]);
        case 6: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5]);
        case 7: return new Ctor(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
      }
      var thisBinding = baseCreate(Ctor.prototype),
          result = Ctor.apply(thisBinding, args);

      // Mimic the constructor's `return` behavior.
      // See https://es5.github.io/#x13.2.2 for more details.
      return isObject(result) ? result : thisBinding;
    };
  }

  /**
   * Creates a function that wraps `func` to enable currying.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {number} arity The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createCurry(func, bitmask, arity) {
    var Ctor = createCtor(func);

    function wrapper() {
      var length = arguments.length,
          args = Array(length),
          index = length,
          placeholder = getHolder(wrapper);

      while (index--) {
        args[index] = arguments[index];
      }
      var holders = (length < 3 && args[0] !== placeholder && args[length - 1] !== placeholder)
        ? []
        : replaceHolders(args, placeholder);

      length -= holders.length;
      if (length < arity) {
        return createRecurry(
          func, bitmask, createHybrid, wrapper.placeholder, undefined,
          args, holders, undefined, undefined, arity - length);
      }
      var fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;
      return apply(fn, this, args);
    }
    return wrapper;
  }

  /**
   * Creates a `_.find` or `_.findLast` function.
   *
   * @private
   * @param {Function} findIndexFunc The function to find the collection index.
   * @returns {Function} Returns the new find function.
   */
  function createFind(findIndexFunc) {
    return function(collection, predicate, fromIndex) {
      var iterable = Object(collection);
      if (!isArrayLike(collection)) {
        var iteratee = baseIteratee(predicate, 3);
        collection = keys(collection);
        predicate = function(key) { return iteratee(iterable[key], key, iterable); };
      }
      var index = findIndexFunc(collection, predicate, fromIndex);
      return index > -1 ? iterable[iteratee ? collection[index] : index] : undefined;
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with optional `this`
   * binding of `thisArg`, partial application, and currying.
   *
   * @private
   * @param {Function|string} func The function or method name to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to prepend to those provided to
   *  the new function.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [partialsRight] The arguments to append to those provided
   *  to the new function.
   * @param {Array} [holdersRight] The `partialsRight` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createHybrid(func, bitmask, thisArg, partials, holders, partialsRight, holdersRight, argPos, ary, arity) {
    var isAry = bitmask & WRAP_ARY_FLAG,
        isBind = bitmask & WRAP_BIND_FLAG,
        isBindKey = bitmask & WRAP_BIND_KEY_FLAG,
        isCurried = bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG),
        isFlip = bitmask & WRAP_FLIP_FLAG,
        Ctor = isBindKey ? undefined : createCtor(func);

    function wrapper() {
      var length = arguments.length,
          args = Array(length),
          index = length;

      while (index--) {
        args[index] = arguments[index];
      }
      if (isCurried) {
        var placeholder = getHolder(wrapper),
            holdersCount = countHolders(args, placeholder);
      }
      if (partials) {
        args = composeArgs(args, partials, holders, isCurried);
      }
      if (partialsRight) {
        args = composeArgsRight(args, partialsRight, holdersRight, isCurried);
      }
      length -= holdersCount;
      if (isCurried && length < arity) {
        var newHolders = replaceHolders(args, placeholder);
        return createRecurry(
          func, bitmask, createHybrid, wrapper.placeholder, thisArg,
          args, newHolders, argPos, ary, arity - length
        );
      }
      var thisBinding = isBind ? thisArg : this,
          fn = isBindKey ? thisBinding[func] : func;

      length = args.length;
      if (argPos) {
        args = reorder(args, argPos);
      } else if (isFlip && length > 1) {
        args.reverse();
      }
      if (isAry && ary < length) {
        args.length = ary;
      }
      if (this && this !== root && this instanceof wrapper) {
        fn = Ctor || createCtor(fn);
      }
      return fn.apply(thisBinding, args);
    }
    return wrapper;
  }

  /**
   * Creates a function like `_.invertBy`.
   *
   * @private
   * @param {Function} setter The function to set accumulator values.
   * @param {Function} toIteratee The function to resolve iteratees.
   * @returns {Function} Returns the new inverter function.
   */
  function createInverter(setter, toIteratee) {
    return function(object, iteratee) {
      return baseInverter(object, setter, toIteratee(iteratee), {});
    };
  }

  /**
   * Creates a function that wraps `func` to invoke it with the `this` binding
   * of `thisArg` and `partials` prepended to the arguments it receives.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {Array} partials The arguments to prepend to those provided to
   *  the new function.
   * @returns {Function} Returns the new wrapped function.
   */
  function createPartial(func, bitmask, thisArg, partials) {
    var isBind = bitmask & WRAP_BIND_FLAG,
        Ctor = createCtor(func);

    function wrapper() {
      var argsIndex = -1,
          argsLength = arguments.length,
          leftIndex = -1,
          leftLength = partials.length,
          args = Array(leftLength + argsLength),
          fn = (this && this !== root && this instanceof wrapper) ? Ctor : func;

      while (++leftIndex < leftLength) {
        args[leftIndex] = partials[leftIndex];
      }
      while (argsLength--) {
        args[leftIndex++] = arguments[++argsIndex];
      }
      return apply(fn, isBind ? thisArg : this, args);
    }
    return wrapper;
  }

  /**
   * Creates a `_.range` or `_.rangeRight` function.
   *
   * @private
   * @param {boolean} [fromRight] Specify iterating from right to left.
   * @returns {Function} Returns the new range function.
   */
  function createRange(fromRight) {
    return function(start, end, step) {
      if (step && typeof step != 'number' && isIterateeCall(start, end, step)) {
        end = step = undefined;
      }
      // Ensure the sign of `-0` is preserved.
      start = toFinite(start);
      if (end === undefined) {
        end = start;
        start = 0;
      } else {
        end = toFinite(end);
      }
      step = step === undefined ? (start < end ? 1 : -1) : toFinite(step);
      return baseRange(start, end, step, fromRight);
    };
  }

  /**
   * Creates a function that wraps `func` to continue currying.
   *
   * @private
   * @param {Function} func The function to wrap.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @param {Function} wrapFunc The function to create the `func` wrapper.
   * @param {*} placeholder The placeholder value.
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to prepend to those provided to
   *  the new function.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createRecurry(func, bitmask, wrapFunc, placeholder, thisArg, partials, holders, argPos, ary, arity) {
    var isCurry = bitmask & WRAP_CURRY_FLAG,
        newHolders = isCurry ? holders : undefined,
        newHoldersRight = isCurry ? undefined : holders,
        newPartials = isCurry ? partials : undefined,
        newPartialsRight = isCurry ? undefined : partials;

    bitmask |= (isCurry ? WRAP_PARTIAL_FLAG : WRAP_PARTIAL_RIGHT_FLAG);
    bitmask &= ~(isCurry ? WRAP_PARTIAL_RIGHT_FLAG : WRAP_PARTIAL_FLAG);

    if (!(bitmask & WRAP_CURRY_BOUND_FLAG)) {
      bitmask &= ~(WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG);
    }
    var newData = [
      func, bitmask, thisArg, newPartials, newHolders, newPartialsRight,
      newHoldersRight, argPos, ary, arity
    ];

    var result = wrapFunc.apply(undefined, newData);
    if (isLaziable(func)) {
      setData(result, newData);
    }
    result.placeholder = placeholder;
    return setWrapToString(result, func, bitmask);
  }

  /**
   * Creates a set object of `values`.
   *
   * @private
   * @param {Array} values The values to add to the set.
   * @returns {Object} Returns the new set.
   */
  var createSet = !(Set && (1 / setToArray(new Set([,-0]))[1]) == INFINITY) ? noop : function(values) {
    return new Set(values);
  };

  /**
   * Creates a function that either curries or invokes `func` with optional
   * `this` binding and partially applied arguments.
   *
   * @private
   * @param {Function|string} func The function or method name to wrap.
   * @param {number} bitmask The bitmask flags.
   *    1 - `_.bind`
   *    2 - `_.bindKey`
   *    4 - `_.curry` or `_.curryRight` of a bound function
   *    8 - `_.curry`
   *   16 - `_.curryRight`
   *   32 - `_.partial`
   *   64 - `_.partialRight`
   *  128 - `_.rearg`
   *  256 - `_.ary`
   *  512 - `_.flip`
   * @param {*} [thisArg] The `this` binding of `func`.
   * @param {Array} [partials] The arguments to be partially applied.
   * @param {Array} [holders] The `partials` placeholder indexes.
   * @param {Array} [argPos] The argument positions of the new function.
   * @param {number} [ary] The arity cap of `func`.
   * @param {number} [arity] The arity of `func`.
   * @returns {Function} Returns the new wrapped function.
   */
  function createWrap(func, bitmask, thisArg, partials, holders, argPos, ary, arity) {
    var isBindKey = bitmask & WRAP_BIND_KEY_FLAG;
    if (!isBindKey && typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    var length = partials ? partials.length : 0;
    if (!length) {
      bitmask &= ~(WRAP_PARTIAL_FLAG | WRAP_PARTIAL_RIGHT_FLAG);
      partials = holders = undefined;
    }
    ary = ary === undefined ? ary : nativeMax(toInteger(ary), 0);
    arity = arity === undefined ? arity : toInteger(arity);
    length -= holders ? holders.length : 0;

    if (bitmask & WRAP_PARTIAL_RIGHT_FLAG) {
      var partialsRight = partials,
          holdersRight = holders;

      partials = holders = undefined;
    }
    var data = isBindKey ? undefined : getData(func);

    var newData = [
      func, bitmask, thisArg, partials, holders, partialsRight, holdersRight,
      argPos, ary, arity
    ];

    if (data) {
      mergeData(newData, data);
    }
    func = newData[0];
    bitmask = newData[1];
    thisArg = newData[2];
    partials = newData[3];
    holders = newData[4];
    arity = newData[9] = newData[9] === undefined
      ? (isBindKey ? 0 : func.length)
      : nativeMax(newData[9] - length, 0);

    if (!arity && bitmask & (WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG)) {
      bitmask &= ~(WRAP_CURRY_FLAG | WRAP_CURRY_RIGHT_FLAG);
    }
    if (!bitmask || bitmask == WRAP_BIND_FLAG) {
      var result = createBind(func, bitmask, thisArg);
    } else if (bitmask == WRAP_CURRY_FLAG || bitmask == WRAP_CURRY_RIGHT_FLAG) {
      result = createCurry(func, bitmask, arity);
    } else if ((bitmask == WRAP_PARTIAL_FLAG || bitmask == (WRAP_BIND_FLAG | WRAP_PARTIAL_FLAG)) && !holders.length) {
      result = createPartial(func, bitmask, thisArg, partials);
    } else {
      result = createHybrid.apply(undefined, newData);
    }
    var setter = data ? baseSetData : setData;
    return setWrapToString(setter(result, newData), func, bitmask);
  }

  /**
   * Used by `_.defaultsDeep` to customize its `_.merge` use to merge source
   * objects into destination objects that are passed thru.
   *
   * @private
   * @param {*} objValue The destination value.
   * @param {*} srcValue The source value.
   * @param {string} key The key of the property to merge.
   * @param {Object} object The parent object of `objValue`.
   * @param {Object} source The parent object of `srcValue`.
   * @param {Object} [stack] Tracks traversed source values and their merged
   *  counterparts.
   * @returns {*} Returns the value to assign.
   */
  function customDefaultsMerge(objValue, srcValue, key, object, source, stack) {
    if (isObject(objValue) && isObject(srcValue)) {
      // Recursively merge objects and arrays (susceptible to call stack limits).
      stack.set(srcValue, objValue);
      baseMerge(objValue, srcValue, undefined, customDefaultsMerge, stack);
      stack['delete'](srcValue);
    }
    return objValue;
  }

  /**
   * Used by `_.omit` to customize its `_.cloneDeep` use to only clone plain
   * objects.
   *
   * @private
   * @param {*} value The value to inspect.
   * @param {string} key The key of the property to inspect.
   * @returns {*} Returns the uncloned value or `undefined` to defer cloning to `_.cloneDeep`.
   */
  function customOmitClone(value) {
    return isPlainObject(value) ? undefined : value;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for arrays with support for
   * partial deep comparisons.
   *
   * @private
   * @param {Array} array The array to compare.
   * @param {Array} other The other array to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `array` and `other` objects.
   * @returns {boolean} Returns `true` if the arrays are equivalent, else `false`.
   */
  function equalArrays(array, other, bitmask, customizer, equalFunc, stack) {
    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,
        arrLength = array.length,
        othLength = other.length;

    if (arrLength != othLength && !(isPartial && othLength > arrLength)) {
      return false;
    }
    // Assume cyclic values are equal.
    var stacked = stack.get(array);
    if (stacked && stack.get(other)) {
      return stacked == other;
    }
    var index = -1,
        result = true,
        seen = (bitmask & COMPARE_UNORDERED_FLAG) ? new SetCache : undefined;

    stack.set(array, other);
    stack.set(other, array);

    // Ignore non-index properties.
    while (++index < arrLength) {
      var arrValue = array[index],
          othValue = other[index];

      if (customizer) {
        var compared = isPartial
          ? customizer(othValue, arrValue, index, other, array, stack)
          : customizer(arrValue, othValue, index, array, other, stack);
      }
      if (compared !== undefined) {
        if (compared) {
          continue;
        }
        result = false;
        break;
      }
      // Recursively compare arrays (susceptible to call stack limits).
      if (seen) {
        if (!arraySome(other, function(othValue, othIndex) {
              if (!cacheHas(seen, othIndex) &&
                  (arrValue === othValue || equalFunc(arrValue, othValue, bitmask, customizer, stack))) {
                return seen.push(othIndex);
              }
            })) {
          result = false;
          break;
        }
      } else if (!(
            arrValue === othValue ||
              equalFunc(arrValue, othValue, bitmask, customizer, stack)
          )) {
        result = false;
        break;
      }
    }
    stack['delete'](array);
    stack['delete'](other);
    return result;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for comparing objects of
   * the same `toStringTag`.
   *
   * **Note:** This function only supports comparing values with tags of
   * `Boolean`, `Date`, `Error`, `Number`, `RegExp`, or `String`.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {string} tag The `toStringTag` of the objects to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function equalByTag(object, other, tag, bitmask, customizer, equalFunc, stack) {
    switch (tag) {
      case dataViewTag:
        if ((object.byteLength != other.byteLength) ||
            (object.byteOffset != other.byteOffset)) {
          return false;
        }
        object = object.buffer;
        other = other.buffer;

      case arrayBufferTag:
        if ((object.byteLength != other.byteLength) ||
            !equalFunc(new Uint8Array(object), new Uint8Array(other))) {
          return false;
        }
        return true;

      case boolTag:
      case dateTag:
      case numberTag:
        // Coerce booleans to `1` or `0` and dates to milliseconds.
        // Invalid dates are coerced to `NaN`.
        return eq(+object, +other);

      case errorTag:
        return object.name == other.name && object.message == other.message;

      case regexpTag:
      case stringTag:
        // Coerce regexes to strings and treat strings, primitives and objects,
        // as equal. See http://www.ecma-international.org/ecma-262/7.0/#sec-regexp.prototype.tostring
        // for more details.
        return object == (other + '');

      case mapTag:
        var convert = mapToArray;

      case setTag:
        var isPartial = bitmask & COMPARE_PARTIAL_FLAG;
        convert || (convert = setToArray);

        if (object.size != other.size && !isPartial) {
          return false;
        }
        // Assume cyclic values are equal.
        var stacked = stack.get(object);
        if (stacked) {
          return stacked == other;
        }
        bitmask |= COMPARE_UNORDERED_FLAG;

        // Recursively compare objects (susceptible to call stack limits).
        stack.set(object, other);
        var result = equalArrays(convert(object), convert(other), bitmask, customizer, equalFunc, stack);
        stack['delete'](object);
        return result;

      case symbolTag:
        if (symbolValueOf) {
          return symbolValueOf.call(object) == symbolValueOf.call(other);
        }
    }
    return false;
  }

  /**
   * A specialized version of `baseIsEqualDeep` for objects with support for
   * partial deep comparisons.
   *
   * @private
   * @param {Object} object The object to compare.
   * @param {Object} other The other object to compare.
   * @param {number} bitmask The bitmask flags. See `baseIsEqual` for more details.
   * @param {Function} customizer The function to customize comparisons.
   * @param {Function} equalFunc The function to determine equivalents of values.
   * @param {Object} stack Tracks traversed `object` and `other` objects.
   * @returns {boolean} Returns `true` if the objects are equivalent, else `false`.
   */
  function equalObjects(object, other, bitmask, customizer, equalFunc, stack) {
    var isPartial = bitmask & COMPARE_PARTIAL_FLAG,
        objProps = getAllKeys(object),
        objLength = objProps.length,
        othProps = getAllKeys(other),
        othLength = othProps.length;

    if (objLength != othLength && !isPartial) {
      return false;
    }
    var index = objLength;
    while (index--) {
      var key = objProps[index];
      if (!(isPartial ? key in other : hasOwnProperty.call(other, key))) {
        return false;
      }
    }
    // Assume cyclic values are equal.
    var stacked = stack.get(object);
    if (stacked && stack.get(other)) {
      return stacked == other;
    }
    var result = true;
    stack.set(object, other);
    stack.set(other, object);

    var skipCtor = isPartial;
    while (++index < objLength) {
      key = objProps[index];
      var objValue = object[key],
          othValue = other[key];

      if (customizer) {
        var compared = isPartial
          ? customizer(othValue, objValue, key, other, object, stack)
          : customizer(objValue, othValue, key, object, other, stack);
      }
      // Recursively compare objects (susceptible to call stack limits).
      if (!(compared === undefined
            ? (objValue === othValue || equalFunc(objValue, othValue, bitmask, customizer, stack))
            : compared
          )) {
        result = false;
        break;
      }
      skipCtor || (skipCtor = key == 'constructor');
    }
    if (result && !skipCtor) {
      var objCtor = object.constructor,
          othCtor = other.constructor;

      // Non `Object` object instances with different constructors are not equal.
      if (objCtor != othCtor &&
          ('constructor' in object && 'constructor' in other) &&
          !(typeof objCtor == 'function' && objCtor instanceof objCtor &&
            typeof othCtor == 'function' && othCtor instanceof othCtor)) {
        result = false;
      }
    }
    stack['delete'](object);
    stack['delete'](other);
    return result;
  }

  /**
   * A specialized version of `baseRest` which flattens the rest array.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @returns {Function} Returns the new function.
   */
  function flatRest(func) {
    return setToString(overRest(func, undefined, flatten), func + '');
  }

  /**
   * Creates an array of own enumerable property names and symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function getAllKeys(object) {
    return baseGetAllKeys(object, keys, getSymbols);
  }

  /**
   * Creates an array of own and inherited enumerable property names and
   * symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names and symbols.
   */
  function getAllKeysIn(object) {
    return baseGetAllKeys(object, keysIn, getSymbolsIn);
  }

  /**
   * Gets metadata for `func`.
   *
   * @private
   * @param {Function} func The function to query.
   * @returns {*} Returns the metadata for `func`.
   */
  var getData = !metaMap ? noop : function(func) {
    return metaMap.get(func);
  };

  /**
   * Gets the name of `func`.
   *
   * @private
   * @param {Function} func The function to query.
   * @returns {string} Returns the function name.
   */
  function getFuncName(func) {
    var result = (func.name + ''),
        array = realNames[result],
        length = hasOwnProperty.call(realNames, result) ? array.length : 0;

    while (length--) {
      var data = array[length],
          otherFunc = data.func;
      if (otherFunc == null || otherFunc == func) {
        return data.name;
      }
    }
    return result;
  }

  /**
   * Gets the argument placeholder value for `func`.
   *
   * @private
   * @param {Function} func The function to inspect.
   * @returns {*} Returns the placeholder value.
   */
  function getHolder(func) {
    var object = hasOwnProperty.call(lodash, 'placeholder') ? lodash : func;
    return object.placeholder;
  }

  /**
   * Gets the data for `map`.
   *
   * @private
   * @param {Object} map The map to query.
   * @param {string} key The reference key.
   * @returns {*} Returns the map data.
   */
  function getMapData(map, key) {
    var data = map.__data__;
    return isKeyable(key)
      ? data[typeof key == 'string' ? 'string' : 'hash']
      : data.map;
  }

  /**
   * Gets the property names, values, and compare flags of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the match data of `object`.
   */
  function getMatchData(object) {
    var result = keys(object),
        length = result.length;

    while (length--) {
      var key = result[length],
          value = object[key];

      result[length] = [key, value, isStrictComparable(value)];
    }
    return result;
  }

  /**
   * Gets the native function at `key` of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {string} key The key of the method to get.
   * @returns {*} Returns the function if it's native, else `undefined`.
   */
  function getNative(object, key) {
    var value = getValue(object, key);
    return baseIsNative(value) ? value : undefined;
  }

  /**
   * A specialized version of `baseGetTag` which ignores `Symbol.toStringTag` values.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the raw `toStringTag`.
   */
  function getRawTag(value) {
    var isOwn = hasOwnProperty.call(value, symToStringTag),
        tag = value[symToStringTag];

    try {
      value[symToStringTag] = undefined;
      var unmasked = true;
    } catch (e) {}

    var result = nativeObjectToString.call(value);
    if (unmasked) {
      if (isOwn) {
        value[symToStringTag] = tag;
      } else {
        delete value[symToStringTag];
      }
    }
    return result;
  }

  /**
   * Creates an array of the own enumerable symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of symbols.
   */
  var getSymbols = !nativeGetSymbols ? stubArray : function(object) {
    if (object == null) {
      return [];
    }
    object = Object(object);
    return arrayFilter(nativeGetSymbols(object), function(symbol) {
      return propertyIsEnumerable.call(object, symbol);
    });
  };

  /**
   * Creates an array of the own and inherited enumerable symbols of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of symbols.
   */
  var getSymbolsIn = !nativeGetSymbols ? stubArray : function(object) {
    var result = [];
    while (object) {
      arrayPush(result, getSymbols(object));
      object = getPrototype(object);
    }
    return result;
  };

  /**
   * Gets the `toStringTag` of `value`.
   *
   * @private
   * @param {*} value The value to query.
   * @returns {string} Returns the `toStringTag`.
   */
  var getTag = baseGetTag;

  // Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6.
  if ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) ||
      (Map && getTag(new Map) != mapTag) ||
      (Promise && getTag(Promise.resolve()) != promiseTag) ||
      (Set && getTag(new Set) != setTag) ||
      (WeakMap && getTag(new WeakMap) != weakMapTag)) {
    getTag = function(value) {
      var result = baseGetTag(value),
          Ctor = result == objectTag ? value.constructor : undefined,
          ctorString = Ctor ? toSource(Ctor) : '';

      if (ctorString) {
        switch (ctorString) {
          case dataViewCtorString: return dataViewTag;
          case mapCtorString: return mapTag;
          case promiseCtorString: return promiseTag;
          case setCtorString: return setTag;
          case weakMapCtorString: return weakMapTag;
        }
      }
      return result;
    };
  }

  /**
   * Gets the view, applying any `transforms` to the `start` and `end` positions.
   *
   * @private
   * @param {number} start The start of the view.
   * @param {number} end The end of the view.
   * @param {Array} transforms The transformations to apply to the view.
   * @returns {Object} Returns an object containing the `start` and `end`
   *  positions of the view.
   */
  function getView(start, end, transforms) {
    var index = -1,
        length = transforms.length;

    while (++index < length) {
      var data = transforms[index],
          size = data.size;

      switch (data.type) {
        case 'drop':      start += size; break;
        case 'dropRight': end -= size; break;
        case 'take':      end = nativeMin(end, start + size); break;
        case 'takeRight': start = nativeMax(start, end - size); break;
      }
    }
    return { 'start': start, 'end': end };
  }

  /**
   * Extracts wrapper details from the `source` body comment.
   *
   * @private
   * @param {string} source The source to inspect.
   * @returns {Array} Returns the wrapper details.
   */
  function getWrapDetails(source) {
    var match = source.match(reWrapDetails);
    return match ? match[1].split(reSplitDetails) : [];
  }

  /**
   * Checks if `path` exists on `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @param {Function} hasFunc The function to check properties.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   */
  function hasPath(object, path, hasFunc) {
    path = castPath(path, object);

    var index = -1,
        length = path.length,
        result = false;

    while (++index < length) {
      var key = toKey(path[index]);
      if (!(result = object != null && hasFunc(object, key))) {
        break;
      }
      object = object[key];
    }
    if (result || ++index != length) {
      return result;
    }
    length = object == null ? 0 : object.length;
    return !!length && isLength(length) && isIndex(key, length) &&
      (isArray(object) || isArguments(object));
  }

  /**
   * Initializes an array clone.
   *
   * @private
   * @param {Array} array The array to clone.
   * @returns {Array} Returns the initialized clone.
   */
  function initCloneArray(array) {
    var length = array.length,
        result = new array.constructor(length);

    // Add properties assigned by `RegExp#exec`.
    if (length && typeof array[0] == 'string' && hasOwnProperty.call(array, 'index')) {
      result.index = array.index;
      result.input = array.input;
    }
    return result;
  }

  /**
   * Initializes an object clone.
   *
   * @private
   * @param {Object} object The object to clone.
   * @returns {Object} Returns the initialized clone.
   */
  function initCloneObject(object) {
    return (typeof object.constructor == 'function' && !isPrototype(object))
      ? baseCreate(getPrototype(object))
      : {};
  }

  /**
   * Initializes an object clone based on its `toStringTag`.
   *
   * **Note:** This function only supports cloning values with tags of
   * `Boolean`, `Date`, `Error`, `Map`, `Number`, `RegExp`, `Set`, or `String`.
   *
   * @private
   * @param {Object} object The object to clone.
   * @param {string} tag The `toStringTag` of the object to clone.
   * @param {boolean} [isDeep] Specify a deep clone.
   * @returns {Object} Returns the initialized clone.
   */
  function initCloneByTag(object, tag, isDeep) {
    var Ctor = object.constructor;
    switch (tag) {
      case arrayBufferTag:
        return cloneArrayBuffer(object);

      case boolTag:
      case dateTag:
        return new Ctor(+object);

      case dataViewTag:
        return cloneDataView(object, isDeep);

      case float32Tag: case float64Tag:
      case int8Tag: case int16Tag: case int32Tag:
      case uint8Tag: case uint8ClampedTag: case uint16Tag: case uint32Tag:
        return cloneTypedArray(object, isDeep);

      case mapTag:
        return new Ctor;

      case numberTag:
      case stringTag:
        return new Ctor(object);

      case regexpTag:
        return cloneRegExp(object);

      case setTag:
        return new Ctor;

      case symbolTag:
        return cloneSymbol(object);
    }
  }

  /**
   * Inserts wrapper `details` in a comment at the top of the `source` body.
   *
   * @private
   * @param {string} source The source to modify.
   * @returns {Array} details The details to insert.
   * @returns {string} Returns the modified source.
   */
  function insertWrapDetails(source, details) {
    var length = details.length;
    if (!length) {
      return source;
    }
    var lastIndex = length - 1;
    details[lastIndex] = (length > 1 ? '& ' : '') + details[lastIndex];
    details = details.join(length > 2 ? ', ' : ' ');
    return source.replace(reWrapComment, '{\n/* [wrapped with ' + details + '] */\n');
  }

  /**
   * Checks if `value` is a flattenable `arguments` object or array.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is flattenable, else `false`.
   */
  function isFlattenable(value) {
    return isArray(value) || isArguments(value) ||
      !!(spreadableSymbol && value && value[spreadableSymbol]);
  }

  /**
   * Checks if `value` is a valid array-like index.
   *
   * @private
   * @param {*} value The value to check.
   * @param {number} [length=MAX_SAFE_INTEGER] The upper bounds of a valid index.
   * @returns {boolean} Returns `true` if `value` is a valid index, else `false`.
   */
  function isIndex(value, length) {
    var type = typeof value;
    length = length == null ? MAX_SAFE_INTEGER : length;

    return !!length &&
      (type == 'number' ||
        (type != 'symbol' && reIsUint.test(value))) &&
          (value > -1 && value % 1 == 0 && value < length);
  }

  /**
   * Checks if the given arguments are from an iteratee call.
   *
   * @private
   * @param {*} value The potential iteratee value argument.
   * @param {*} index The potential iteratee index or key argument.
   * @param {*} object The potential iteratee object argument.
   * @returns {boolean} Returns `true` if the arguments are from an iteratee call,
   *  else `false`.
   */
  function isIterateeCall(value, index, object) {
    if (!isObject(object)) {
      return false;
    }
    var type = typeof index;
    if (type == 'number'
          ? (isArrayLike(object) && isIndex(index, object.length))
          : (type == 'string' && index in object)
        ) {
      return eq(object[index], value);
    }
    return false;
  }

  /**
   * Checks if `value` is a property name and not a property path.
   *
   * @private
   * @param {*} value The value to check.
   * @param {Object} [object] The object to query keys on.
   * @returns {boolean} Returns `true` if `value` is a property name, else `false`.
   */
  function isKey(value, object) {
    if (isArray(value)) {
      return false;
    }
    var type = typeof value;
    if (type == 'number' || type == 'symbol' || type == 'boolean' ||
        value == null || isSymbol(value)) {
      return true;
    }
    return reIsPlainProp.test(value) || !reIsDeepProp.test(value) ||
      (object != null && value in Object(object));
  }

  /**
   * Checks if `value` is suitable for use as unique object key.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is suitable, else `false`.
   */
  function isKeyable(value) {
    var type = typeof value;
    return (type == 'string' || type == 'number' || type == 'symbol' || type == 'boolean')
      ? (value !== '__proto__')
      : (value === null);
  }

  /**
   * Checks if `func` has a lazy counterpart.
   *
   * @private
   * @param {Function} func The function to check.
   * @returns {boolean} Returns `true` if `func` has a lazy counterpart,
   *  else `false`.
   */
  function isLaziable(func) {
    var funcName = getFuncName(func),
        other = lodash[funcName];

    if (typeof other != 'function' || !(funcName in LazyWrapper.prototype)) {
      return false;
    }
    if (func === other) {
      return true;
    }
    var data = getData(other);
    return !!data && func === data[0];
  }

  /**
   * Checks if `func` has its source masked.
   *
   * @private
   * @param {Function} func The function to check.
   * @returns {boolean} Returns `true` if `func` is masked, else `false`.
   */
  function isMasked(func) {
    return !!maskSrcKey && (maskSrcKey in func);
  }

  /**
   * Checks if `value` is likely a prototype object.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a prototype, else `false`.
   */
  function isPrototype(value) {
    var Ctor = value && value.constructor,
        proto = (typeof Ctor == 'function' && Ctor.prototype) || objectProto;

    return value === proto;
  }

  /**
   * Checks if `value` is suitable for strict equality comparisons, i.e. `===`.
   *
   * @private
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` if suitable for strict
   *  equality comparisons, else `false`.
   */
  function isStrictComparable(value) {
    return value === value && !isObject(value);
  }

  /**
   * A specialized version of `matchesProperty` for source values suitable
   * for strict equality comparisons, i.e. `===`.
   *
   * @private
   * @param {string} key The key of the property to get.
   * @param {*} srcValue The value to match.
   * @returns {Function} Returns the new spec function.
   */
  function matchesStrictComparable(key, srcValue) {
    return function(object) {
      if (object == null) {
        return false;
      }
      return object[key] === srcValue &&
        (srcValue !== undefined || (key in Object(object)));
    };
  }

  /**
   * A specialized version of `_.memoize` which clears the memoized function's
   * cache when it exceeds `MAX_MEMOIZE_SIZE`.
   *
   * @private
   * @param {Function} func The function to have its output memoized.
   * @returns {Function} Returns the new memoized function.
   */
  function memoizeCapped(func) {
    var result = memoize(func, function(key) {
      if (cache.size === MAX_MEMOIZE_SIZE) {
        cache.clear();
      }
      return key;
    });

    var cache = result.cache;
    return result;
  }

  /**
   * Merges the function metadata of `source` into `data`.
   *
   * Merging metadata reduces the number of wrappers used to invoke a function.
   * This is possible because methods like `_.bind`, `_.curry`, and `_.partial`
   * may be applied regardless of execution order. Methods like `_.ary` and
   * `_.rearg` modify function arguments, making the order in which they are
   * executed important, preventing the merging of metadata. However, we make
   * an exception for a safe combined case where curried functions have `_.ary`
   * and or `_.rearg` applied.
   *
   * @private
   * @param {Array} data The destination metadata.
   * @param {Array} source The source metadata.
   * @returns {Array} Returns `data`.
   */
  function mergeData(data, source) {
    var bitmask = data[1],
        srcBitmask = source[1],
        newBitmask = bitmask | srcBitmask,
        isCommon = newBitmask < (WRAP_BIND_FLAG | WRAP_BIND_KEY_FLAG | WRAP_ARY_FLAG);

    var isCombo =
      ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_CURRY_FLAG)) ||
      ((srcBitmask == WRAP_ARY_FLAG) && (bitmask == WRAP_REARG_FLAG) && (data[7].length <= source[8])) ||
      ((srcBitmask == (WRAP_ARY_FLAG | WRAP_REARG_FLAG)) && (source[7].length <= source[8]) && (bitmask == WRAP_CURRY_FLAG));

    // Exit early if metadata can't be merged.
    if (!(isCommon || isCombo)) {
      return data;
    }
    // Use source `thisArg` if available.
    if (srcBitmask & WRAP_BIND_FLAG) {
      data[2] = source[2];
      // Set when currying a bound function.
      newBitmask |= bitmask & WRAP_BIND_FLAG ? 0 : WRAP_CURRY_BOUND_FLAG;
    }
    // Compose partial arguments.
    var value = source[3];
    if (value) {
      var partials = data[3];
      data[3] = partials ? composeArgs(partials, value, source[4]) : value;
      data[4] = partials ? replaceHolders(data[3], PLACEHOLDER) : source[4];
    }
    // Compose partial right arguments.
    value = source[5];
    if (value) {
      partials = data[5];
      data[5] = partials ? composeArgsRight(partials, value, source[6]) : value;
      data[6] = partials ? replaceHolders(data[5], PLACEHOLDER) : source[6];
    }
    // Use source `argPos` if available.
    value = source[7];
    if (value) {
      data[7] = value;
    }
    // Use source `ary` if it's smaller.
    if (srcBitmask & WRAP_ARY_FLAG) {
      data[8] = data[8] == null ? source[8] : nativeMin(data[8], source[8]);
    }
    // Use source `arity` if one is not provided.
    if (data[9] == null) {
      data[9] = source[9];
    }
    // Use source `func` and merge bitmasks.
    data[0] = source[0];
    data[1] = newBitmask;

    return data;
  }

  /**
   * This function is like
   * [`Object.keys`](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)
   * except that it includes inherited enumerable properties.
   *
   * @private
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   */
  function nativeKeysIn(object) {
    var result = [];
    if (object != null) {
      for (var key in Object(object)) {
        result.push(key);
      }
    }
    return result;
  }

  /**
   * Converts `value` to a string using `Object.prototype.toString`.
   *
   * @private
   * @param {*} value The value to convert.
   * @returns {string} Returns the converted string.
   */
  function objectToString(value) {
    return nativeObjectToString.call(value);
  }

  /**
   * A specialized version of `baseRest` which transforms the rest array.
   *
   * @private
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @param {Function} transform The rest array transform.
   * @returns {Function} Returns the new function.
   */
  function overRest(func, start, transform) {
    start = nativeMax(start === undefined ? (func.length - 1) : start, 0);
    return function() {
      var args = arguments,
          index = -1,
          length = nativeMax(args.length - start, 0),
          array = Array(length);

      while (++index < length) {
        array[index] = args[start + index];
      }
      index = -1;
      var otherArgs = Array(start + 1);
      while (++index < start) {
        otherArgs[index] = args[index];
      }
      otherArgs[start] = transform(array);
      return apply(func, this, otherArgs);
    };
  }

  /**
   * Gets the parent value at `path` of `object`.
   *
   * @private
   * @param {Object} object The object to query.
   * @param {Array} path The path to get the parent value of.
   * @returns {*} Returns the parent value.
   */
  function parent(object, path) {
    return path.length < 2 ? object : baseGet(object, baseSlice(path, 0, -1));
  }

  /**
   * Reorder `array` according to the specified indexes where the element at
   * the first index is assigned as the first element, the element at
   * the second index is assigned as the second element, and so on.
   *
   * @private
   * @param {Array} array The array to reorder.
   * @param {Array} indexes The arranged array indexes.
   * @returns {Array} Returns `array`.
   */
  function reorder(array, indexes) {
    var arrLength = array.length,
        length = nativeMin(indexes.length, arrLength),
        oldArray = copyArray(array);

    while (length--) {
      var index = indexes[length];
      array[length] = isIndex(index, arrLength) ? oldArray[index] : undefined;
    }
    return array;
  }

  /**
   * Sets metadata for `func`.
   *
   * **Note:** If this function becomes hot, i.e. is invoked a lot in a short
   * period of time, it will trip its breaker and transition to an identity
   * function to avoid garbage collection pauses in V8. See
   * [V8 issue 2070](https://bugs.chromium.org/p/v8/issues/detail?id=2070)
   * for more details.
   *
   * @private
   * @param {Function} func The function to associate metadata with.
   * @param {*} data The metadata.
   * @returns {Function} Returns `func`.
   */
  var setData = shortOut(baseSetData);

  /**
   * Sets the `toString` method of `func` to return `string`.
   *
   * @private
   * @param {Function} func The function to modify.
   * @param {Function} string The `toString` result.
   * @returns {Function} Returns `func`.
   */
  var setToString = shortOut(baseSetToString);

  /**
   * Sets the `toString` method of `wrapper` to mimic the source of `reference`
   * with wrapper details in a comment at the top of the source body.
   *
   * @private
   * @param {Function} wrapper The function to modify.
   * @param {Function} reference The reference function.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @returns {Function} Returns `wrapper`.
   */
  function setWrapToString(wrapper, reference, bitmask) {
    var source = (reference + '');
    return setToString(wrapper, insertWrapDetails(source, updateWrapDetails(getWrapDetails(source), bitmask)));
  }

  /**
   * Creates a function that'll short out and invoke `identity` instead
   * of `func` when it's called `HOT_COUNT` or more times in `HOT_SPAN`
   * milliseconds.
   *
   * @private
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new shortable function.
   */
  function shortOut(func) {
    var count = 0,
        lastCalled = 0;

    return function() {
      var stamp = nativeNow(),
          remaining = HOT_SPAN - (stamp - lastCalled);

      lastCalled = stamp;
      if (remaining > 0) {
        if (++count >= HOT_COUNT) {
          return arguments[0];
        }
      } else {
        count = 0;
      }
      return func.apply(undefined, arguments);
    };
  }

  /**
   * Converts `string` to a property path array.
   *
   * @private
   * @param {string} string The string to convert.
   * @returns {Array} Returns the property path array.
   */
  var stringToPath = memoizeCapped(function(string) {
    var result = [];
    if (string.charCodeAt(0) === 46 /* . */) {
      result.push('');
    }
    string.replace(rePropName, function(match, number, quote, subString) {
      result.push(quote ? subString.replace(reEscapeChar, '$1') : (number || match));
    });
    return result;
  });

  /**
   * Converts `value` to a string key if it's not a string or symbol.
   *
   * @private
   * @param {*} value The value to inspect.
   * @returns {string|symbol} Returns the key.
   */
  function toKey(value) {
    if (typeof value == 'string' || isSymbol(value)) {
      return value;
    }
    var result = (value + '');
    return (result == '0' && (1 / value) == -INFINITY) ? '-0' : result;
  }

  /**
   * Converts `func` to its source code.
   *
   * @private
   * @param {Function} func The function to convert.
   * @returns {string} Returns the source code.
   */
  function toSource(func) {
    if (func != null) {
      try {
        return funcToString.call(func);
      } catch (e) {}
      try {
        return (func + '');
      } catch (e) {}
    }
    return '';
  }

  /**
   * Updates wrapper `details` based on `bitmask` flags.
   *
   * @private
   * @returns {Array} details The details to modify.
   * @param {number} bitmask The bitmask flags. See `createWrap` for more details.
   * @returns {Array} Returns `details`.
   */
  function updateWrapDetails(details, bitmask) {
    arrayEach(wrapFlags, function(pair) {
      var value = '_.' + pair[0];
      if ((bitmask & pair[1]) && !arrayIncludes(details, value)) {
        details.push(value);
      }
    });
    return details.sort();
  }

  /**
   * Creates a clone of `wrapper`.
   *
   * @private
   * @param {Object} wrapper The wrapper to clone.
   * @returns {Object} Returns the cloned wrapper.
   */
  function wrapperClone(wrapper) {
    if (wrapper instanceof LazyWrapper) {
      return wrapper.clone();
    }
    var result = new LodashWrapper(wrapper.__wrapped__, wrapper.__chain__);
    result.__actions__ = copyArray(wrapper.__actions__);
    result.__index__  = wrapper.__index__;
    result.__values__ = wrapper.__values__;
    return result;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates an array with all falsey values removed. The values `false`, `null`,
   * `0`, `""`, `undefined`, and `NaN` are falsey.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to compact.
   * @returns {Array} Returns the new array of filtered values.
   * @example
   *
   * _.compact([0, 1, false, 2, '', 3]);
   * // => [1, 2, 3]
   */
  function compact(array) {
    var index = -1,
        length = array == null ? 0 : array.length,
        resIndex = 0,
        result = [];

    while (++index < length) {
      var value = array[index];
      if (value) {
        result[resIndex++] = value;
      }
    }
    return result;
  }

  /**
   * Creates a new array concatenating `array` with any additional arrays
   * and/or values.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to concatenate.
   * @param {...*} [values] The values to concatenate.
   * @returns {Array} Returns the new concatenated array.
   * @example
   *
   * var array = [1];
   * var other = _.concat(array, 2, [3], [[4]]);
   *
   * console.log(other);
   * // => [1, 2, 3, [4]]
   *
   * console.log(array);
   * // => [1]
   */
  function concat() {
    var length = arguments.length;
    if (!length) {
      return [];
    }
    var args = Array(length - 1),
        array = arguments[0],
        index = length;

    while (index--) {
      args[index - 1] = arguments[index];
    }
    return arrayPush(isArray(array) ? copyArray(array) : [array], baseFlatten(args, 1));
  }

  /**
   * Creates an array of `array` values not included in the other given arrays
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. The order and references of result values are
   * determined by the first array.
   *
   * **Note:** Unlike `_.pullAll`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {...Array} [values] The values to exclude.
   * @returns {Array} Returns the new array of filtered values.
   * @see _.without, _.xor
   * @example
   *
   * _.difference([2, 1], [2, 3]);
   * // => [1]
   */
  var difference = baseRest(function(array, values) {
    return isArrayLikeObject(array)
      ? baseDifference(array, baseFlatten(values, 1, isArrayLikeObject, true))
      : [];
  });

  /**
   * Creates a slice of `array` with `n` elements dropped from the beginning.
   *
   * @static
   * @memberOf _
   * @since 0.5.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to drop.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.drop([1, 2, 3]);
   * // => [2, 3]
   *
   * _.drop([1, 2, 3], 2);
   * // => [3]
   *
   * _.drop([1, 2, 3], 5);
   * // => []
   *
   * _.drop([1, 2, 3], 0);
   * // => [1, 2, 3]
   */
  function drop(array, n, guard) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    return baseSlice(array, n < 0 ? 0 : n, length);
  }

  /**
   * This method is like `_.find` except that it returns the index of the first
   * element `predicate` returns truthy for instead of the element itself.
   *
   * @static
   * @memberOf _
   * @since 1.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {number} Returns the index of the found element, else `-1`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'active': false },
   *   { 'user': 'fred',    'active': false },
   *   { 'user': 'pebbles', 'active': true }
   * ];
   *
   * _.findIndex(users, function(o) { return o.user == 'barney'; });
   * // => 0
   *
   * // The `_.matches` iteratee shorthand.
   * _.findIndex(users, { 'user': 'fred', 'active': false });
   * // => 1
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findIndex(users, ['active', false]);
   * // => 0
   *
   * // The `_.property` iteratee shorthand.
   * _.findIndex(users, 'active');
   * // => 2
   */
  function findIndex(array, predicate, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = fromIndex == null ? 0 : toInteger(fromIndex);
    if (index < 0) {
      index = nativeMax(length + index, 0);
    }
    return baseFindIndex(array, baseIteratee(predicate, 3), index);
  }

  /**
   * This method is like `_.findIndex` except that it iterates over elements
   * of `collection` from right to left.
   *
   * @static
   * @memberOf _
   * @since 2.0.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=array.length-1] The index to search from.
   * @returns {number} Returns the index of the found element, else `-1`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'active': true },
   *   { 'user': 'fred',    'active': false },
   *   { 'user': 'pebbles', 'active': false }
   * ];
   *
   * _.findLastIndex(users, function(o) { return o.user == 'pebbles'; });
   * // => 2
   *
   * // The `_.matches` iteratee shorthand.
   * _.findLastIndex(users, { 'user': 'barney', 'active': true });
   * // => 0
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findLastIndex(users, ['active', false]);
   * // => 2
   *
   * // The `_.property` iteratee shorthand.
   * _.findLastIndex(users, 'active');
   * // => 0
   */
  function findLastIndex(array, predicate, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = length - 1;
    if (fromIndex !== undefined) {
      index = toInteger(fromIndex);
      index = fromIndex < 0
        ? nativeMax(length + index, 0)
        : nativeMin(index, length - 1);
    }
    return baseFindIndex(array, baseIteratee(predicate, 3), index, true);
  }

  /**
   * Flattens `array` a single level deep.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to flatten.
   * @returns {Array} Returns the new flattened array.
   * @example
   *
   * _.flatten([1, [2, [3, [4]], 5]]);
   * // => [1, 2, [3, [4]], 5]
   */
  function flatten(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseFlatten(array, 1) : [];
  }

  /**
   * Recursively flattens `array`.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to flatten.
   * @returns {Array} Returns the new flattened array.
   * @example
   *
   * _.flattenDeep([1, [2, [3, [4]], 5]]);
   * // => [1, 2, 3, 4, 5]
   */
  function flattenDeep(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseFlatten(array, INFINITY) : [];
  }

  /**
   * Gets the first element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @alias first
   * @category Array
   * @param {Array} array The array to query.
   * @returns {*} Returns the first element of `array`.
   * @example
   *
   * _.head([1, 2, 3]);
   * // => 1
   *
   * _.head([]);
   * // => undefined
   */
  function head(array) {
    return (array && array.length) ? array[0] : undefined;
  }

  /**
   * Gets the index at which the first occurrence of `value` is found in `array`
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. If `fromIndex` is negative, it's used as the
   * offset from the end of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {*} value The value to search for.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {number} Returns the index of the matched value, else `-1`.
   * @example
   *
   * _.indexOf([1, 2, 1, 2], 2);
   * // => 1
   *
   * // Search from the `fromIndex`.
   * _.indexOf([1, 2, 1, 2], 2, 2);
   * // => 3
   */
  function indexOf(array, value, fromIndex) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return -1;
    }
    var index = fromIndex == null ? 0 : toInteger(fromIndex);
    if (index < 0) {
      index = nativeMax(length + index, 0);
    }
    return baseIndexOf(array, value, index);
  }

  /**
   * Gets all but the last element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.initial([1, 2, 3]);
   * // => [1, 2]
   */
  function initial(array) {
    var length = array == null ? 0 : array.length;
    return length ? baseSlice(array, 0, -1) : [];
  }

  /**
   * Creates an array of unique values that are included in all given arrays
   * using [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons. The order and references of result values are
   * determined by the first array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to inspect.
   * @returns {Array} Returns the new array of intersecting values.
   * @example
   *
   * _.intersection([2, 1], [2, 3]);
   * // => [2]
   */
  var intersection = baseRest(function(arrays) {
    var mapped = arrayMap(arrays, castArrayLikeObject);
    return (mapped.length && mapped[0] === arrays[0])
      ? baseIntersection(mapped)
      : [];
  });

  /**
   * Gets the last element of `array`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @returns {*} Returns the last element of `array`.
   * @example
   *
   * _.last([1, 2, 3]);
   * // => 3
   */
  function last(array) {
    var length = array == null ? 0 : array.length;
    return length ? array[length - 1] : undefined;
  }

  /**
   * Reverses `array` so that the first element becomes the last, the second
   * element becomes the second to last, and so on.
   *
   * **Note:** This method mutates `array` and is based on
   * [`Array#reverse`](https://mdn.io/Array/reverse).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to modify.
   * @returns {Array} Returns `array`.
   * @example
   *
   * var array = [1, 2, 3];
   *
   * _.reverse(array);
   * // => [3, 2, 1]
   *
   * console.log(array);
   * // => [3, 2, 1]
   */
  function reverse(array) {
    return array == null ? array : nativeReverse.call(array);
  }

  /**
   * Creates a slice of `array` from `start` up to, but not including, `end`.
   *
   * **Note:** This method is used instead of
   * [`Array#slice`](https://mdn.io/Array/slice) to ensure dense arrays are
   * returned.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to slice.
   * @param {number} [start=0] The start position.
   * @param {number} [end=array.length] The end position.
   * @returns {Array} Returns the slice of `array`.
   */
  function slice(array, start, end) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    if (end && typeof end != 'number' && isIterateeCall(array, start, end)) {
      start = 0;
      end = length;
    }
    else {
      start = start == null ? 0 : toInteger(start);
      end = end === undefined ? length : toInteger(end);
    }
    return baseSlice(array, start, end);
  }

  /**
   * Creates a slice of `array` with `n` elements taken from the beginning.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to take.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.take([1, 2, 3]);
   * // => [1]
   *
   * _.take([1, 2, 3], 2);
   * // => [1, 2]
   *
   * _.take([1, 2, 3], 5);
   * // => [1, 2, 3]
   *
   * _.take([1, 2, 3], 0);
   * // => []
   */
  function take(array, n, guard) {
    if (!(array && array.length)) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    return baseSlice(array, 0, n < 0 ? 0 : n);
  }

  /**
   * Creates a slice of `array` with `n` elements taken from the end.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Array
   * @param {Array} array The array to query.
   * @param {number} [n=1] The number of elements to take.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {Array} Returns the slice of `array`.
   * @example
   *
   * _.takeRight([1, 2, 3]);
   * // => [3]
   *
   * _.takeRight([1, 2, 3], 2);
   * // => [2, 3]
   *
   * _.takeRight([1, 2, 3], 5);
   * // => [1, 2, 3]
   *
   * _.takeRight([1, 2, 3], 0);
   * // => []
   */
  function takeRight(array, n, guard) {
    var length = array == null ? 0 : array.length;
    if (!length) {
      return [];
    }
    n = (guard || n === undefined) ? 1 : toInteger(n);
    n = length - n;
    return baseSlice(array, n < 0 ? 0 : n, length);
  }

  /**
   * Creates an array of unique values, in order, from all given arrays using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to inspect.
   * @returns {Array} Returns the new array of combined values.
   * @example
   *
   * _.union([2], [1, 2]);
   * // => [2, 1]
   */
  var union = baseRest(function(arrays) {
    return baseUniq(baseFlatten(arrays, 1, isArrayLikeObject, true));
  });

  /**
   * Creates a duplicate-free version of an array, using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons, in which only the first occurrence of each element
   * is kept. The order of result values is determined by the order they occur
   * in the array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @returns {Array} Returns the new duplicate free array.
   * @example
   *
   * _.uniq([2, 1, 2]);
   * // => [2, 1]
   */
  function uniq(array) {
    return (array && array.length) ? baseUniq(array) : [];
  }

  /**
   * This method is like `_.uniq` except that it accepts `iteratee` which is
   * invoked for each element in `array` to generate the criterion by which
   * uniqueness is computed. The order of result values is determined by the
   * order they occur in the array. The iteratee is invoked with one argument:
   * (value).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.
   * @returns {Array} Returns the new duplicate free array.
   * @example
   *
   * _.uniqBy([2.1, 1.2, 2.3], Math.floor);
   * // => [2.1, 1.2]
   *
   * // The `_.property` iteratee shorthand.
   * _.uniqBy([{ 'x': 1 }, { 'x': 2 }, { 'x': 1 }], 'x');
   * // => [{ 'x': 1 }, { 'x': 2 }]
   */
  function uniqBy(array, iteratee) {
    return (array && array.length) ? baseUniq(array, baseIteratee(iteratee, 2)) : [];
  }

  /**
   * This method is like `_.zip` except that it accepts an array of grouped
   * elements and creates an array regrouping the elements to their pre-zip
   * configuration.
   *
   * @static
   * @memberOf _
   * @since 1.2.0
   * @category Array
   * @param {Array} array The array of grouped elements to process.
   * @returns {Array} Returns the new array of regrouped elements.
   * @example
   *
   * var zipped = _.zip(['a', 'b'], [1, 2], [true, false]);
   * // => [['a', 1, true], ['b', 2, false]]
   *
   * _.unzip(zipped);
   * // => [['a', 'b'], [1, 2], [true, false]]
   */
  function unzip(array) {
    if (!(array && array.length)) {
      return [];
    }
    var length = 0;
    array = arrayFilter(array, function(group) {
      if (isArrayLikeObject(group)) {
        length = nativeMax(group.length, length);
        return true;
      }
    });
    return baseTimes(length, function(index) {
      return arrayMap(array, baseProperty(index));
    });
  }

  /**
   * Creates an array excluding all given values using
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * for equality comparisons.
   *
   * **Note:** Unlike `_.pull`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {Array} array The array to inspect.
   * @param {...*} [values] The values to exclude.
   * @returns {Array} Returns the new array of filtered values.
   * @see _.difference, _.xor
   * @example
   *
   * _.without([2, 1, 2, 3], 1, 2);
   * // => [3]
   */
  var without = baseRest(function(array, values) {
    return isArrayLikeObject(array)
      ? baseDifference(array, values)
      : [];
  });

  /**
   * Creates an array of grouped elements, the first of which contains the
   * first elements of the given arrays, the second of which contains the
   * second elements of the given arrays, and so on.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Array
   * @param {...Array} [arrays] The arrays to process.
   * @returns {Array} Returns the new array of grouped elements.
   * @example
   *
   * _.zip(['a', 'b'], [1, 2], [true, false]);
   * // => [['a', 1, true], ['b', 2, false]]
   */
  var zip = baseRest(unzip);

  /**
   * This method is like `_.fromPairs` except that it accepts two arrays,
   * one of property identifiers and one of corresponding values.
   *
   * @static
   * @memberOf _
   * @since 0.4.0
   * @category Array
   * @param {Array} [props=[]] The property identifiers.
   * @param {Array} [values=[]] The property values.
   * @returns {Object} Returns the new object.
   * @example
   *
   * _.zipObject(['a', 'b'], [1, 2]);
   * // => { 'a': 1, 'b': 2 }
   */
  function zipObject(props, values) {
    return baseZipObject(props || [], values || [], assignValue);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a `lodash` wrapper instance that wraps `value` with explicit method
   * chain sequences enabled. The result of such sequences must be unwrapped
   * with `_#value`.
   *
   * @static
   * @memberOf _
   * @since 1.3.0
   * @category Seq
   * @param {*} value The value to wrap.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'age': 36 },
   *   { 'user': 'fred',    'age': 40 },
   *   { 'user': 'pebbles', 'age': 1 }
   * ];
   *
   * var youngest = _
   *   .chain(users)
   *   .sortBy('age')
   *   .map(function(o) {
   *     return o.user + ' is ' + o.age;
   *   })
   *   .head()
   *   .value();
   * // => 'pebbles is 1'
   */
  function chain(value) {
    var result = lodash(value);
    result.__chain__ = true;
    return result;
  }

  /**
   * This method invokes `interceptor` and returns `value`. The interceptor
   * is invoked with one argument; (value). The purpose of this method is to
   * "tap into" a method chain sequence in order to modify intermediate results.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @param {*} value The value to provide to `interceptor`.
   * @param {Function} interceptor The function to invoke.
   * @returns {*} Returns `value`.
   * @example
   *
   * _([1, 2, 3])
   *  .tap(function(array) {
   *    // Mutate input array.
   *    array.pop();
   *  })
   *  .reverse()
   *  .value();
   * // => [2, 1]
   */
  function tap(value, interceptor) {
    interceptor(value);
    return value;
  }

  /**
   * This method is like `_.tap` except that it returns the result of `interceptor`.
   * The purpose of this method is to "pass thru" values replacing intermediate
   * results in a method chain sequence.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Seq
   * @param {*} value The value to provide to `interceptor`.
   * @param {Function} interceptor The function to invoke.
   * @returns {*} Returns the result of `interceptor`.
   * @example
   *
   * _('  abc  ')
   *  .chain()
   *  .trim()
   *  .thru(function(value) {
   *    return [value];
   *  })
   *  .value();
   * // => ['abc']
   */
  function thru(value, interceptor) {
    return interceptor(value);
  }

  /**
   * This method is the wrapper version of `_.at`.
   *
   * @name at
   * @memberOf _
   * @since 1.0.0
   * @category Seq
   * @param {...(string|string[])} [paths] The property paths to pick.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c': 3 } }, 4] };
   *
   * _(object).at(['a[0].b.c', 'a[1]']).value();
   * // => [3, 4]
   */
  var wrapperAt = flatRest(function(paths) {
    var length = paths.length,
        start = length ? paths[0] : 0,
        value = this.__wrapped__,
        interceptor = function(object) { return baseAt(object, paths); };

    if (length > 1 || this.__actions__.length ||
        !(value instanceof LazyWrapper) || !isIndex(start)) {
      return this.thru(interceptor);
    }
    value = value.slice(start, +start + (length ? 1 : 0));
    value.__actions__.push({
      'func': thru,
      'args': [interceptor],
      'thisArg': undefined
    });
    return new LodashWrapper(value, this.__chain__).thru(function(array) {
      if (length && !array.length) {
        array.push(undefined);
      }
      return array;
    });
  });

  /**
   * Creates a `lodash` wrapper instance with explicit method chain sequences enabled.
   *
   * @name chain
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36 },
   *   { 'user': 'fred',   'age': 40 }
   * ];
   *
   * // A sequence without explicit chaining.
   * _(users).head();
   * // => { 'user': 'barney', 'age': 36 }
   *
   * // A sequence with explicit chaining.
   * _(users)
   *   .chain()
   *   .head()
   *   .pick('user')
   *   .value();
   * // => { 'user': 'barney' }
   */
  function wrapperChain() {
    return chain(this);
  }

  /**
   * Executes the chain sequence and returns the wrapped result.
   *
   * @name commit
   * @memberOf _
   * @since 3.2.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var array = [1, 2];
   * var wrapped = _(array).push(3);
   *
   * console.log(array);
   * // => [1, 2]
   *
   * wrapped = wrapped.commit();
   * console.log(array);
   * // => [1, 2, 3]
   *
   * wrapped.last();
   * // => 3
   *
   * console.log(array);
   * // => [1, 2, 3]
   */
  function wrapperCommit() {
    return new LodashWrapper(this.value(), this.__chain__);
  }

  /**
   * Gets the next value on a wrapped object following the
   * [iterator protocol](https://mdn.io/iteration_protocols#iterator).
   *
   * @name next
   * @memberOf _
   * @since 4.0.0
   * @category Seq
   * @returns {Object} Returns the next iterator value.
   * @example
   *
   * var wrapped = _([1, 2]);
   *
   * wrapped.next();
   * // => { 'done': false, 'value': 1 }
   *
   * wrapped.next();
   * // => { 'done': false, 'value': 2 }
   *
   * wrapped.next();
   * // => { 'done': true, 'value': undefined }
   */
  function wrapperNext() {
    if (this.__values__ === undefined) {
      this.__values__ = toArray(this.value());
    }
    var done = this.__index__ >= this.__values__.length,
        value = done ? undefined : this.__values__[this.__index__++];

    return { 'done': done, 'value': value };
  }

  /**
   * Enables the wrapper to be iterable.
   *
   * @name Symbol.iterator
   * @memberOf _
   * @since 4.0.0
   * @category Seq
   * @returns {Object} Returns the wrapper object.
   * @example
   *
   * var wrapped = _([1, 2]);
   *
   * wrapped[Symbol.iterator]() === wrapped;
   * // => true
   *
   * Array.from(wrapped);
   * // => [1, 2]
   */
  function wrapperToIterator() {
    return this;
  }

  /**
   * Creates a clone of the chain sequence planting `value` as the wrapped value.
   *
   * @name plant
   * @memberOf _
   * @since 3.2.0
   * @category Seq
   * @param {*} value The value to plant.
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * var wrapped = _([1, 2]).map(square);
   * var other = wrapped.plant([3, 4]);
   *
   * other.value();
   * // => [9, 16]
   *
   * wrapped.value();
   * // => [1, 4]
   */
  function wrapperPlant(value) {
    var result,
        parent = this;

    while (parent instanceof baseLodash) {
      var clone = wrapperClone(parent);
      clone.__index__ = 0;
      clone.__values__ = undefined;
      if (result) {
        previous.__wrapped__ = clone;
      } else {
        result = clone;
      }
      var previous = clone;
      parent = parent.__wrapped__;
    }
    previous.__wrapped__ = value;
    return result;
  }

  /**
   * This method is the wrapper version of `_.reverse`.
   *
   * **Note:** This method mutates the wrapped array.
   *
   * @name reverse
   * @memberOf _
   * @since 0.1.0
   * @category Seq
   * @returns {Object} Returns the new `lodash` wrapper instance.
   * @example
   *
   * var array = [1, 2, 3];
   *
   * _(array).reverse().value()
   * // => [3, 2, 1]
   *
   * console.log(array);
   * // => [3, 2, 1]
   */
  function wrapperReverse() {
    var value = this.__wrapped__;
    if (value instanceof LazyWrapper) {
      var wrapped = value;
      if (this.__actions__.length) {
        wrapped = new LazyWrapper(this);
      }
      wrapped = wrapped.reverse();
      wrapped.__actions__.push({
        'func': thru,
        'args': [reverse],
        'thisArg': undefined
      });
      return new LodashWrapper(wrapped, this.__chain__);
    }
    return this.thru(reverse);
  }

  /**
   * Executes the chain sequence to resolve the unwrapped value.
   *
   * @name value
   * @memberOf _
   * @since 0.1.0
   * @alias toJSON, valueOf
   * @category Seq
   * @returns {*} Returns the resolved unwrapped value.
   * @example
   *
   * _([1, 2, 3]).value();
   * // => [1, 2, 3]
   */
  function wrapperValue() {
    return baseWrapperValue(this.__wrapped__, this.__actions__);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates an object composed of keys generated from the results of running
   * each element of `collection` thru `iteratee`. The corresponding value of
   * each key is the number of times the key was returned by `iteratee`. The
   * iteratee is invoked with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 0.5.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The iteratee to transform keys.
   * @returns {Object} Returns the composed aggregate object.
   * @example
   *
   * _.countBy([6.1, 4.2, 6.3], Math.floor);
   * // => { '4': 1, '6': 2 }
   *
   * // The `_.property` iteratee shorthand.
   * _.countBy(['one', 'two', 'three'], 'length');
   * // => { '3': 2, '5': 1 }
   */
  var countBy = createAggregator(function(result, value, key) {
    if (hasOwnProperty.call(result, key)) {
      ++result[key];
    } else {
      baseAssignValue(result, key, 1);
    }
  });

  /**
   * Checks if `predicate` returns truthy for **all** elements of `collection`.
   * Iteration is stopped once `predicate` returns falsey. The predicate is
   * invoked with three arguments: (value, index|key, collection).
   *
   * **Note:** This method returns `true` for
   * [empty collections](https://en.wikipedia.org/wiki/Empty_set) because
   * [everything is true](https://en.wikipedia.org/wiki/Vacuous_truth) of
   * elements of empty collections.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {boolean} Returns `true` if all elements pass the predicate check,
   *  else `false`.
   * @example
   *
   * _.every([true, 1, null, 'yes'], Boolean);
   * // => false
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': false },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.every(users, { 'user': 'barney', 'active': false });
   * // => false
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.every(users, ['active', false]);
   * // => true
   *
   * // The `_.property` iteratee shorthand.
   * _.every(users, 'active');
   * // => false
   */
  function every(collection, predicate, guard) {
    var func = isArray(collection) ? arrayEvery : baseEvery;
    if (guard && isIterateeCall(collection, predicate, guard)) {
      predicate = undefined;
    }
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Iterates over elements of `collection`, returning an array of all elements
   * `predicate` returns truthy for. The predicate is invoked with three
   * arguments: (value, index|key, collection).
   *
   * **Note:** Unlike `_.remove`, this method returns a new array.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   * @see _.reject
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': true },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * _.filter(users, function(o) { return !o.active; });
   * // => objects for ['fred']
   *
   * // The `_.matches` iteratee shorthand.
   * _.filter(users, { 'age': 36, 'active': true });
   * // => objects for ['barney']
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.filter(users, ['active', false]);
   * // => objects for ['fred']
   *
   * // The `_.property` iteratee shorthand.
   * _.filter(users, 'active');
   * // => objects for ['barney']
   */
  function filter(collection, predicate) {
    var func = isArray(collection) ? arrayFilter : baseFilter;
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Iterates over elements of `collection`, returning the first element
   * `predicate` returns truthy for. The predicate is invoked with three
   * arguments: (value, index|key, collection).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param {number} [fromIndex=0] The index to search from.
   * @returns {*} Returns the matched element, else `undefined`.
   * @example
   *
   * var users = [
   *   { 'user': 'barney',  'age': 36, 'active': true },
   *   { 'user': 'fred',    'age': 40, 'active': false },
   *   { 'user': 'pebbles', 'age': 1,  'active': true }
   * ];
   *
   * _.find(users, function(o) { return o.age < 40; });
   * // => object for 'barney'
   *
   * // The `_.matches` iteratee shorthand.
   * _.find(users, { 'age': 1, 'active': true });
   * // => object for 'pebbles'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.find(users, ['active', false]);
   * // => object for 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.find(users, 'active');
   * // => object for 'barney'
   */
  var find = createFind(findIndex);

  /**
   * Iterates over elements of `collection` and invokes `iteratee` for each element.
   * The iteratee is invoked with three arguments: (value, index|key, collection).
   * Iteratee functions may exit iteration early by explicitly returning `false`.
   *
   * **Note:** As with other "Collections" methods, objects with a "length"
   * property are iterated like arrays. To avoid this behavior use `_.forIn`
   * or `_.forOwn` for object iteration.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @alias each
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @returns {Array|Object} Returns `collection`.
   * @see _.forEachRight
   * @example
   *
   * _.forEach([1, 2], function(value) {
   *   console.log(value);
   * });
   * // => Logs `1` then `2`.
   *
   * _.forEach({ 'a': 1, 'b': 2 }, function(value, key) {
   *   console.log(key);
   * });
   * // => Logs 'a' then 'b' (iteration order is not guaranteed).
   */
  function forEach(collection, iteratee) {
    var func = isArray(collection) ? arrayEach : baseEach;
    return func(collection, baseIteratee(iteratee, 3));
  }

  /**
   * Creates an array of values by running each element in `collection` thru
   * `iteratee`. The iteratee is invoked with three arguments:
   * (value, index|key, collection).
   *
   * Many lodash methods are guarded to work as iteratees for methods like
   * `_.every`, `_.filter`, `_.map`, `_.mapValues`, `_.reject`, and `_.some`.
   *
   * The guarded methods are:
   * `ary`, `chunk`, `curry`, `curryRight`, `drop`, `dropRight`, `every`,
   * `fill`, `invert`, `parseInt`, `random`, `range`, `rangeRight`, `repeat`,
   * `sampleSize`, `slice`, `some`, `sortBy`, `split`, `take`, `takeRight`,
   * `template`, `trim`, `trimEnd`, `trimStart`, and `words`
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new mapped array.
   * @example
   *
   * function square(n) {
   *   return n * n;
   * }
   *
   * _.map([4, 8], square);
   * // => [16, 64]
   *
   * _.map({ 'a': 4, 'b': 8 }, square);
   * // => [16, 64] (iteration order is not guaranteed)
   *
   * var users = [
   *   { 'user': 'barney' },
   *   { 'user': 'fred' }
   * ];
   *
   * // The `_.property` iteratee shorthand.
   * _.map(users, 'user');
   * // => ['barney', 'fred']
   */
  function map(collection, iteratee) {
    var func = isArray(collection) ? arrayMap : baseMap;
    return func(collection, baseIteratee(iteratee, 3));
  }

  /**
   * Reduces `collection` to a value which is the accumulated result of running
   * each element in `collection` thru `iteratee`, where each successive
   * invocation is supplied the return value of the previous. If `accumulator`
   * is not given, the first element of `collection` is used as the initial
   * value. The iteratee is invoked with four arguments:
   * (accumulator, value, index|key, collection).
   *
   * Many lodash methods are guarded to work as iteratees for methods like
   * `_.reduce`, `_.reduceRight`, and `_.transform`.
   *
   * The guarded methods are:
   * `assign`, `defaults`, `defaultsDeep`, `includes`, `merge`, `orderBy`,
   * and `sortBy`
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [iteratee=_.identity] The function invoked per iteration.
   * @param {*} [accumulator] The initial value.
   * @returns {*} Returns the accumulated value.
   * @see _.reduceRight
   * @example
   *
   * _.reduce([1, 2], function(sum, n) {
   *   return sum + n;
   * }, 0);
   * // => 3
   *
   * _.reduce({ 'a': 1, 'b': 2, 'c': 1 }, function(result, value, key) {
   *   (result[value] || (result[value] = [])).push(key);
   *   return result;
   * }, {});
   * // => { '1': ['a', 'c'], '2': ['b'] } (iteration order is not guaranteed)
   */
  function reduce(collection, iteratee, accumulator) {
    var func = isArray(collection) ? arrayReduce : baseReduce,
        initAccum = arguments.length < 3;

    return func(collection, baseIteratee(iteratee, 4), accumulator, initAccum, baseEach);
  }

  /**
   * The opposite of `_.filter`; this method returns the elements of `collection`
   * that `predicate` does **not** return truthy for.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {Array} Returns the new filtered array.
   * @see _.filter
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': false },
   *   { 'user': 'fred',   'age': 40, 'active': true }
   * ];
   *
   * _.reject(users, function(o) { return !o.active; });
   * // => objects for ['fred']
   *
   * // The `_.matches` iteratee shorthand.
   * _.reject(users, { 'age': 40, 'active': true });
   * // => objects for ['barney']
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.reject(users, ['active', false]);
   * // => objects for ['fred']
   *
   * // The `_.property` iteratee shorthand.
   * _.reject(users, 'active');
   * // => objects for ['barney']
   */
  function reject(collection, predicate) {
    var func = isArray(collection) ? arrayFilter : baseFilter;
    return func(collection, negate(baseIteratee(predicate, 3)));
  }

  /**
   * Gets the size of `collection` by returning its length for array-like
   * values or the number of own enumerable string keyed properties for objects.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object|string} collection The collection to inspect.
   * @returns {number} Returns the collection size.
   * @example
   *
   * _.size([1, 2, 3]);
   * // => 3
   *
   * _.size({ 'a': 1, 'b': 2 });
   * // => 2
   *
   * _.size('pebbles');
   * // => 7
   */
  function size(collection) {
    if (collection == null) {
      return 0;
    }
    if (isArrayLike(collection)) {
      return isString(collection) ? stringSize(collection) : collection.length;
    }
    var tag = getTag(collection);
    if (tag == mapTag || tag == setTag) {
      return collection.size;
    }
    return baseKeys(collection).length;
  }

  /**
   * Checks if `predicate` returns truthy for **any** element of `collection`.
   * Iteration is stopped once `predicate` returns truthy. The predicate is
   * invoked with three arguments: (value, index|key, collection).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @param- {Object} [guard] Enables use as an iteratee for methods like `_.map`.
   * @returns {boolean} Returns `true` if any element passes the predicate check,
   *  else `false`.
   * @example
   *
   * _.some([null, 0, 'yes', false], Boolean);
   * // => true
   *
   * var users = [
   *   { 'user': 'barney', 'active': true },
   *   { 'user': 'fred',   'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.some(users, { 'user': 'barney', 'active': false });
   * // => false
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.some(users, ['active', false]);
   * // => true
   *
   * // The `_.property` iteratee shorthand.
   * _.some(users, 'active');
   * // => true
   */
  function some(collection, predicate, guard) {
    var func = isArray(collection) ? arraySome : baseSome;
    if (guard && isIterateeCall(collection, predicate, guard)) {
      predicate = undefined;
    }
    return func(collection, baseIteratee(predicate, 3));
  }

  /**
   * Creates an array of elements, sorted in ascending order by the results of
   * running each element in a collection thru each iteratee. This method
   * performs a stable sort, that is, it preserves the original sort order of
   * equal elements. The iteratees are invoked with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Collection
   * @param {Array|Object} collection The collection to iterate over.
   * @param {...(Function|Function[])} [iteratees=[_.identity]]
   *  The iteratees to sort by.
   * @returns {Array} Returns the new sorted array.
   * @example
   *
   * var users = [
   *   { 'user': 'fred',   'age': 48 },
   *   { 'user': 'barney', 'age': 36 },
   *   { 'user': 'fred',   'age': 40 },
   *   { 'user': 'barney', 'age': 34 }
   * ];
   *
   * _.sortBy(users, [function(o) { return o.user; }]);
   * // => objects for [['barney', 36], ['barney', 34], ['fred', 48], ['fred', 40]]
   *
   * _.sortBy(users, ['user', 'age']);
   * // => objects for [['barney', 34], ['barney', 36], ['fred', 40], ['fred', 48]]
   */
  var sortBy = baseRest(function(collection, iteratees) {
    if (collection == null) {
      return [];
    }
    var length = iteratees.length;
    if (length > 1 && isIterateeCall(collection, iteratees[0], iteratees[1])) {
      iteratees = [];
    } else if (length > 2 && isIterateeCall(iteratees[0], iteratees[1], iteratees[2])) {
      iteratees = [iteratees[0]];
    }
    return baseOrderBy(collection, baseFlatten(iteratees, 1), []);
  });

  /*------------------------------------------------------------------------*/

  /**
   * Gets the timestamp of the number of milliseconds that have elapsed since
   * the Unix epoch (1 January 1970 00:00:00 UTC).
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Date
   * @returns {number} Returns the timestamp.
   * @example
   *
   * _.defer(function(stamp) {
   *   console.log(_.now() - stamp);
   * }, _.now());
   * // => Logs the number of milliseconds it took for the deferred invocation.
   */
  var now = function() {
    return root.Date.now();
  };

  /*------------------------------------------------------------------------*/

  /**
   * Creates a function that invokes `func`, with the `this` binding and arguments
   * of the created function, while it's called less than `n` times. Subsequent
   * calls to the created function return the result of the last `func` invocation.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Function
   * @param {number} n The number of calls at which `func` is no longer invoked.
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new restricted function.
   * @example
   *
   * jQuery(element).on('click', _.before(5, addContactToList));
   * // => Allows adding up to 4 contacts to the list.
   */
  function before(n, func) {
    var result;
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    n = toInteger(n);
    return function() {
      if (--n > 0) {
        result = func.apply(this, arguments);
      }
      if (n <= 1) {
        func = undefined;
      }
      return result;
    };
  }

  /**
   * Creates a function that invokes `func` with the `this` binding of `thisArg`
   * and `partials` prepended to the arguments it receives.
   *
   * The `_.bind.placeholder` value, which defaults to `_` in monolithic builds,
   * may be used as a placeholder for partially applied arguments.
   *
   * **Note:** Unlike native `Function#bind`, this method doesn't set the "length"
   * property of bound functions.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to bind.
   * @param {*} thisArg The `this` binding of `func`.
   * @param {...*} [partials] The arguments to be partially applied.
   * @returns {Function} Returns the new bound function.
   * @example
   *
   * function greet(greeting, punctuation) {
   *   return greeting + ' ' + this.user + punctuation;
   * }
   *
   * var object = { 'user': 'fred' };
   *
   * var bound = _.bind(greet, object, 'hi');
   * bound('!');
   * // => 'hi fred!'
   *
   * // Bound with placeholders.
   * var bound = _.bind(greet, object, _, '!');
   * bound('hi');
   * // => 'hi fred!'
   */
  var bind = baseRest(function(func, thisArg, partials) {
    var bitmask = WRAP_BIND_FLAG;
    if (partials.length) {
      var holders = replaceHolders(partials, getHolder(bind));
      bitmask |= WRAP_PARTIAL_FLAG;
    }
    return createWrap(func, bitmask, thisArg, partials, holders);
  });

  /**
   * Creates a debounced function that delays invoking `func` until after `wait`
   * milliseconds have elapsed since the last time the debounced function was
   * invoked. The debounced function comes with a `cancel` method to cancel
   * delayed `func` invocations and a `flush` method to immediately invoke them.
   * Provide `options` to indicate whether `func` should be invoked on the
   * leading and/or trailing edge of the `wait` timeout. The `func` is invoked
   * with the last arguments provided to the debounced function. Subsequent
   * calls to the debounced function return the result of the last `func`
   * invocation.
   *
   * **Note:** If `leading` and `trailing` options are `true`, `func` is
   * invoked on the trailing edge of the timeout only if the debounced function
   * is invoked more than once during the `wait` timeout.
   *
   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred
   * until to the next tick, similar to `setTimeout` with a timeout of `0`.
   *
   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)
   * for details over the differences between `_.debounce` and `_.throttle`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to debounce.
   * @param {number} [wait=0] The number of milliseconds to delay.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.leading=false]
   *  Specify invoking on the leading edge of the timeout.
   * @param {number} [options.maxWait]
   *  The maximum time `func` is allowed to be delayed before it's invoked.
   * @param {boolean} [options.trailing=true]
   *  Specify invoking on the trailing edge of the timeout.
   * @returns {Function} Returns the new debounced function.
   * @example
   *
   * // Avoid costly calculations while the window size is in flux.
   * jQuery(window).on('resize', _.debounce(calculateLayout, 150));
   *
   * // Invoke `sendMail` when clicked, debouncing subsequent calls.
   * jQuery(element).on('click', _.debounce(sendMail, 300, {
   *   'leading': true,
   *   'trailing': false
   * }));
   *
   * // Ensure `batchLog` is invoked once after 1 second of debounced calls.
   * var debounced = _.debounce(batchLog, 250, { 'maxWait': 1000 });
   * var source = new EventSource('/stream');
   * jQuery(source).on('message', debounced);
   *
   * // Cancel the trailing debounced invocation.
   * jQuery(window).on('popstate', debounced.cancel);
   */
  function debounce(func, wait, options) {
    var lastArgs,
        lastThis,
        maxWait,
        result,
        timerId,
        lastCallTime,
        lastInvokeTime = 0,
        leading = false,
        maxing = false,
        trailing = true;

    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    wait = toNumber(wait) || 0;
    if (isObject(options)) {
      leading = !!options.leading;
      maxing = 'maxWait' in options;
      maxWait = maxing ? nativeMax(toNumber(options.maxWait) || 0, wait) : maxWait;
      trailing = 'trailing' in options ? !!options.trailing : trailing;
    }

    function invokeFunc(time) {
      var args = lastArgs,
          thisArg = lastThis;

      lastArgs = lastThis = undefined;
      lastInvokeTime = time;
      result = func.apply(thisArg, args);
      return result;
    }

    function leadingEdge(time) {
      // Reset any `maxWait` timer.
      lastInvokeTime = time;
      // Start the timer for the trailing edge.
      timerId = setTimeout(timerExpired, wait);
      // Invoke the leading edge.
      return leading ? invokeFunc(time) : result;
    }

    function remainingWait(time) {
      var timeSinceLastCall = time - lastCallTime,
          timeSinceLastInvoke = time - lastInvokeTime,
          timeWaiting = wait - timeSinceLastCall;

      return maxing
        ? nativeMin(timeWaiting, maxWait - timeSinceLastInvoke)
        : timeWaiting;
    }

    function shouldInvoke(time) {
      var timeSinceLastCall = time - lastCallTime,
          timeSinceLastInvoke = time - lastInvokeTime;

      // Either this is the first call, activity has stopped and we're at the
      // trailing edge, the system time has gone backwards and we're treating
      // it as the trailing edge, or we've hit the `maxWait` limit.
      return (lastCallTime === undefined || (timeSinceLastCall >= wait) ||
        (timeSinceLastCall < 0) || (maxing && timeSinceLastInvoke >= maxWait));
    }

    function timerExpired() {
      var time = now();
      if (shouldInvoke(time)) {
        return trailingEdge(time);
      }
      // Restart the timer.
      timerId = setTimeout(timerExpired, remainingWait(time));
    }

    function trailingEdge(time) {
      timerId = undefined;

      // Only invoke if we have `lastArgs` which means `func` has been
      // debounced at least once.
      if (trailing && lastArgs) {
        return invokeFunc(time);
      }
      lastArgs = lastThis = undefined;
      return result;
    }

    function cancel() {
      if (timerId !== undefined) {
        clearTimeout(timerId);
      }
      lastInvokeTime = 0;
      lastArgs = lastCallTime = lastThis = timerId = undefined;
    }

    function flush() {
      return timerId === undefined ? result : trailingEdge(now());
    }

    function debounced() {
      var time = now(),
          isInvoking = shouldInvoke(time);

      lastArgs = arguments;
      lastThis = this;
      lastCallTime = time;

      if (isInvoking) {
        if (timerId === undefined) {
          return leadingEdge(lastCallTime);
        }
        if (maxing) {
          // Handle invocations in a tight loop.
          timerId = setTimeout(timerExpired, wait);
          return invokeFunc(lastCallTime);
        }
      }
      if (timerId === undefined) {
        timerId = setTimeout(timerExpired, wait);
      }
      return result;
    }
    debounced.cancel = cancel;
    debounced.flush = flush;
    return debounced;
  }

  /**
   * Defers invoking the `func` until the current call stack has cleared. Any
   * additional arguments are provided to `func` when it's invoked.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to defer.
   * @param {...*} [args] The arguments to invoke `func` with.
   * @returns {number} Returns the timer id.
   * @example
   *
   * _.defer(function(text) {
   *   console.log(text);
   * }, 'deferred');
   * // => Logs 'deferred' after one millisecond.
   */
  var defer = baseRest(function(func, args) {
    return baseDelay(func, 1, args);
  });

  /**
   * Invokes `func` after `wait` milliseconds. Any additional arguments are
   * provided to `func` when it's invoked.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to delay.
   * @param {number} wait The number of milliseconds to delay invocation.
   * @param {...*} [args] The arguments to invoke `func` with.
   * @returns {number} Returns the timer id.
   * @example
   *
   * _.delay(function(text) {
   *   console.log(text);
   * }, 1000, 'later');
   * // => Logs 'later' after one second.
   */
  var delay = baseRest(function(func, wait, args) {
    return baseDelay(func, toNumber(wait) || 0, args);
  });

  /**
   * Creates a function that memoizes the result of `func`. If `resolver` is
   * provided, it determines the cache key for storing the result based on the
   * arguments provided to the memoized function. By default, the first argument
   * provided to the memoized function is used as the map cache key. The `func`
   * is invoked with the `this` binding of the memoized function.
   *
   * **Note:** The cache is exposed as the `cache` property on the memoized
   * function. Its creation may be customized by replacing the `_.memoize.Cache`
   * constructor with one whose instances implement the
   * [`Map`](http://ecma-international.org/ecma-262/7.0/#sec-properties-of-the-map-prototype-object)
   * method interface of `clear`, `delete`, `get`, `has`, and `set`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to have its output memoized.
   * @param {Function} [resolver] The function to resolve the cache key.
   * @returns {Function} Returns the new memoized function.
   * @example
   *
   * var object = { 'a': 1, 'b': 2 };
   * var other = { 'c': 3, 'd': 4 };
   *
   * var values = _.memoize(_.values);
   * values(object);
   * // => [1, 2]
   *
   * values(other);
   * // => [3, 4]
   *
   * object.a = 2;
   * values(object);
   * // => [1, 2]
   *
   * // Modify the result cache.
   * values.cache.set(object, ['a', 'b']);
   * values(object);
   * // => ['a', 'b']
   *
   * // Replace `_.memoize.Cache`.
   * _.memoize.Cache = WeakMap;
   */
  function memoize(func, resolver) {
    if (typeof func != 'function' || (resolver != null && typeof resolver != 'function')) {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    var memoized = function() {
      var args = arguments,
          key = resolver ? resolver.apply(this, args) : args[0],
          cache = memoized.cache;

      if (cache.has(key)) {
        return cache.get(key);
      }
      var result = func.apply(this, args);
      memoized.cache = cache.set(key, result) || cache;
      return result;
    };
    memoized.cache = new (memoize.Cache || MapCache);
    return memoized;
  }

  // Expose `MapCache`.
  memoize.Cache = MapCache;

  /**
   * Creates a function that negates the result of the predicate `func`. The
   * `func` predicate is invoked with the `this` binding and arguments of the
   * created function.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Function
   * @param {Function} predicate The predicate to negate.
   * @returns {Function} Returns the new negated function.
   * @example
   *
   * function isEven(n) {
   *   return n % 2 == 0;
   * }
   *
   * _.filter([1, 2, 3, 4, 5, 6], _.negate(isEven));
   * // => [1, 3, 5]
   */
  function negate(predicate) {
    if (typeof predicate != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    return function() {
      var args = arguments;
      switch (args.length) {
        case 0: return !predicate.call(this);
        case 1: return !predicate.call(this, args[0]);
        case 2: return !predicate.call(this, args[0], args[1]);
        case 3: return !predicate.call(this, args[0], args[1], args[2]);
      }
      return !predicate.apply(this, args);
    };
  }

  /**
   * Creates a function that is restricted to invoking `func` once. Repeat calls
   * to the function return the value of the first invocation. The `func` is
   * invoked with the `this` binding and arguments of the created function.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to restrict.
   * @returns {Function} Returns the new restricted function.
   * @example
   *
   * var initialize = _.once(createApplication);
   * initialize();
   * initialize();
   * // => `createApplication` is invoked once
   */
  function once(func) {
    return before(2, func);
  }

  /**
   * Creates a function that invokes `func` with the `this` binding of the
   * created function and arguments from `start` and beyond provided as
   * an array.
   *
   * **Note:** This method is based on the
   * [rest parameter](https://mdn.io/rest_parameters).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Function
   * @param {Function} func The function to apply a rest parameter to.
   * @param {number} [start=func.length-1] The start position of the rest parameter.
   * @returns {Function} Returns the new function.
   * @example
   *
   * var say = _.rest(function(what, names) {
   *   return what + ' ' + _.initial(names).join(', ') +
   *     (_.size(names) > 1 ? ', & ' : '') + _.last(names);
   * });
   *
   * say('hello', 'fred', 'barney', 'pebbles');
   * // => 'hello fred, barney, & pebbles'
   */
  function rest(func, start) {
    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    start = start === undefined ? start : toInteger(start);
    return baseRest(func, start);
  }

  /**
   * Creates a throttled function that only invokes `func` at most once per
   * every `wait` milliseconds. The throttled function comes with a `cancel`
   * method to cancel delayed `func` invocations and a `flush` method to
   * immediately invoke them. Provide `options` to indicate whether `func`
   * should be invoked on the leading and/or trailing edge of the `wait`
   * timeout. The `func` is invoked with the last arguments provided to the
   * throttled function. Subsequent calls to the throttled function return the
   * result of the last `func` invocation.
   *
   * **Note:** If `leading` and `trailing` options are `true`, `func` is
   * invoked on the trailing edge of the timeout only if the throttled function
   * is invoked more than once during the `wait` timeout.
   *
   * If `wait` is `0` and `leading` is `false`, `func` invocation is deferred
   * until to the next tick, similar to `setTimeout` with a timeout of `0`.
   *
   * See [David Corbacho's article](https://css-tricks.com/debouncing-throttling-explained-examples/)
   * for details over the differences between `_.throttle` and `_.debounce`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Function
   * @param {Function} func The function to throttle.
   * @param {number} [wait=0] The number of milliseconds to throttle invocations to.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.leading=true]
   *  Specify invoking on the leading edge of the timeout.
   * @param {boolean} [options.trailing=true]
   *  Specify invoking on the trailing edge of the timeout.
   * @returns {Function} Returns the new throttled function.
   * @example
   *
   * // Avoid excessively updating the position while scrolling.
   * jQuery(window).on('scroll', _.throttle(updatePosition, 100));
   *
   * // Invoke `renewToken` when the click event is fired, but not more than once every 5 minutes.
   * var throttled = _.throttle(renewToken, 300000, { 'trailing': false });
   * jQuery(element).on('click', throttled);
   *
   * // Cancel the trailing throttled invocation.
   * jQuery(window).on('popstate', throttled.cancel);
   */
  function throttle(func, wait, options) {
    var leading = true,
        trailing = true;

    if (typeof func != 'function') {
      throw new TypeError(FUNC_ERROR_TEXT);
    }
    if (isObject(options)) {
      leading = 'leading' in options ? !!options.leading : leading;
      trailing = 'trailing' in options ? !!options.trailing : trailing;
    }
    return debounce(func, wait, {
      'leading': leading,
      'maxWait': wait,
      'trailing': trailing
    });
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a shallow clone of `value`.
   *
   * **Note:** This method is loosely based on the
   * [structured clone algorithm](https://mdn.io/Structured_clone_algorithm)
   * and supports cloning arrays, array buffers, booleans, date objects, maps,
   * numbers, `Object` objects, regexes, sets, strings, symbols, and typed
   * arrays. The own enumerable properties of `arguments` objects are cloned
   * as plain objects. An empty object is returned for uncloneable values such
   * as error objects, functions, DOM nodes, and WeakMaps.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to clone.
   * @returns {*} Returns the cloned value.
   * @see _.cloneDeep
   * @example
   *
   * var objects = [{ 'a': 1 }, { 'b': 2 }];
   *
   * var shallow = _.clone(objects);
   * console.log(shallow[0] === objects[0]);
   * // => true
   */
  function clone(value) {
    return baseClone(value, CLONE_SYMBOLS_FLAG);
  }

  /**
   * This method is like `_.clone` except that it recursively clones `value`.
   *
   * @static
   * @memberOf _
   * @since 1.0.0
   * @category Lang
   * @param {*} value The value to recursively clone.
   * @returns {*} Returns the deep cloned value.
   * @see _.clone
   * @example
   *
   * var objects = [{ 'a': 1 }, { 'b': 2 }];
   *
   * var deep = _.cloneDeep(objects);
   * console.log(deep[0] === objects[0]);
   * // => false
   */
  function cloneDeep(value) {
    return baseClone(value, CLONE_DEEP_FLAG | CLONE_SYMBOLS_FLAG);
  }

  /**
   * Performs a
   * [`SameValueZero`](http://ecma-international.org/ecma-262/7.0/#sec-samevaluezero)
   * comparison between two values to determine if they are equivalent.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   * @example
   *
   * var object = { 'a': 1 };
   * var other = { 'a': 1 };
   *
   * _.eq(object, object);
   * // => true
   *
   * _.eq(object, other);
   * // => false
   *
   * _.eq('a', 'a');
   * // => true
   *
   * _.eq('a', Object('a'));
   * // => false
   *
   * _.eq(NaN, NaN);
   * // => true
   */
  function eq(value, other) {
    return value === other || (value !== value && other !== other);
  }

  /**
   * Checks if `value` is likely an `arguments` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an `arguments` object,
   *  else `false`.
   * @example
   *
   * _.isArguments(function() { return arguments; }());
   * // => true
   *
   * _.isArguments([1, 2, 3]);
   * // => false
   */
  var isArguments = baseIsArguments(function() { return arguments; }()) ? baseIsArguments : function(value) {
    return isObjectLike(value) && hasOwnProperty.call(value, 'callee') &&
      !propertyIsEnumerable.call(value, 'callee');
  };

  /**
   * Checks if `value` is classified as an `Array` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an array, else `false`.
   * @example
   *
   * _.isArray([1, 2, 3]);
   * // => true
   *
   * _.isArray(document.body.children);
   * // => false
   *
   * _.isArray('abc');
   * // => false
   *
   * _.isArray(_.noop);
   * // => false
   */
  var isArray = Array.isArray;

  /**
   * Checks if `value` is array-like. A value is considered array-like if it's
   * not a function and has a `value.length` that's an integer greater than or
   * equal to `0` and less than or equal to `Number.MAX_SAFE_INTEGER`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is array-like, else `false`.
   * @example
   *
   * _.isArrayLike([1, 2, 3]);
   * // => true
   *
   * _.isArrayLike(document.body.children);
   * // => true
   *
   * _.isArrayLike('abc');
   * // => true
   *
   * _.isArrayLike(_.noop);
   * // => false
   */
  function isArrayLike(value) {
    return value != null && isLength(value.length) && !isFunction(value);
  }

  /**
   * This method is like `_.isArrayLike` except that it also checks if `value`
   * is an object.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an array-like object,
   *  else `false`.
   * @example
   *
   * _.isArrayLikeObject([1, 2, 3]);
   * // => true
   *
   * _.isArrayLikeObject(document.body.children);
   * // => true
   *
   * _.isArrayLikeObject('abc');
   * // => false
   *
   * _.isArrayLikeObject(_.noop);
   * // => false
   */
  function isArrayLikeObject(value) {
    return isObjectLike(value) && isArrayLike(value);
  }

  /**
   * Checks if `value` is classified as a boolean primitive or object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a boolean, else `false`.
   * @example
   *
   * _.isBoolean(false);
   * // => true
   *
   * _.isBoolean(null);
   * // => false
   */
  function isBoolean(value) {
    return value === true || value === false ||
      (isObjectLike(value) && baseGetTag(value) == boolTag);
  }

  /**
   * Checks if `value` is a buffer.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a buffer, else `false`.
   * @example
   *
   * _.isBuffer(new Buffer(2));
   * // => true
   *
   * _.isBuffer(new Uint8Array(2));
   * // => false
   */
  var isBuffer = nativeIsBuffer || stubFalse;

  /**
   * Checks if `value` is classified as a `Date` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a date object, else `false`.
   * @example
   *
   * _.isDate(new Date);
   * // => true
   *
   * _.isDate('Mon April 23 2012');
   * // => false
   */
  var isDate = nodeIsDate ? baseUnary(nodeIsDate) : baseIsDate;

  /**
   * Checks if `value` is an empty object, collection, map, or set.
   *
   * Objects are considered empty if they have no own enumerable string keyed
   * properties.
   *
   * Array-like values such as `arguments` objects, arrays, buffers, strings, or
   * jQuery-like collections are considered empty if they have a `length` of `0`.
   * Similarly, maps and sets are considered empty if they have a `size` of `0`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is empty, else `false`.
   * @example
   *
   * _.isEmpty(null);
   * // => true
   *
   * _.isEmpty(true);
   * // => true
   *
   * _.isEmpty(1);
   * // => true
   *
   * _.isEmpty([1, 2, 3]);
   * // => false
   *
   * _.isEmpty({ 'a': 1 });
   * // => false
   */
  function isEmpty(value) {
    if (value == null) {
      return true;
    }
    if (isArrayLike(value) &&
        (isArray(value) || typeof value == 'string' || typeof value.splice == 'function' ||
          isBuffer(value) || isTypedArray(value) || isArguments(value))) {
      return !value.length;
    }
    var tag = getTag(value);
    if (tag == mapTag || tag == setTag) {
      return !value.size;
    }
    if (isPrototype(value)) {
      return !baseKeys(value).length;
    }
    for (var key in value) {
      if (hasOwnProperty.call(value, key)) {
        return false;
      }
    }
    return true;
  }

  /**
   * Performs a deep comparison between two values to determine if they are
   * equivalent.
   *
   * **Note:** This method supports comparing arrays, array buffers, booleans,
   * date objects, error objects, maps, numbers, `Object` objects, regexes,
   * sets, strings, symbols, and typed arrays. `Object` objects are compared
   * by their own, not inherited, enumerable properties. Functions and DOM
   * nodes are compared by strict equality, i.e. `===`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to compare.
   * @param {*} other The other value to compare.
   * @returns {boolean} Returns `true` if the values are equivalent, else `false`.
   * @example
   *
   * var object = { 'a': 1 };
   * var other = { 'a': 1 };
   *
   * _.isEqual(object, other);
   * // => true
   *
   * object === other;
   * // => false
   */
  function isEqual(value, other) {
    return baseIsEqual(value, other);
  }

  /**
   * Checks if `value` is a finite primitive number.
   *
   * **Note:** This method is based on
   * [`Number.isFinite`](https://mdn.io/Number/isFinite).
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a finite number, else `false`.
   * @example
   *
   * _.isFinite(3);
   * // => true
   *
   * _.isFinite(Number.MIN_VALUE);
   * // => true
   *
   * _.isFinite(Infinity);
   * // => false
   *
   * _.isFinite('3');
   * // => false
   */
  function isFinite(value) {
    return typeof value == 'number' && nativeIsFinite(value);
  }

  /**
   * Checks if `value` is classified as a `Function` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a function, else `false`.
   * @example
   *
   * _.isFunction(_);
   * // => true
   *
   * _.isFunction(/abc/);
   * // => false
   */
  function isFunction(value) {
    if (!isObject(value)) {
      return false;
    }
    // The use of `Object#toString` avoids issues with the `typeof` operator
    // in Safari 9 which returns 'object' for typed arrays and other constructors.
    var tag = baseGetTag(value);
    return tag == funcTag || tag == genTag || tag == asyncTag || tag == proxyTag;
  }

  /**
   * Checks if `value` is a valid array-like length.
   *
   * **Note:** This method is loosely based on
   * [`ToLength`](http://ecma-international.org/ecma-262/7.0/#sec-tolength).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a valid length, else `false`.
   * @example
   *
   * _.isLength(3);
   * // => true
   *
   * _.isLength(Number.MIN_VALUE);
   * // => false
   *
   * _.isLength(Infinity);
   * // => false
   *
   * _.isLength('3');
   * // => false
   */
  function isLength(value) {
    return typeof value == 'number' &&
      value > -1 && value % 1 == 0 && value <= MAX_SAFE_INTEGER;
  }

  /**
   * Checks if `value` is the
   * [language type](http://www.ecma-international.org/ecma-262/7.0/#sec-ecmascript-language-types)
   * of `Object`. (e.g. arrays, functions, objects, regexes, `new Number(0)`, and `new String('')`)
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is an object, else `false`.
   * @example
   *
   * _.isObject({});
   * // => true
   *
   * _.isObject([1, 2, 3]);
   * // => true
   *
   * _.isObject(_.noop);
   * // => true
   *
   * _.isObject(null);
   * // => false
   */
  function isObject(value) {
    var type = typeof value;
    return value != null && (type == 'object' || type == 'function');
  }

  /**
   * Checks if `value` is object-like. A value is object-like if it's not `null`
   * and has a `typeof` result of "object".
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is object-like, else `false`.
   * @example
   *
   * _.isObjectLike({});
   * // => true
   *
   * _.isObjectLike([1, 2, 3]);
   * // => true
   *
   * _.isObjectLike(_.noop);
   * // => false
   *
   * _.isObjectLike(null);
   * // => false
   */
  function isObjectLike(value) {
    return value != null && typeof value == 'object';
  }

  /**
   * Checks if `value` is classified as a `Map` object.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a map, else `false`.
   * @example
   *
   * _.isMap(new Map);
   * // => true
   *
   * _.isMap(new WeakMap);
   * // => false
   */
  var isMap = nodeIsMap ? baseUnary(nodeIsMap) : baseIsMap;

  /**
   * Checks if `value` is `NaN`.
   *
   * **Note:** This method is based on
   * [`Number.isNaN`](https://mdn.io/Number/isNaN) and is not the same as
   * global [`isNaN`](https://mdn.io/isNaN) which returns `true` for
   * `undefined` and other non-number values.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `NaN`, else `false`.
   * @example
   *
   * _.isNaN(NaN);
   * // => true
   *
   * _.isNaN(new Number(NaN));
   * // => true
   *
   * isNaN(undefined);
   * // => true
   *
   * _.isNaN(undefined);
   * // => false
   */
  function isNaN(value) {
    // An `NaN` primitive is the only value that is not equal to itself.
    // Perform the `toStringTag` check first to avoid errors with some
    // ActiveX objects in IE.
    return isNumber(value) && value != +value;
  }

  /**
   * Checks if `value` is `null`.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `null`, else `false`.
   * @example
   *
   * _.isNull(null);
   * // => true
   *
   * _.isNull(void 0);
   * // => false
   */
  function isNull(value) {
    return value === null;
  }

  /**
   * Checks if `value` is classified as a `Number` primitive or object.
   *
   * **Note:** To exclude `Infinity`, `-Infinity`, and `NaN`, which are
   * classified as numbers, use the `_.isFinite` method.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a number, else `false`.
   * @example
   *
   * _.isNumber(3);
   * // => true
   *
   * _.isNumber(Number.MIN_VALUE);
   * // => true
   *
   * _.isNumber(Infinity);
   * // => true
   *
   * _.isNumber('3');
   * // => false
   */
  function isNumber(value) {
    return typeof value == 'number' ||
      (isObjectLike(value) && baseGetTag(value) == numberTag);
  }

  /**
   * Checks if `value` is a plain object, that is, an object created by the
   * `Object` constructor or one with a `[[Prototype]]` of `null`.
   *
   * @static
   * @memberOf _
   * @since 0.8.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a plain object, else `false`.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   * }
   *
   * _.isPlainObject(new Foo);
   * // => false
   *
   * _.isPlainObject([1, 2, 3]);
   * // => false
   *
   * _.isPlainObject({ 'x': 0, 'y': 0 });
   * // => true
   *
   * _.isPlainObject(Object.create(null));
   * // => true
   */
  function isPlainObject(value) {
    if (!isObjectLike(value) || baseGetTag(value) != objectTag) {
      return false;
    }
    var proto = getPrototype(value);
    if (proto === null) {
      return true;
    }
    var Ctor = hasOwnProperty.call(proto, 'constructor') && proto.constructor;
    return typeof Ctor == 'function' && Ctor instanceof Ctor &&
      funcToString.call(Ctor) == objectCtorString;
  }

  /**
   * Checks if `value` is classified as a `RegExp` object.
   *
   * @static
   * @memberOf _
   * @since 0.1.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a regexp, else `false`.
   * @example
   *
   * _.isRegExp(/abc/);
   * // => true
   *
   * _.isRegExp('/abc/');
   * // => false
   */
  var isRegExp = nodeIsRegExp ? baseUnary(nodeIsRegExp) : baseIsRegExp;

  /**
   * Checks if `value` is classified as a `Set` object.
   *
   * @static
   * @memberOf _
   * @since 4.3.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a set, else `false`.
   * @example
   *
   * _.isSet(new Set);
   * // => true
   *
   * _.isSet(new WeakSet);
   * // => false
   */
  var isSet = nodeIsSet ? baseUnary(nodeIsSet) : baseIsSet;

  /**
   * Checks if `value` is classified as a `String` primitive or object.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a string, else `false`.
   * @example
   *
   * _.isString('abc');
   * // => true
   *
   * _.isString(1);
   * // => false
   */
  function isString(value) {
    return typeof value == 'string' ||
      (!isArray(value) && isObjectLike(value) && baseGetTag(value) == stringTag);
  }

  /**
   * Checks if `value` is classified as a `Symbol` primitive or object.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a symbol, else `false`.
   * @example
   *
   * _.isSymbol(Symbol.iterator);
   * // => true
   *
   * _.isSymbol('abc');
   * // => false
   */
  function isSymbol(value) {
    return typeof value == 'symbol' ||
      (isObjectLike(value) && baseGetTag(value) == symbolTag);
  }

  /**
   * Checks if `value` is classified as a typed array.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is a typed array, else `false`.
   * @example
   *
   * _.isTypedArray(new Uint8Array);
   * // => true
   *
   * _.isTypedArray([]);
   * // => false
   */
  var isTypedArray = nodeIsTypedArray ? baseUnary(nodeIsTypedArray) : baseIsTypedArray;

  /**
   * Checks if `value` is `undefined`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to check.
   * @returns {boolean} Returns `true` if `value` is `undefined`, else `false`.
   * @example
   *
   * _.isUndefined(void 0);
   * // => true
   *
   * _.isUndefined(null);
   * // => false
   */
  function isUndefined(value) {
    return value === undefined;
  }

  /**
   * Converts `value` to an array.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {Array} Returns the converted array.
   * @example
   *
   * _.toArray({ 'a': 1, 'b': 2 });
   * // => [1, 2]
   *
   * _.toArray('abc');
   * // => ['a', 'b', 'c']
   *
   * _.toArray(1);
   * // => []
   *
   * _.toArray(null);
   * // => []
   */
  function toArray(value) {
    if (!value) {
      return [];
    }
    if (isArrayLike(value)) {
      return isString(value) ? stringToArray(value) : copyArray(value);
    }
    if (symIterator && value[symIterator]) {
      return iteratorToArray(value[symIterator]());
    }
    var tag = getTag(value),
        func = tag == mapTag ? mapToArray : (tag == setTag ? setToArray : values);

    return func(value);
  }

  /**
   * Converts `value` to a finite number.
   *
   * @static
   * @memberOf _
   * @since 4.12.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {number} Returns the converted number.
   * @example
   *
   * _.toFinite(3.2);
   * // => 3.2
   *
   * _.toFinite(Number.MIN_VALUE);
   * // => 5e-324
   *
   * _.toFinite(Infinity);
   * // => 1.7976931348623157e+308
   *
   * _.toFinite('3.2');
   * // => 3.2
   */
  function toFinite(value) {
    if (!value) {
      return value === 0 ? value : 0;
    }
    value = toNumber(value);
    if (value === INFINITY || value === -INFINITY) {
      var sign = (value < 0 ? -1 : 1);
      return sign * MAX_INTEGER;
    }
    return value === value ? value : 0;
  }

  /**
   * Converts `value` to an integer.
   *
   * **Note:** This method is loosely based on
   * [`ToInteger`](http://www.ecma-international.org/ecma-262/7.0/#sec-tointeger).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {number} Returns the converted integer.
   * @example
   *
   * _.toInteger(3.2);
   * // => 3
   *
   * _.toInteger(Number.MIN_VALUE);
   * // => 0
   *
   * _.toInteger(Infinity);
   * // => 1.7976931348623157e+308
   *
   * _.toInteger('3.2');
   * // => 3
   */
  function toInteger(value) {
    var result = toFinite(value),
        remainder = result % 1;

    return result === result ? (remainder ? result - remainder : result) : 0;
  }

  /**
   * Converts `value` to a number.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to process.
   * @returns {number} Returns the number.
   * @example
   *
   * _.toNumber(3.2);
   * // => 3.2
   *
   * _.toNumber(Number.MIN_VALUE);
   * // => 5e-324
   *
   * _.toNumber(Infinity);
   * // => Infinity
   *
   * _.toNumber('3.2');
   * // => 3.2
   */
  function toNumber(value) {
    if (typeof value == 'number') {
      return value;
    }
    if (isSymbol(value)) {
      return NAN;
    }
    if (isObject(value)) {
      var other = typeof value.valueOf == 'function' ? value.valueOf() : value;
      value = isObject(other) ? (other + '') : other;
    }
    if (typeof value != 'string') {
      return value === 0 ? value : +value;
    }
    value = value.replace(reTrim, '');
    var isBinary = reIsBinary.test(value);
    return (isBinary || reIsOctal.test(value))
      ? freeParseInt(value.slice(2), isBinary ? 2 : 8)
      : (reIsBadHex.test(value) ? NAN : +value);
  }

  /**
   * Converts `value` to a plain object flattening inherited enumerable string
   * keyed properties of `value` to own properties of the plain object.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {Object} Returns the converted plain object.
   * @example
   *
   * function Foo() {
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.assign({ 'a': 1 }, new Foo);
   * // => { 'a': 1, 'b': 2 }
   *
   * _.assign({ 'a': 1 }, _.toPlainObject(new Foo));
   * // => { 'a': 1, 'b': 2, 'c': 3 }
   */
  function toPlainObject(value) {
    return copyObject(value, keysIn(value));
  }

  /**
   * Converts `value` to a string. An empty string is returned for `null`
   * and `undefined` values. The sign of `-0` is preserved.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Lang
   * @param {*} value The value to convert.
   * @returns {string} Returns the converted string.
   * @example
   *
   * _.toString(null);
   * // => ''
   *
   * _.toString(-0);
   * // => '-0'
   *
   * _.toString([1, 2, 3]);
   * // => '1,2,3'
   */
  function toString(value) {
    return value == null ? '' : baseToString(value);
  }

  /*------------------------------------------------------------------------*/

  /**
   * This method is like `_.assign` except that it iterates over own and
   * inherited source properties.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @alias extend
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.assign
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   * }
   *
   * function Bar() {
   *   this.c = 3;
   * }
   *
   * Foo.prototype.b = 2;
   * Bar.prototype.d = 4;
   *
   * _.assignIn({ 'a': 0 }, new Foo, new Bar);
   * // => { 'a': 1, 'b': 2, 'c': 3, 'd': 4 }
   */
  var assignIn = createAssigner(function(object, source) {
    copyObject(source, keysIn(source), object);
  });

  /**
   * Creates an object that inherits from the `prototype` object. If a
   * `properties` object is given, its own enumerable string keyed properties
   * are assigned to the created object.
   *
   * @static
   * @memberOf _
   * @since 2.3.0
   * @category Object
   * @param {Object} prototype The object to inherit from.
   * @param {Object} [properties] The properties to assign to the object.
   * @returns {Object} Returns the new object.
   * @example
   *
   * function Shape() {
   *   this.x = 0;
   *   this.y = 0;
   * }
   *
   * function Circle() {
   *   Shape.call(this);
   * }
   *
   * Circle.prototype = _.create(Shape.prototype, {
   *   'constructor': Circle
   * });
   *
   * var circle = new Circle;
   * circle instanceof Circle;
   * // => true
   *
   * circle instanceof Shape;
   * // => true
   */
  function create(prototype, properties) {
    var result = baseCreate(prototype);
    return properties == null ? result : baseAssign(result, properties);
  }

  /**
   * Assigns own and inherited enumerable string keyed properties of source
   * objects to the destination object for all destination properties that
   * resolve to `undefined`. Source objects are applied from left to right.
   * Once a property is set, additional values of the same property are ignored.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.defaultsDeep
   * @example
   *
   * _.defaults({ 'a': 1 }, { 'b': 2 }, { 'a': 3 });
   * // => { 'a': 1, 'b': 2 }
   */
  var defaults = baseRest(function(object, sources) {
    object = Object(object);

    var index = -1;
    var length = sources.length;
    var guard = length > 2 ? sources[2] : undefined;

    if (guard && isIterateeCall(sources[0], sources[1], guard)) {
      length = 1;
    }

    while (++index < length) {
      var source = sources[index];
      var props = keysIn(source);
      var propsIndex = -1;
      var propsLength = props.length;

      while (++propsIndex < propsLength) {
        var key = props[propsIndex];
        var value = object[key];

        if (value === undefined ||
            (eq(value, objectProto[key]) && !hasOwnProperty.call(object, key))) {
          object[key] = source[key];
        }
      }
    }

    return object;
  });

  /**
   * This method is like `_.defaults` except that it recursively assigns
   * default properties.
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 3.10.0
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} [sources] The source objects.
   * @returns {Object} Returns `object`.
   * @see _.defaults
   * @example
   *
   * _.defaultsDeep({ 'a': { 'b': 2 } }, { 'a': { 'b': 1, 'c': 3 } });
   * // => { 'a': { 'b': 2, 'c': 3 } }
   */
  var defaultsDeep = baseRest(function(args) {
    args.push(undefined, customDefaultsMerge);
    return apply(mergeWith, undefined, args);
  });

  /**
   * This method is like `_.find` except that it returns the key of the first
   * element `predicate` returns truthy for instead of the element itself.
   *
   * @static
   * @memberOf _
   * @since 1.1.0
   * @category Object
   * @param {Object} object The object to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {string|undefined} Returns the key of the matched element,
   *  else `undefined`.
   * @example
   *
   * var users = {
   *   'barney':  { 'age': 36, 'active': true },
   *   'fred':    { 'age': 40, 'active': false },
   *   'pebbles': { 'age': 1,  'active': true }
   * };
   *
   * _.findKey(users, function(o) { return o.age < 40; });
   * // => 'barney' (iteration order is not guaranteed)
   *
   * // The `_.matches` iteratee shorthand.
   * _.findKey(users, { 'age': 1, 'active': true });
   * // => 'pebbles'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findKey(users, ['active', false]);
   * // => 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.findKey(users, 'active');
   * // => 'barney'
   */
  function findKey(object, predicate) {
    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwn);
  }

  /**
   * This method is like `_.findKey` except that it iterates over elements of
   * a collection in the opposite order.
   *
   * @static
   * @memberOf _
   * @since 2.0.0
   * @category Object
   * @param {Object} object The object to inspect.
   * @param {Function} [predicate=_.identity] The function invoked per iteration.
   * @returns {string|undefined} Returns the key of the matched element,
   *  else `undefined`.
   * @example
   *
   * var users = {
   *   'barney':  { 'age': 36, 'active': true },
   *   'fred':    { 'age': 40, 'active': false },
   *   'pebbles': { 'age': 1,  'active': true }
   * };
   *
   * _.findLastKey(users, function(o) { return o.age < 40; });
   * // => returns 'pebbles' assuming `_.findKey` returns 'barney'
   *
   * // The `_.matches` iteratee shorthand.
   * _.findLastKey(users, { 'age': 36, 'active': true });
   * // => 'barney'
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.findLastKey(users, ['active', false]);
   * // => 'fred'
   *
   * // The `_.property` iteratee shorthand.
   * _.findLastKey(users, 'active');
   * // => 'pebbles'
   */
  function findLastKey(object, predicate) {
    return baseFindKey(object, baseIteratee(predicate, 3), baseForOwnRight);
  }

  /**
   * Gets the value at `path` of `object`. If the resolved value is
   * `undefined`, the `defaultValue` is returned in its place.
   *
   * @static
   * @memberOf _
   * @since 3.7.0
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to get.
   * @param {*} [defaultValue] The value returned for `undefined` resolved values.
   * @returns {*} Returns the resolved value.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c': 3 } }] };
   *
   * _.get(object, 'a[0].b.c');
   * // => 3
   *
   * _.get(object, ['a', '0', 'b', 'c']);
   * // => 3
   *
   * _.get(object, 'a.b.c', 'default');
   * // => 'default'
   */
  function get(object, path, defaultValue) {
    var result = object == null ? undefined : baseGet(object, path);
    return result === undefined ? defaultValue : result;
  }

  /**
   * Checks if `path` is a direct property of `object`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   * @example
   *
   * var object = { 'a': { 'b': 2 } };
   * var other = _.create({ 'a': _.create({ 'b': 2 }) });
   *
   * _.has(object, 'a');
   * // => true
   *
   * _.has(object, 'a.b');
   * // => true
   *
   * _.has(object, ['a', 'b']);
   * // => true
   *
   * _.has(other, 'a');
   * // => false
   */
  function has(object, path) {
    return object != null && hasPath(object, path, baseHas);
  }

  /**
   * Checks if `path` is a direct or inherited property of `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path to check.
   * @returns {boolean} Returns `true` if `path` exists, else `false`.
   * @example
   *
   * var object = _.create({ 'a': _.create({ 'b': 2 }) });
   *
   * _.hasIn(object, 'a');
   * // => true
   *
   * _.hasIn(object, 'a.b');
   * // => true
   *
   * _.hasIn(object, ['a', 'b']);
   * // => true
   *
   * _.hasIn(object, 'b');
   * // => false
   */
  function hasIn(object, path) {
    return object != null && hasPath(object, path, baseHasIn);
  }

  /**
   * Creates an object composed of the inverted keys and values of `object`.
   * If `object` contains duplicate values, subsequent values overwrite
   * property assignments of previous values.
   *
   * @static
   * @memberOf _
   * @since 0.7.0
   * @category Object
   * @param {Object} object The object to invert.
   * @returns {Object} Returns the new inverted object.
   * @example
   *
   * var object = { 'a': 1, 'b': 2, 'c': 1 };
   *
   * _.invert(object);
   * // => { '1': 'c', '2': 'b' }
   */
  var invert = createInverter(function(result, value, key) {
    if (value != null &&
        typeof value.toString != 'function') {
      value = nativeObjectToString.call(value);
    }

    result[value] = key;
  }, constant(identity));

  /**
   * This method is like `_.invert` except that the inverted object is generated
   * from the results of running each element of `object` thru `iteratee`. The
   * corresponding inverted value of each inverted key is an array of keys
   * responsible for generating the inverted value. The iteratee is invoked
   * with one argument: (value).
   *
   * @static
   * @memberOf _
   * @since 4.1.0
   * @category Object
   * @param {Object} object The object to invert.
   * @param {Function} [iteratee=_.identity] The iteratee invoked per element.
   * @returns {Object} Returns the new inverted object.
   * @example
   *
   * var object = { 'a': 1, 'b': 2, 'c': 1 };
   *
   * _.invertBy(object);
   * // => { '1': ['a', 'c'], '2': ['b'] }
   *
   * _.invertBy(object, function(value) {
   *   return 'group' + value;
   * });
   * // => { 'group1': ['a', 'c'], 'group2': ['b'] }
   */
  var invertBy = createInverter(function(result, value, key) {
    if (value != null &&
        typeof value.toString != 'function') {
      value = nativeObjectToString.call(value);
    }

    if (hasOwnProperty.call(result, value)) {
      result[value].push(key);
    } else {
      result[value] = [key];
    }
  }, baseIteratee);

  /**
   * Creates an array of the own enumerable property names of `object`.
   *
   * **Note:** Non-object values are coerced to objects. See the
   * [ES spec](http://ecma-international.org/ecma-262/7.0/#sec-object.keys)
   * for more details.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.keys(new Foo);
   * // => ['a', 'b'] (iteration order is not guaranteed)
   *
   * _.keys('hi');
   * // => ['0', '1']
   */
  function keys(object) {
    return isArrayLike(object) ? arrayLikeKeys(object) : baseKeys(object);
  }

  /**
   * Creates an array of the own and inherited enumerable property names of `object`.
   *
   * **Note:** Non-object values are coerced to objects.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property names.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.keysIn(new Foo);
   * // => ['a', 'b', 'c'] (iteration order is not guaranteed)
   */
  function keysIn(object) {
    return isArrayLike(object) ? arrayLikeKeys(object, true) : baseKeysIn(object);
  }

  /**
   * This method is like `_.merge` except that it accepts `customizer` which
   * is invoked to produce the merged values of the destination and source
   * properties. If `customizer` returns `undefined`, merging is handled by the
   * method instead. The `customizer` is invoked with six arguments:
   * (objValue, srcValue, key, object, source, stack).
   *
   * **Note:** This method mutates `object`.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The destination object.
   * @param {...Object} sources The source objects.
   * @param {Function} customizer The function to customize assigned values.
   * @returns {Object} Returns `object`.
   * @example
   *
   * function customizer(objValue, srcValue) {
   *   if (_.isArray(objValue)) {
   *     return objValue.concat(srcValue);
   *   }
   * }
   *
   * var object = { 'a': [1], 'b': [2] };
   * var other = { 'a': [3], 'b': [4] };
   *
   * _.mergeWith(object, other, customizer);
   * // => { 'a': [1, 3], 'b': [2, 4] }
   */
  var mergeWith = createAssigner(function(object, source, srcIndex, customizer) {
    baseMerge(object, source, srcIndex, customizer);
  });

  /**
   * The opposite of `_.pick`; this method creates an object composed of the
   * own and inherited enumerable property paths of `object` that are not omitted.
   *
   * **Note:** This method is considerably slower than `_.pick`.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The source object.
   * @param {...(string|string[])} [paths] The property paths to omit.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.omit(object, ['a', 'c']);
   * // => { 'b': '2' }
   */
  var omit = flatRest(function(object, paths) {
    var result = {};
    if (object == null) {
      return result;
    }
    var isDeep = false;
    paths = arrayMap(paths, function(path) {
      path = castPath(path, object);
      isDeep || (isDeep = path.length > 1);
      return path;
    });
    copyObject(object, getAllKeysIn(object), result);
    if (isDeep) {
      result = baseClone(result, CLONE_DEEP_FLAG | CLONE_FLAT_FLAG | CLONE_SYMBOLS_FLAG, customOmitClone);
    }
    var length = paths.length;
    while (length--) {
      baseUnset(result, paths[length]);
    }
    return result;
  });

  /**
   * The opposite of `_.pickBy`; this method creates an object composed of
   * the own and inherited enumerable string keyed properties of `object` that
   * `predicate` doesn't return truthy for. The predicate is invoked with two
   * arguments: (value, key).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The source object.
   * @param {Function} [predicate=_.identity] The function invoked per property.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.omitBy(object, _.isNumber);
   * // => { 'b': '2' }
   */
  function omitBy(object, predicate) {
    return pickBy(object, negate(baseIteratee(predicate)));
  }

  /**
   * Creates an object composed of the picked `object` properties.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The source object.
   * @param {...(string|string[])} [paths] The property paths to pick.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.pick(object, ['a', 'c']);
   * // => { 'a': 1, 'c': 3 }
   */
  var pick = flatRest(function(object, paths) {
    return object == null ? {} : basePick(object, paths);
  });

  /**
   * Creates an object composed of the `object` properties `predicate` returns
   * truthy for. The predicate is invoked with two arguments: (value, key).
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Object
   * @param {Object} object The source object.
   * @param {Function} [predicate=_.identity] The function invoked per property.
   * @returns {Object} Returns the new object.
   * @example
   *
   * var object = { 'a': 1, 'b': '2', 'c': 3 };
   *
   * _.pickBy(object, _.isNumber);
   * // => { 'a': 1, 'c': 3 }
   */
  function pickBy(object, predicate) {
    if (object == null) {
      return {};
    }
    var props = arrayMap(getAllKeysIn(object), function(prop) {
      return [prop];
    });
    predicate = baseIteratee(predicate);
    return basePickBy(object, props, function(value, path) {
      return predicate(value, path[0]);
    });
  }

  /**
   * This method is like `_.get` except that if the resolved value is a
   * function it's invoked with the `this` binding of its parent object and
   * its result is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @param {Array|string} path The path of the property to resolve.
   * @param {*} [defaultValue] The value returned for `undefined` resolved values.
   * @returns {*} Returns the resolved value.
   * @example
   *
   * var object = { 'a': [{ 'b': { 'c1': 3, 'c2': _.constant(4) } }] };
   *
   * _.result(object, 'a[0].b.c1');
   * // => 3
   *
   * _.result(object, 'a[0].b.c2');
   * // => 4
   *
   * _.result(object, 'a[0].b.c3', 'default');
   * // => 'default'
   *
   * _.result(object, 'a[0].b.c3', _.constant('default'));
   * // => 'default'
   */
  function result(object, path, defaultValue) {
    path = castPath(path, object);

    var index = -1,
        length = path.length;

    // Ensure the loop is entered when path is empty.
    if (!length) {
      length = 1;
      object = undefined;
    }
    while (++index < length) {
      var value = object == null ? undefined : object[toKey(path[index])];
      if (value === undefined) {
        index = length;
        value = defaultValue;
      }
      object = isFunction(value) ? value.call(object) : value;
    }
    return object;
  }

  /**
   * Creates an array of the own enumerable string keyed property values of `object`.
   *
   * **Note:** Non-object values are coerced to objects.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Object
   * @param {Object} object The object to query.
   * @returns {Array} Returns the array of property values.
   * @example
   *
   * function Foo() {
   *   this.a = 1;
   *   this.b = 2;
   * }
   *
   * Foo.prototype.c = 3;
   *
   * _.values(new Foo);
   * // => [1, 2] (iteration order is not guaranteed)
   *
   * _.values('hi');
   * // => ['h', 'i']
   */
  function values(object) {
    return object == null ? [] : baseValues(object, keys(object));
  }

  /*------------------------------------------------------------------------*/

  /**
   * Clamps `number` within the inclusive `lower` and `upper` bounds.
   *
   * @static
   * @memberOf _
   * @since 4.0.0
   * @category Number
   * @param {number} number The number to clamp.
   * @param {number} [lower] The lower bound.
   * @param {number} upper The upper bound.
   * @returns {number} Returns the clamped number.
   * @example
   *
   * _.clamp(-10, -5, 5);
   * // => -5
   *
   * _.clamp(10, -5, 5);
   * // => 5
   */
  function clamp(number, lower, upper) {
    if (upper === undefined) {
      upper = lower;
      lower = undefined;
    }
    if (upper !== undefined) {
      upper = toNumber(upper);
      upper = upper === upper ? upper : 0;
    }
    if (lower !== undefined) {
      lower = toNumber(lower);
      lower = lower === lower ? lower : 0;
    }
    return baseClamp(toNumber(number), lower, upper);
  }

  /**
   * Produces a random number between the inclusive `lower` and `upper` bounds.
   * If only one argument is provided a number between `0` and the given number
   * is returned. If `floating` is `true`, or either `lower` or `upper` are
   * floats, a floating-point number is returned instead of an integer.
   *
   * **Note:** JavaScript follows the IEEE-754 standard for resolving
   * floating-point values which can produce unexpected results.
   *
   * @static
   * @memberOf _
   * @since 0.7.0
   * @category Number
   * @param {number} [lower=0] The lower bound.
   * @param {number} [upper=1] The upper bound.
   * @param {boolean} [floating] Specify returning a floating-point number.
   * @returns {number} Returns the random number.
   * @example
   *
   * _.random(0, 5);
   * // => an integer between 0 and 5
   *
   * _.random(5);
   * // => also an integer between 0 and 5
   *
   * _.random(5, true);
   * // => a floating-point number between 0 and 5
   *
   * _.random(1.2, 5.2);
   * // => a floating-point number between 1.2 and 5.2
   */
  function random(lower, upper, floating) {
    if (floating && typeof floating != 'boolean' && isIterateeCall(lower, upper, floating)) {
      upper = floating = undefined;
    }
    if (floating === undefined) {
      if (typeof upper == 'boolean') {
        floating = upper;
        upper = undefined;
      }
      else if (typeof lower == 'boolean') {
        floating = lower;
        lower = undefined;
      }
    }
    if (lower === undefined && upper === undefined) {
      lower = 0;
      upper = 1;
    }
    else {
      lower = toFinite(lower);
      if (upper === undefined) {
        upper = lower;
        lower = 0;
      } else {
        upper = toFinite(upper);
      }
    }
    if (lower > upper) {
      var temp = lower;
      lower = upper;
      upper = temp;
    }
    if (floating || lower % 1 || upper % 1) {
      var rand = nativeRandom();
      return nativeMin(lower + (rand * (upper - lower + freeParseFloat('1e-' + ((rand + '').length - 1)))), upper);
    }
    return baseRandom(lower, upper);
  }

  /*------------------------------------------------------------------------*/

  /**
   * Converts the characters "&", "<", ">", '"', and "'" in `string` to their
   * corresponding HTML entities.
   *
   * **Note:** No other characters are escaped. To escape additional
   * characters use a third-party library like [_he_](https://mths.be/he).
   *
   * Though the ">" character is escaped for symmetry, characters like
   * ">" and "/" don't need escaping in HTML and have no special meaning
   * unless they're part of a tag or unquoted attribute value. See
   * [Mathias Bynens's article](https://mathiasbynens.be/notes/ambiguous-ampersands)
   * (under "semi-related fun fact") for more details.
   *
   * When working with HTML you should always
   * [quote attribute values](http://wonko.com/post/html-escaping) to reduce
   * XSS vectors.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category String
   * @param {string} [string=''] The string to escape.
   * @returns {string} Returns the escaped string.
   * @example
   *
   * _.escape('fred, barney, & pebbles');
   * // => 'fred, barney, &amp; pebbles'
   */
  function escape(string) {
    string = toString(string);
    return (string && reHasUnescapedHtml.test(string))
      ? string.replace(reUnescapedHtml, escapeHtmlChar)
      : string;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Creates a function that returns `value`.
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Util
   * @param {*} value The value to return from the new function.
   * @returns {Function} Returns the new constant function.
   * @example
   *
   * var objects = _.times(2, _.constant({ 'a': 1 }));
   *
   * console.log(objects);
   * // => [{ 'a': 1 }, { 'a': 1 }]
   *
   * console.log(objects[0] === objects[1]);
   * // => true
   */
  function constant(value) {
    return function() {
      return value;
    };
  }

  /**
   * This method returns the first argument it receives.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {*} value Any value.
   * @returns {*} Returns `value`.
   * @example
   *
   * var object = { 'a': 1 };
   *
   * console.log(_.identity(object) === object);
   * // => true
   */
  function identity(value) {
    return value;
  }

  /**
   * Creates a function that invokes `func` with the arguments of the created
   * function. If `func` is a property name, the created function returns the
   * property value for a given element. If `func` is an array or object, the
   * created function returns `true` for elements that contain the equivalent
   * source properties, otherwise it returns `false`.
   *
   * @static
   * @since 4.0.0
   * @memberOf _
   * @category Util
   * @param {*} [func=_.identity] The value to convert to a callback.
   * @returns {Function} Returns the callback.
   * @example
   *
   * var users = [
   *   { 'user': 'barney', 'age': 36, 'active': true },
   *   { 'user': 'fred',   'age': 40, 'active': false }
   * ];
   *
   * // The `_.matches` iteratee shorthand.
   * _.filter(users, _.iteratee({ 'user': 'barney', 'active': true }));
   * // => [{ 'user': 'barney', 'age': 36, 'active': true }]
   *
   * // The `_.matchesProperty` iteratee shorthand.
   * _.filter(users, _.iteratee(['user', 'fred']));
   * // => [{ 'user': 'fred', 'age': 40 }]
   *
   * // The `_.property` iteratee shorthand.
   * _.map(users, _.iteratee('user'));
   * // => ['barney', 'fred']
   *
   * // Create custom iteratee shorthands.
   * _.iteratee = _.wrap(_.iteratee, function(iteratee, func) {
   *   return !_.isRegExp(func) ? iteratee(func) : function(string) {
   *     return func.test(string);
   *   };
   * });
   *
   * _.filter(['abc', 'def'], /ef/);
   * // => ['def']
   */
  function iteratee(func) {
    return baseIteratee(typeof func == 'function' ? func : baseClone(func, CLONE_DEEP_FLAG));
  }

  /**
   * Creates a function that performs a partial deep comparison between a given
   * object and `source`, returning `true` if the given object has equivalent
   * property values, else `false`.
   *
   * **Note:** The created function is equivalent to `_.isMatch` with `source`
   * partially applied.
   *
   * Partial comparisons will match empty array and empty object `source`
   * values against any array or object value, respectively. See `_.isEqual`
   * for a list of supported value comparisons.
   *
   * @static
   * @memberOf _
   * @since 3.0.0
   * @category Util
   * @param {Object} source The object of property values to match.
   * @returns {Function} Returns the new spec function.
   * @example
   *
   * var objects = [
   *   { 'a': 1, 'b': 2, 'c': 3 },
   *   { 'a': 4, 'b': 5, 'c': 6 }
   * ];
   *
   * _.filter(objects, _.matches({ 'a': 4, 'c': 6 }));
   * // => [{ 'a': 4, 'b': 5, 'c': 6 }]
   */
  function matches(source) {
    return baseMatches(baseClone(source, CLONE_DEEP_FLAG));
  }

  /**
   * Adds all own enumerable string keyed function properties of a source
   * object to the destination object. If `object` is a function, then methods
   * are added to its prototype as well.
   *
   * **Note:** Use `_.runInContext` to create a pristine `lodash` function to
   * avoid conflicts caused by modifying the original.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {Function|Object} [object=lodash] The destination object.
   * @param {Object} source The object of functions to add.
   * @param {Object} [options={}] The options object.
   * @param {boolean} [options.chain=true] Specify whether mixins are chainable.
   * @returns {Function|Object} Returns `object`.
   * @example
   *
   * function vowels(string) {
   *   return _.filter(string, function(v) {
   *     return /[aeiou]/i.test(v);
   *   });
   * }
   *
   * _.mixin({ 'vowels': vowels });
   * _.vowels('fred');
   * // => ['e']
   *
   * _('fred').vowels().value();
   * // => ['e']
   *
   * _.mixin({ 'vowels': vowels }, { 'chain': false });
   * _('fred').vowels();
   * // => ['e']
   */
  function mixin(object, source, options) {
    var props = keys(source),
        methodNames = baseFunctions(source, props);

    if (options == null &&
        !(isObject(source) && (methodNames.length || !props.length))) {
      options = source;
      source = object;
      object = this;
      methodNames = baseFunctions(source, keys(source));
    }
    var chain = !(isObject(options) && 'chain' in options) || !!options.chain,
        isFunc = isFunction(object);

    arrayEach(methodNames, function(methodName) {
      var func = source[methodName];
      object[methodName] = func;
      if (isFunc) {
        object.prototype[methodName] = function() {
          var chainAll = this.__chain__;
          if (chain || chainAll) {
            var result = object(this.__wrapped__),
                actions = result.__actions__ = copyArray(this.__actions__);

            actions.push({ 'func': func, 'args': arguments, 'thisArg': object });
            result.__chain__ = chainAll;
            return result;
          }
          return func.apply(object, arrayPush([this.value()], arguments));
        };
      }
    });

    return object;
  }

  /**
   * Reverts the `_` variable to its previous value and returns a reference to
   * the `lodash` function.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @returns {Function} Returns the `lodash` function.
   * @example
   *
   * var lodash = _.noConflict();
   */
  function noConflict() {
    if (root._ === this) {
      root._ = oldDash;
    }
    return this;
  }

  /**
   * This method returns `undefined`.
   *
   * @static
   * @memberOf _
   * @since 2.3.0
   * @category Util
   * @example
   *
   * _.times(2, _.noop);
   * // => [undefined, undefined]
   */
  function noop() {
    // No operation performed.
  }

  /**
   * Creates a function that returns the value at `path` of a given object.
   *
   * @static
   * @memberOf _
   * @since 2.4.0
   * @category Util
   * @param {Array|string} path The path of the property to get.
   * @returns {Function} Returns the new accessor function.
   * @example
   *
   * var objects = [
   *   { 'a': { 'b': 2 } },
   *   { 'a': { 'b': 1 } }
   * ];
   *
   * _.map(objects, _.property('a.b'));
   * // => [2, 1]
   *
   * _.map(_.sortBy(objects, _.property(['a', 'b'])), 'a.b');
   * // => [1, 2]
   */
  function property(path) {
    return isKey(path) ? baseProperty(toKey(path)) : basePropertyDeep(path);
  }

  /**
   * Creates an array of numbers (positive and/or negative) progressing from
   * `start` up to, but not including, `end`. A step of `-1` is used if a negative
   * `start` is specified without an `end` or `step`. If `end` is not specified,
   * it's set to `start` with `start` then set to `0`.
   *
   * **Note:** JavaScript follows the IEEE-754 standard for resolving
   * floating-point values which can produce unexpected results.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {number} [start=0] The start of the range.
   * @param {number} end The end of the range.
   * @param {number} [step=1] The value to increment or decrement by.
   * @returns {Array} Returns the range of numbers.
   * @see _.inRange, _.rangeRight
   * @example
   *
   * _.range(4);
   * // => [0, 1, 2, 3]
   *
   * _.range(-4);
   * // => [0, -1, -2, -3]
   *
   * _.range(1, 5);
   * // => [1, 2, 3, 4]
   *
   * _.range(0, 20, 5);
   * // => [0, 5, 10, 15]
   *
   * _.range(0, -4, -1);
   * // => [0, -1, -2, -3]
   *
   * _.range(1, 4, 0);
   * // => [1, 1, 1]
   *
   * _.range(0);
   * // => []
   */
  var range = createRange();

  /**
   * This method returns a new empty array.
   *
   * @static
   * @memberOf _
   * @since 4.13.0
   * @category Util
   * @returns {Array} Returns the new empty array.
   * @example
   *
   * var arrays = _.times(2, _.stubArray);
   *
   * console.log(arrays);
   * // => [[], []]
   *
   * console.log(arrays[0] === arrays[1]);
   * // => false
   */
  function stubArray() {
    return [];
  }

  /**
   * This method returns `false`.
   *
   * @static
   * @memberOf _
   * @since 4.13.0
   * @category Util
   * @returns {boolean} Returns `false`.
   * @example
   *
   * _.times(2, _.stubFalse);
   * // => [false, false]
   */
  function stubFalse() {
    return false;
  }

  /**
   * Generates a unique ID. If `prefix` is given, the ID is appended to it.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Util
   * @param {string} [prefix=''] The value to prefix the ID with.
   * @returns {string} Returns the unique ID.
   * @example
   *
   * _.uniqueId('contact_');
   * // => 'contact_104'
   *
   * _.uniqueId();
   * // => '105'
   */
  function uniqueId(prefix) {
    var id = ++idCounter;
    return toString(prefix) + id;
  }

  /*------------------------------------------------------------------------*/

  /**
   * Computes the maximum value of `array`. If `array` is empty or falsey,
   * `undefined` is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Math
   * @param {Array} array The array to iterate over.
   * @returns {*} Returns the maximum value.
   * @example
   *
   * _.max([4, 2, 8, 6]);
   * // => 8
   *
   * _.max([]);
   * // => undefined
   */
  function max(array) {
    return (array && array.length)
      ? baseExtremum(array, identity, baseGt)
      : undefined;
  }

  /**
   * Computes the minimum value of `array`. If `array` is empty or falsey,
   * `undefined` is returned.
   *
   * @static
   * @since 0.1.0
   * @memberOf _
   * @category Math
   * @param {Array} array The array to iterate over.
   * @returns {*} Returns the minimum value.
   * @example
   *
   * _.min([4, 2, 8, 6]);
   * // => 2
   *
   * _.min([]);
   * // => undefined
   */
  function min(array) {
    return (array && array.length)
      ? baseExtremum(array, identity, baseLt)
      : undefined;
  }

  /*------------------------------------------------------------------------*/

  // Add methods that return wrapped values in chain sequences.
  lodash.assignIn = assignIn;
  lodash.before = before;
  lodash.bind = bind;
  lodash.chain = chain;
  lodash.compact = compact;
  lodash.concat = concat;
  lodash.countBy = countBy;
  lodash.create = create;
  lodash.debounce = debounce;
  lodash.defaults = defaults;
  lodash.defaultsDeep = defaultsDeep;
  lodash.defer = defer;
  lodash.delay = delay;
  lodash.difference = difference;
  lodash.drop = drop;
  lodash.filter = filter;
  lodash.flatten = flatten;
  lodash.flattenDeep = flattenDeep;
  lodash.initial = initial;
  lodash.intersection = intersection;
  lodash.invert = invert;
  lodash.invertBy = invertBy;
  lodash.iteratee = iteratee;
  lodash.keys = keys;
  lodash.map = map;
  lodash.matches = matches;
  lodash.mixin = mixin;
  lodash.negate = negate;
  lodash.omit = omit;
  lodash.omitBy = omitBy;
  lodash.once = once;
  lodash.pick = pick;
  lodash.range = range;
  lodash.reject = reject;
  lodash.rest = rest;
  lodash.slice = slice;
  lodash.sortBy = sortBy;
  lodash.take = take;
  lodash.takeRight = takeRight;
  lodash.tap = tap;
  lodash.throttle = throttle;
  lodash.thru = thru;
  lodash.toArray = toArray;
  lodash.union = union;
  lodash.uniq = uniq;
  lodash.uniqBy = uniqBy;
  lodash.unzip = unzip;
  lodash.values = values;
  lodash.without = without;
  lodash.zip = zip;
  lodash.zipObject = zipObject;

  // Add aliases.
  lodash.extend = assignIn;

  // Add methods to `lodash.prototype`.
  mixin(lodash, lodash);

  /*------------------------------------------------------------------------*/

  // Add methods that return unwrapped values in chain sequences.
  lodash.clamp = clamp;
  lodash.clone = clone;
  lodash.cloneDeep = cloneDeep;
  lodash.escape = escape;
  lodash.every = every;
  lodash.find = find;
  lodash.findIndex = findIndex;
  lodash.findKey = findKey;
  lodash.findLastIndex = findLastIndex;
  lodash.findLastKey = findLastKey;
  lodash.forEach = forEach;
  lodash.get = get;
  lodash.has = has;
  lodash.head = head;
  lodash.identity = identity;
  lodash.indexOf = indexOf;
  lodash.isArguments = isArguments;
  lodash.isArray = isArray;
  lodash.isArrayLike = isArrayLike;
  lodash.isBoolean = isBoolean;
  lodash.isDate = isDate;
  lodash.isEmpty = isEmpty;
  lodash.isEqual = isEqual;
  lodash.isFinite = isFinite;
  lodash.isFunction = isFunction;
  lodash.isNaN = isNaN;
  lodash.isNull = isNull;
  lodash.isNumber = isNumber;
  lodash.isObject = isObject;
  lodash.isPlainObject = isPlainObject;
  lodash.isRegExp = isRegExp;
  lodash.isString = isString;
  lodash.isUndefined = isUndefined;
  lodash.last = last;
  lodash.max = max;
  lodash.min = min;
  lodash.noConflict = noConflict;
  lodash.noop = noop;
  lodash.random = random;
  lodash.reduce = reduce;
  lodash.result = result;
  lodash.size = size;
  lodash.some = some;
  lodash.uniqueId = uniqueId;

  // Add aliases.
  lodash.each = forEach;
  lodash.first = head;

  mixin(lodash, (function() {
    var source = {};
    baseForOwn(lodash, function(func, methodName) {
      if (!hasOwnProperty.call(lodash.prototype, methodName)) {
        source[methodName] = func;
      }
    });
    return source;
  }()), { 'chain': false });

  /*------------------------------------------------------------------------*/

  /**
   * The semantic version number.
   *
   * @static
   * @memberOf _
   * @type {string}
   */
  lodash.VERSION = VERSION;

  // Add `LazyWrapper` methods for `_.drop` and `_.take` variants.
  arrayEach(['drop', 'take'], function(methodName, index) {
    LazyWrapper.prototype[methodName] = function(n) {
      n = n === undefined ? 1 : nativeMax(toInteger(n), 0);

      var result = (this.__filtered__ && !index)
        ? new LazyWrapper(this)
        : this.clone();

      if (result.__filtered__) {
        result.__takeCount__ = nativeMin(n, result.__takeCount__);
      } else {
        result.__views__.push({
          'size': nativeMin(n, MAX_ARRAY_LENGTH),
          'type': methodName + (result.__dir__ < 0 ? 'Right' : '')
        });
      }
      return result;
    };

    LazyWrapper.prototype[methodName + 'Right'] = function(n) {
      return this.reverse()[methodName](n).reverse();
    };
  });

  // Add `LazyWrapper` methods that accept an `iteratee` value.
  arrayEach(['filter', 'map', 'takeWhile'], function(methodName, index) {
    var type = index + 1,
        isFilter = type == LAZY_FILTER_FLAG || type == LAZY_WHILE_FLAG;

    LazyWrapper.prototype[methodName] = function(iteratee) {
      var result = this.clone();
      result.__iteratees__.push({
        'iteratee': getIteratee(iteratee, 3),
        'type': type
      });
      result.__filtered__ = result.__filtered__ || isFilter;
      return result;
    };
  });

  // Add `LazyWrapper` methods for `_.head` and `_.last`.
  arrayEach(['head', 'last'], function(methodName, index) {
    var takeName = 'take' + (index ? 'Right' : '');

    LazyWrapper.prototype[methodName] = function() {
      return this[takeName](1).value()[0];
    };
  });

  // Add `LazyWrapper` methods for `_.initial` and `_.tail`.
  arrayEach(['initial', 'tail'], function(methodName, index) {
    var dropName = 'drop' + (index ? '' : 'Right');

    LazyWrapper.prototype[methodName] = function() {
      return this.__filtered__ ? new LazyWrapper(this) : this[dropName](1);
    };
  });

  LazyWrapper.prototype.compact = function() {
    return this.filter(identity);
  };

  LazyWrapper.prototype.find = function(predicate) {
    return this.filter(predicate).head();
  };

  LazyWrapper.prototype.findLast = function(predicate) {
    return this.reverse().find(predicate);
  };

  LazyWrapper.prototype.invokeMap = baseRest(function(path, args) {
    if (typeof path == 'function') {
      return new LazyWrapper(this);
    }
    return this.map(function(value) {
      return baseInvoke(value, path, args);
    });
  });

  LazyWrapper.prototype.reject = function(predicate) {
    return this.filter(negate(getIteratee(predicate)));
  };

  LazyWrapper.prototype.slice = function(start, end) {
    start = toInteger(start);

    var result = this;
    if (result.__filtered__ && (start > 0 || end < 0)) {
      return new LazyWrapper(result);
    }
    if (start < 0) {
      result = result.takeRight(-start);
    } else if (start) {
      result = result.drop(start);
    }
    if (end !== undefined) {
      end = toInteger(end);
      result = end < 0 ? result.dropRight(-end) : result.take(end - start);
    }
    return result;
  };

  LazyWrapper.prototype.takeRightWhile = function(predicate) {
    return this.reverse().takeWhile(predicate).reverse();
  };

  LazyWrapper.prototype.toArray = function() {
    return this.take(MAX_ARRAY_LENGTH);
  };

  // Add `LazyWrapper` methods to `lodash.prototype`.
  baseForOwn(LazyWrapper.prototype, function(func, methodName) {
    var checkIteratee = /^(?:filter|find|map|reject)|While$/.test(methodName),
        isTaker = /^(?:head|last)$/.test(methodName),
        lodashFunc = lodash[isTaker ? ('take' + (methodName == 'last' ? 'Right' : '')) : methodName],
        retUnwrapped = isTaker || /^find/.test(methodName);

    if (!lodashFunc) {
      return;
    }
    lodash.prototype[methodName] = function() {
      var value = this.__wrapped__,
          args = isTaker ? [1] : arguments,
          isLazy = value instanceof LazyWrapper,
          iteratee = args[0],
          useLazy = isLazy || isArray(value);

      var interceptor = function(value) {
        var result = lodashFunc.apply(lodash, arrayPush([value], args));
        return (isTaker && chainAll) ? result[0] : result;
      };

      if (useLazy && checkIteratee && typeof iteratee == 'function' && iteratee.length != 1) {
        // Avoid lazy use if the iteratee has a "length" value other than `1`.
        isLazy = useLazy = false;
      }
      var chainAll = this.__chain__,
          isHybrid = !!this.__actions__.length,
          isUnwrapped = retUnwrapped && !chainAll,
          onlyLazy = isLazy && !isHybrid;

      if (!retUnwrapped && useLazy) {
        value = onlyLazy ? value : new LazyWrapper(this);
        var result = func.apply(value, args);
        result.__actions__.push({ 'func': thru, 'args': [interceptor], 'thisArg': undefined });
        return new LodashWrapper(result, chainAll);
      }
      if (isUnwrapped && onlyLazy) {
        return func.apply(this, args);
      }
      result = this.thru(interceptor);
      return isUnwrapped ? (isTaker ? result.value()[0] : result.value()) : result;
    };
  });

  // Add `Array` methods to `lodash.prototype`.
  arrayEach(['pop', 'push', 'shift', 'sort', 'splice', 'unshift'], function(methodName) {
    var func = arrayProto[methodName],
        chainName = /^(?:push|sort|unshift)$/.test(methodName) ? 'tap' : 'thru',
        retUnwrapped = /^(?:pop|shift)$/.test(methodName);

    lodash.prototype[methodName] = function() {
      var args = arguments;
      if (retUnwrapped && !this.__chain__) {
        var value = this.value();
        return func.apply(isArray(value) ? value : [], args);
      }
      return this[chainName](function(value) {
        return func.apply(isArray(value) ? value : [], args);
      });
    };
  });

  // Map minified method names to their real names.
  baseForOwn(LazyWrapper.prototype, function(func, methodName) {
    var lodashFunc = lodash[methodName];
    if (lodashFunc) {
      var key = (lodashFunc.name + ''),
          names = realNames[key] || (realNames[key] = []);

      names.push({ 'name': methodName, 'func': lodashFunc });
    }
  });

  realNames[createHybrid(undefined, WRAP_BIND_KEY_FLAG).name] = [{
    'name': 'wrapper',
    'func': undefined
  }];

  // Add methods to `LazyWrapper`.
  LazyWrapper.prototype.clone = lazyClone;
  LazyWrapper.prototype.reverse = lazyReverse;
  LazyWrapper.prototype.value = lazyValue;

  // Add lazy aliases.
  lodash.prototype.first = lodash.prototype.head;

  if (symIterator) {
    lodash.prototype[symIterator] = wrapperToIterator;
  }

  /*--------------------------------------------------------------------------*/

  // Some AMD build optimizers, like r.js, check for condition patterns like:
  if (typeof define == 'function' && typeof define.amd == 'object' && define.amd) {
    // Expose Lodash on the global object to prevent errors when Lodash is
    // loaded by a script tag in the presence of an AMD loader.
    // See http://requirejs.org/docs/errors.html#mismatch for more details.
    // Use `_.noConflict` to remove Lodash from the global object.
    root._ = lodash;

    // Define as an anonymous module so, through path mapping, it can be
    // referenced as the "underscore" module.
    define(function() {
      return lodash;
    });
  }
  // Check for `exports` after `define` in case a build optimizer adds it.
  else if (freeModule) {
    // Export for Node.js.
    (freeModule.exports = lodash)._ = lodash;
    // Export for CommonJS support.
    freeExports._ = lodash;
  }
  else {
    // Export to the global object.
    root._ = lodash;
  }
}.call(this));
/**
 * Created by richie on 15/7/8.
 */
/**
 * 初始化BI对象
 */
if (window.BI == null) {
    window.BI = {};
}/**
 * 基本函数
 * Create By GUY 2014\11\17
 *
 */

if (!window.BI) {
    window.BI = {};
}

!(function (undefined) {
    var traverse = function (func, context) {
        return function (value, key, obj) {
            return func.call(context, key, value, obj);
        };
    };
    var _apply = function (name) {
        return function () {
            return _[name].apply(_, arguments);
        };
    };
    var _applyFunc = function (name) {
        return function () {
            var args = Array.prototype.slice.call(arguments, 0);
            args[1] = _.isFunction(args[1]) ? traverse(args[1], args[2]) : args[1];
            return _[name].apply(_, args);
        };
    };

    // Utility
    _.extend(BI, {
        i18nText: function (key) {
            var localeText = (BI.i18n && BI.i18n[key]) || "";
            if (!localeText) {
                localeText = key;
            }
            var len = arguments.length;
            if (len > 1) {
                for (var i = 1; i < len; i++) {
                    var key = "{R" + i + "}";
                    localeText = localeText.replaceAll(key, arguments[i] + "");
                }
            }
            return localeText;
        },

        assert: function (v, is) {
            if (this.isFunction(is)) {
                if (!is(v)) {
                    throw new Error(v + " error");
                } else {
                    return true;
                }
            }
            if (!this.isArray(is)) {
                is = [is];
            }
            if (!this.deepContains(is, v)) {
                throw new Error(v + " error");
            }
        },

        warn: function (message) {
            console.warn(message);
        },

        UUID: function () {
            var f = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"];
            var str = "";
            for (var i = 0; i < 16; i++) {
                var r = parseInt(f.length * Math.random(), 10);
                str += f[r];
            }
            return str;
        },

        isWidget: function (widget) {
            return widget instanceof BI.Widget || (BI.View && widget instanceof BI.View);
        },

        createWidgets: function (items, options, context) {
            if (!BI.isArray(items)) {
                throw new Error("cannot create Widgets");
            }
            if (BI.isWidget(options)) {
                context = options;
                options = {};
            } else {
                options || (options = {});
            }
            return BI.map(BI.flatten(items), function (i, item) {
                return BI.createWidget(item, BI.deepClone(options));
            });
        },

        createItems: function (data, innerAttr, outerAttr) {
            innerAttr = BI.isArray(innerAttr) ? innerAttr : BI.makeArray(BI.flatten(data).length, innerAttr);
            outerAttr = BI.isArray(outerAttr) ? outerAttr : BI.makeArray(BI.flatten(data).length, outerAttr);
            return BI.map(data, function (i, item) {
                if (BI.isArray(item)) {
                    return BI.createItems(item, innerAttr, outerAttr);
                }
                if (item instanceof BI.Widget) {
                    return BI.extend({}, innerAttr.shift(), outerAttr.shift(), {
                        type: null,
                        el: item
                    });
                }
                if (innerAttr[0] instanceof BI.Widget) {
                    outerAttr.shift();
                    return BI.extend({}, item, {
                        el: innerAttr.shift()
                    });
                }
                if (item.el instanceof BI.Widget || (BI.View && item.el instanceof BI.View)) {
                    innerAttr.shift();
                    return BI.extend({}, outerAttr.shift(), {type: null}, item);
                }
                if (item.el) {
                    return BI.extend({}, outerAttr.shift(), item, {
                        el: BI.extend({}, innerAttr.shift(), item.el)
                    });
                }
                return BI.extend({}, outerAttr.shift(), {
                    el: BI.extend({}, innerAttr.shift(), item)
                });
            });
        },

        // 用容器包装items
        packageItems: function (items, layouts) {
            for (var i = layouts.length - 1; i >= 0; i--) {
                items = BI.map(items, function (k, it) {
                    return BI.extend({}, layouts[i], {
                        items: [
                            BI.extend({}, layouts[i].el, {
                                el: it
                            })
                        ]
                    });
                });
            }
            return items;
        },

        formatEL: function (obj) {
            if (obj && !obj.type && obj.el) {
                return obj;
            }
            return {
                el: obj
            };
        },

        // 剥开EL
        stripEL: function (obj) {
            return obj.type && obj || obj.el || obj;
        },

        trans2Element: function (widgets) {
            return BI.map(widgets, function (i, wi) {
                return wi.element;
            });
        }
    });

    // 集合相关方法
    _.each(["where", "findWhere", "invoke", "pluck", "shuffle", "sample", "toArray", "size"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["get", "each", "map", "reduce", "reduceRight", "find", "filter", "reject", "every", "all", "some", "any", "max", "min",
        "sortBy", "groupBy", "indexBy", "countBy", "partition", "clamp"], function (name) {
        if (name === "any") {
            BI[name] = _applyFunc("some");
        } else {
            BI[name] = _applyFunc(name);
        }
    });
    _.extend(BI, {
        // 数数
        count: function (from, to, predicate) {
            var t;
            if (predicate) {
                for (t = from; t < to; t++) {
                    predicate(t);
                }
            }
            return to - from;
        },

        // 倒数
        inverse: function (from, to, predicate) {
            return BI.count(to, from, predicate);
        },

        firstKey: function (obj) {
            var res = undefined;
            BI.any(obj, function (key, value) {
                res = key;
                return true;
            });
            return res;
        },

        lastKey: function (obj) {
            var res = undefined;
            BI.each(obj, function (key, value) {
                res = key;
                return true;
            });
            return res;
        },

        firstObject: function (obj) {
            var res = undefined;
            BI.any(obj, function (key, value) {
                res = value;
                return true;
            });
            return res;
        },

        lastObject: function (obj) {
            var res = undefined;
            BI.each(obj, function (key, value) {
                res = value;
                return true;
            });
            return res;
        },

        concat: function (obj1, obj2) {
            if (BI.isKey(obj1)) {
                return obj1 + "" + obj2;
            }
            if (BI.isArray(obj1)) {
                return obj1.concat(obj2);
            }
            if (BI.isObject(obj1)) {
                return _.extend({}, obj1, obj2);
            }
        },

        backEach: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                predicate(index, obj[index], obj);
            }
            return false;
        },

        backAny: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                if (predicate(index, obj[index], obj)) {
                    return true;
                }
            }
            return false;
        },

        backEvery: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            for (var index = obj.length - 1; index >= 0; index--) {
                if (!predicate(index, obj[index], obj)) {
                    return false;
                }
            }
            return true;
        },

        backFindKey: function (obj, predicate, context) {
            predicate = BI.iteratee(predicate, context);
            var keys = _.keys(obj), key;
            for (var i = keys.length - 1; i >= 0; i--) {
                key = keys[i];
                if (predicate(obj[key], key, obj)) {
                    return key;
                }
            }
        },

        backFind: function (obj, predicate, context) {
            var key;
            if (BI.isArray(obj)) {
                key = BI.findLastIndex(obj, predicate, context);
            } else {
                key = BI.backFindKey(obj, predicate, context);
            }
            if (key !== void 0 && key !== -1) {
                return obj[key];
            }
        },

        remove: function (obj, target, context) {
            var isFunction = BI.isFunction(target);
            target = isFunction || BI.isArray(target) ? target : [target];
            var i;
            if (BI.isArray(obj)) {
                for (i = 0; i < obj.length; i++) {
                    if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) {
                        obj.splice(i--, 1);
                    }
                }
            } else {
                BI.each(obj, function (i, v) {
                    if ((isFunction && target.apply(context, [i, obj[i]]) === true) || (!isFunction && target.contains(obj[i]))) {
                        delete obj[i];
                    }
                });
            }
        },

        removeAt: function (obj, index) {
            index = BI.isArray(index) ? index : [index];
            var isArray = BI.isArray(obj), i;
            for (i = 0; i < index.length; i++) {
                if (isArray) {
                    obj[index[i]] = "$deleteIndex";
                } else {
                    delete obj[index[i]];
                }
            }
            if (isArray) {
                BI.remove(obj, "$deleteIndex");
            }
        },

        string2Array: function (str) {
            return str.split("&-&");
        },

        array2String: function (array) {
            return array.join("&-&");
        },

        abc2Int: function (str) {
            var idx = 0, start = "A", str = str.toUpperCase();
            for (var i = 0, len = str.length; i < len; ++i) {
                idx = str.charAt(i).charCodeAt(0) - start.charCodeAt(0) + 26 * idx + 1;
                if (idx > (2147483646 - str.charAt(i).charCodeAt(0) + start.charCodeAt(0)) / 26) {
                    return 0;
                }
            }
            return idx;
        },

        int2Abc: function (num) {
            var DIGITS = ["A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z"];
            var idx = num, str = "";
            if (num === 0) {
                return "";
            }
            while (idx !== 0) {
                var t = idx % 26;
                if (t === 0) {
                    t = 26;
                }
                str = DIGITS[t - 1] + str;
                idx = (idx - t) / 26;
            }
            return str;
        }
    });

    // 数组相关的方法
    _.each(["first", "initial", "last", "rest", "compact", "flatten", "without", "union", "intersection",
        "difference", "zip", "unzip", "object", "indexOf", "lastIndexOf", "sortedIndex", "range", "take", "takeRight"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["findIndex", "findLastIndex"], function (name) {
        BI[name] = _applyFunc(name);
    });
    _.extend(BI, {
        // 构建一个长度为length的数组
        makeArray: function (length, value) {
            var res = [];
            for (var i = 0; i < length; i++) {
                if (BI.isNull(value)) {
                    res.push(i);
                } else {
                    res.push(BI.deepClone(value));
                }
            }
            return res;
        },

        makeObject: function (array, value) {
            var map = {};
            for (var i = 0; i < array.length; i++) {
                if (BI.isNull(value)) {
                    map[array[i]] = array[i];
                } else {
                    map[array[i]] = BI.deepClone(value);
                }
            }
            return map;
        },

        makeArrayByArray: function (array, value) {
            var res = [];
            if (!array) {
                return res;
            }
            for (var i = 0, len = array.length; i < len; i++) {
                if (BI.isArray(array[i])) {
                    res.push(arguments.callee(array[i], value));
                } else {
                    res.push(BI.deepClone(value));
                }
            }
            return res;
        },

        uniq: function (array, isSorted, iteratee, context) {
            if (array == null) {
                return [];
            }
            if (!_.isBoolean(isSorted)) {
                context = iteratee;
                iteratee = isSorted;
                isSorted = false;
            }
            iteratee && (iteratee = traverse(iteratee, context));
            return _.uniq.call(_, array, isSorted, iteratee, context);
        }
    });

    // 对象相关方法
    _.each(["keys", "allKeys", "values", "pairs", "invert", "create", "functions", "extend", "extendOwn",
        "defaults", "clone", "property", "propertyOf", "matcher", "isEqual", "isMatch", "isEmpty",
        "isElement", "isNumber", "isString", "isArray", "isObject", "isPlainObject", "isArguments", "isFunction", "isFinite",
        "isBoolean", "isDate", "isRegExp", "isError", "isNaN", "isUndefined", "zipObject", "cloneDeep"], function (name) {
        BI[name] = _apply(name);
    });
    _.each(["mapObject", "findKey", "pick", "omit", "tap"], function (name) {
        BI[name] = _applyFunc(name);
    });
    _.extend(BI, {

        inherit: function (sb, sp, overrides) {
            if (typeof sp === "object") {
                overrides = sp;
                sp = sb;
                sb = function () {
                    return sp.apply(this, arguments);
                };
            }
            var F = function () {
            }, spp = sp.prototype;
            F.prototype = spp;
            sb.prototype = new F();
            sb.superclass = spp;
            _.extend(sb.prototype, overrides, {
                superclass: sp
            });
            return sb;
        },

        has: function (obj, keys) {
            if (BI.isArray(keys)) {
                if (keys.length === 0) {
                    return false;
                }
                return BI.every(keys, function (i, key) {
                    return _.has(obj, key);
                });
            }
            return _.has.apply(_, arguments);
        },

        // 数字和字符串可以作为key
        isKey: function (key) {
            return BI.isNumber(key) || (BI.isString(key) && key.length > 0);
        },

        // 忽略大小写的等于
        isCapitalEqual: function (a, b) {
            a = BI.isNull(a) ? a : ("" + a).toLowerCase();
            b = BI.isNull(b) ? b : ("" + b).toLowerCase();
            return BI.isEqual(a, b);
        },

        isWidthOrHeight: function (w) {
            if (typeof w === "number") {
                return w >= 0;
            } else if (typeof w === "string") {
                return /^\d{1,3}%$/.exec(w) || w == "auto" || /^\d+px$/.exec(w);
            }
        },

        isNotNull: function (obj) {
            return !BI.isNull(obj);
        },

        isNull: function (obj) {
            return typeof  obj === "undefined" || obj === null;
        },

        isEmptyArray: function (arr) {
            return BI.isArray(arr) && BI.isEmpty(arr);
        },

        isNotEmptyArray: function (arr) {
            return BI.isArray(arr) && !BI.isEmpty(arr);
        },

        isEmptyObject: function (obj) {
            return BI.isEqual(obj, {});
        },

        isNotEmptyObject: function (obj) {
            return BI.isPlainObject(obj) && !BI.isEmptyObject(obj);
        },

        isEmptyString: function (obj) {
            return BI.isString(obj) && obj.length === 0;
        },

        isNotEmptyString: function (obj) {
            return BI.isString(obj) && !BI.isEmptyString(obj);
        },

        isWindow: function () {
            return $.isWindow.apply($, arguments);
        }
    });

    // deep方法
    _.extend(BI, {
        deepClone: _.cloneDeep,

        isDeepMatch: function (object, attrs) {
            var keys = BI.keys(attrs), length = keys.length;
            if (object == null) {
                return !length;
            }
            var obj = Object(object);
            for (var i = 0; i < length; i++) {
                var key = keys[i];
                if (!BI.isEqual(attrs[key], obj[key]) || !(key in obj)) {
                    return false;
                }
            }
            return true;
        },

        contains: function (obj, target, fromIndex) {
            if (!_.isArrayLike(obj)) obj = _.values(obj);
            return _.indexOf(obj, target, typeof fromIndex === "number" && fromIndex) >= 0;
        },

        deepContains: function (obj, copy) {
            if (BI.isObject(copy)) {
                return BI.any(obj, function (i, v) {
                    if (BI.isEqual(v, copy)) {
                        return true;
                    }
                });
            }
            return BI.contains(obj, copy);
        },

        deepIndexOf: function (obj, target) {
            for (var i = 0; i < obj.length; i++) {
                if (BI.isEqual(target, obj[i])) {
                    return i;
                }
            }
            return -1;
        },

        deepRemove: function (obj, target) {
            var done = false;
            var i;
            if (BI.isArray(obj)) {
                for (i = 0; i < obj.length; i++) {
                    if (BI.isEqual(target, obj[i])) {
                        obj.splice(i--, 1);
                        done = true;
                    }
                }
            } else {
                BI.each(obj, function (i, v) {
                    if (BI.isEqual(target, obj[i])) {
                        delete obj[i];
                        done = true;
                    }
                });
            }
            return done;
        },

        deepWithout: function (obj, target) {
            if (BI.isArray(obj)) {
                var result = [];
                for (var i = 0; i < obj.length; i++) {
                    if (!BI.isEqual(target, obj[i])) {
                        result.push(obj[i]);
                    }
                }
                return result;
            }
            var result = {};
            BI.each(obj, function (i, v) {
                if (!BI.isEqual(target, obj[i])) {
                    result[i] = v;
                }
            });
            return result;

        },

        deepUnique: function (array) {
            var result = [];
            BI.each(array, function (i, item) {
                if (!BI.deepContains(result, item)) {
                    result.push(item);
                }
            });
            return result;
        },

        // 比较两个对象得出不一样的key值
        deepDiff: function (object, other) {
            object || (object = {});
            other || (other = {});
            var result = [];
            var used = [];
            for (var b in object) {
                if (this.has(object, b)) {
                    if (!this.isEqual(object[b], other[b])) {
                        result.push(b);
                    }
                    used.push(b);
                }
            }
            for (var b in other) {
                if (this.has(other, b) && !used.contains(b)) {
                    result.push(b);
                }
            }
            return result;
        },

        deepExtend: function () {
            var args = [].slice.call(arguments);
            args.unshift(true);
            return $.extend.apply($, args);
        }
    });

    // 通用方法
    _.each(["uniqueId", "result", "chain", "iteratee", "escape", "unescape"], function (name) {
        BI[name] = function () {
            return _[name].apply(_, arguments);
        };
    });

    // 事件相关方法
    _.each(["bind", "once", "partial", "debounce", "throttle", "delay", "defer", "wrap"], function (name) {
        BI[name] = function () {
            return _[name].apply(_, arguments);
        };
    });

    _.extend(BI, {
        nextTick: (function () {
            var callbacks = [];
            var pending = false;
            var timerFunc;

            function nextTickHandler () {
                pending = false;
                var copies = callbacks.slice(0);
                callbacks = [];
                for (var i = 0; i < copies.length; i++) {
                    copies[i]();
                }
            }

            if (typeof Promise !== "undefined") {
                var p = Promise.resolve();
                timerFunc = function () {
                    p.then(nextTickHandler);
                };
            } else

            /* istanbul ignore if */
            if (typeof MutationObserver !== "undefined") {
                var counter = 1;
                var observer = new MutationObserver(nextTickHandler);
                var textNode = document.createTextNode(counter + "");
                observer.observe(textNode, {
                    characterData: true
                });
                timerFunc = function () {
                    counter = (counter + 1) % 2;
                    textNode.data = counter + "";
                };
            } else {
                timerFunc = function () {
                    setTimeout(nextTickHandler, 0);
                };
            }
            return function queueNextTick (cb) {
                var _resolve;
                var args = [].slice.call(arguments, 1);
                callbacks.push(function () {
                    if (cb) {
                        cb.apply(null, args);
                    }
                    if (_resolve) {
                        _resolve.apply(null, args);
                    }
                });
                if (!pending) {
                    pending = true;
                    timerFunc();
                }
                if (!cb && typeof Promise !== "undefined") {
                    return new Promise(function (resolve) {
                        _resolve = resolve;
                    });
                }
            };
        })()
    });

    // 数字相关方法
    _.each(["random"], function (name) {
        BI[name] = _apply(name);
    });
    _.extend(BI, {
        getTime: function () {
            if (window.performance && window.performance.now) {
                return window.performance.now();
            }
            if (window.performance && window.performance.webkitNow) {
                return window.performance.webkitNow();
            }
            if (Date.now) {
                return Date.now();
            }
            return BI.getDate().getTime();


        },

        parseInt: function (number) {
            var radix = 10;
            if (/^0x/g.test(number)) {
                radix = 16;
            }
            try {
                return parseInt(number, radix);
            } catch (e) {
                throw new Error(number + "parse int error");
                return NaN;
            }
        },

        parseSafeInt: function (value) {
            var MAX_SAFE_INTEGER = 9007199254740991;
            return value
                ? this.clamp(this.parseInt(value), -MAX_SAFE_INTEGER, MAX_SAFE_INTEGER)
                : (value === 0 ? value : 0);
        },

        parseFloat: function (number) {
            try {
                return parseFloat(number);
            } catch (e) {
                throw new Error(number + "parse float error");
                return NaN;
            }
        },

        isNaturalNumber: function (number) {
            if (/^\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isPositiveInteger: function (number) {
            if (/^\+?[1-9][0-9]*$/.test(number)) {
                return true;
            }
            return false;
        },

        isNegativeInteger: function (number) {
            if (/^\-[1-9][0-9]*$/.test(number)) {
                return true;
            }
            return false;
        },

        isInteger: function (number) {
            if (/^\-?\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isNumeric: function (number) {
            return $.isNumeric(number);
        },

        isFloat: function (number) {
            if (/^([+-]?)\\d*\\.\\d+$/.test(number)) {
                return true;
            }
            return false;
        },

        isOdd: function (number) {
            if (!BI.isInteger(number)) {
                return false;
            }
            return number & 1 === 1;
        },

        isEven: function (number) {
            if (!BI.isInteger(number)) {
                return false;
            }
            return number & 1 === 0;
        },

        sum: function (array, iteratee, context) {
            var sum = 0;
            BI.each(array, function (i, item) {
                if (iteratee) {
                    sum += Number(iteratee.apply(context, [i, item]));
                } else {
                    sum += Number(item);
                }
            });
            return sum;
        },

        average: function (array, iteratee, context) {
            var sum = BI.sum(array, iteratee, context);
            return sum / array.length;
        }
    });

    // 字符串相关方法
    _.extend(BI, {
        trim: function () {
            return $.trim.apply($, arguments);
        },

        toUpperCase: function (string) {
            return (string + "").toLocaleUpperCase();
        },

        toLowerCase: function (string) {
            return (string + "").toLocaleLowerCase();
        },

        isEndWithBlank: function (string) {
            return /(\s|\u00A0)$/.test(string);
        },

        isLiteral: function (exp) {
            var literalValueRE = /^\s?(true|false|-?[\d\.]+|'[^']*'|"[^"]*")\s?$/;
            return literalValueRE.test(exp);
        },

        stripQuotes: function (str) {
            var a = str.charCodeAt(0);
            var b = str.charCodeAt(str.length - 1);
            return a === b && (a === 0x22 || a === 0x27)
                ? str.slice(1, -1)
                : str;
        },

        // background-color => backgroundColor
        camelize: function (str) {
            return str.replace(/-(.)/g, function (_, character) {
                return character.toUpperCase();
            });
        },

        // backgroundColor => background-color
        hyphenate: function (str) {
            return str.replace(/([A-Z])/g, "-$1").toLowerCase();
        },

        isNotEmptyString: function (str) {
            return BI.isString(str) && !BI.isEmpty(str);
        },

        isEmptyString: function (str) {
            return BI.isString(str) && BI.isEmpty(str);
        },

        /**
         * 对字符串进行加密 {@link #decrypt}
         * @static
         * @param str 原始字符�?
         * @param keyt 密钥
         * @returns {String} 加密后的字符�?
         */
        encrypt: function (str, keyt) {
            if (str == "") {
                return "";
            }
            str = escape(str);
            if (!keyt || keyt == "") {
                keyt = "655";
            }
            keyt = escape(keyt);
            if (keyt == null || keyt.length <= 0) {
                alert("Please enter a password with which to encrypt the message.");
                return null;
            }
            var prand = "";
            for (var i = 0; i < keyt.length; i++) {
                prand += keyt.charCodeAt(i).toString();
            }
            var sPos = Math.floor(prand.length / 5);
            var mult = parseInt(prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4) + prand.charAt(sPos * 5));

            var incr = Math.ceil(keyt.length / 2);
            var modu = Math.pow(2, 31) - 1;
            if (mult < 2) {
                alert("Algorithm cannot find a suitable hash. Please choose a different password. \nPossible considerations are to choose a more complex or longer password.");
                return null;
            }
            //        var salt = Math.round(Math.random() * 1000000000) % 100000000;
            var salt = 101;
            prand += salt;
            while (prand.length > 10) {
                prand = (parseInt(prand.substring(0, 10)) + parseInt(prand.substring(10, prand.length), 10)).toString();
            }
            prand = (mult * prand + incr) % modu;
            var enc_chr = "";
            var enc_str = "";
            for (var i = 0; i < str.length; i++) {
                enc_chr = parseInt(str.charCodeAt(i) ^ Math.floor((prand / modu) * 255));
                if (enc_chr < 16) {
                    enc_str += "0" + enc_chr.toString(16);
                } else {
                    enc_str += enc_chr.toString(16);
                }
                prand = (mult * prand + incr) % modu;
            }
            salt = salt.toString(16);
            while (salt.length < 8) {
                salt = "0" + salt;
            }
            enc_str += salt;
            return enc_str;
        },

        /**
         * 对加密后的字符串解密 {@link #encrypt}
         * @static
         * @param str 加密过的字符�?
         * @param keyt 密钥
         * @returns {String} 解密后的字符�?
         */
        decrypt: function (str, keyt) {
            if (str == "") {
                return "";
            }
            if (!keyt || keyt == "") {
                keyt = "655";
            }
            keyt = escape(keyt);
            if (str == null || str.length < 8) {
                return;
            }
            if (keyt == null || keyt.length <= 0) {
                return;
            }
            var prand = "";
            for (var i = 0; i < keyt.length; i++) {
                prand += keyt.charCodeAt(i).toString();
            }
            var sPos = Math.floor(prand.length / 5);
            var tempmult = prand.charAt(sPos) + prand.charAt(sPos * 2) + prand.charAt(sPos * 3) + prand.charAt(sPos * 4);
            if (sPos * 5 < prand.length) {
                tempmult += prand.charAt(sPos * 5);
            }
            var mult = parseInt(tempmult);
            var incr = Math.round(keyt.length / 2);
            var modu = Math.pow(2, 31) - 1;
            var salt = parseInt(str.substring(str.length - 8, str.length), 16);
            str = str.substring(0, str.length - 8);
            prand += salt;
            while (prand.length > 10) {
                prand = (parseInt(prand.substring(0, 10), 10) + parseInt(prand.substring(10, prand.length), 10)).toString();
            }
            prand = (mult * prand + incr) % modu;
            var enc_chr = "";
            var enc_str = "";
            for (var i = 0; i < str.length; i += 2) {
                enc_chr = parseInt(parseInt(str.substring(i, i + 2), 16) ^ Math.floor((prand / modu) * 255));
                enc_str += String.fromCharCode(enc_chr);
                prand = (mult * prand + incr) % modu;
            }
            return unescape(enc_str);
        },

        /**
         * 对字符串中的'和\做编码处理
         * @static
         * @param {String} string 要做编码处理的字符串
         * @return {String} 编码后的字符串
         */
        escape: function (string) {
            return string.replace(/('|\\)/g, "\\$1");
        },

        /**
         * 让字符串通过指定字符做补齐的函数
         *
         *      var s = BI.leftPad('123', 5, '0');//s的值为:'00123'
         *
         * @static
         * @param {String} val 原始值
         * @param {Number} size 总共需要的位数
         * @param {String} ch 用于补齐的字符
         * @return {String}  补齐后的字符串
         */
        leftPad: function (val, size, ch) {
            var result = String(val);
            if (!ch) {
                ch = " ";
            }
            while (result.length < size) {
                result = ch + result;
            }
            return result.toString();
        },

        /**
         * 对字符串做替换的函数
         *
         *      var cls = 'my-class', text = 'Some text';
         *      var res = BI.format('<div class="{0}>{1}</div>"', cls, text);
         *      //res的值为:'<div class="my-class">Some text</div>';
         *
         * @static
         * @param {String} format 要做替换的字符串,替换字符串1,替换字符串2...
         * @return {String} 做了替换后的字符串
         */
        format: function (format) {
            var args = Array.prototype.slice.call(arguments, 1);
            return format.replace(/\{(\d+)\}/g, function (m, i) {
                return args[i];
            });
        }
    });

    // 日期相关方法
    _.extend(BI, {
        /**
         * 是否是闰年
         * @param year
         * @returns {boolean}
         */
        isLeapYear: function (year) {
            return (year % 4 === 0 && year % 100 !== 0) || year % 400 === 0;
        },

        /**
         * 检测是否在有效期
         *
         * @param YY 年
         * @param MM 月
         * @param DD 日
         * @param minDate '1900-01-01'
         * @param maxDate '2099-12-31'
         * @returns {Array} 若无效返回无效状态
         */
        checkDateVoid: function (YY, MM, DD, minDate, maxDate) {
            var back = [];
            YY = YY | 0;
            MM = MM | 0;
            DD = DD | 0;
            minDate = BI.isString(minDate) ? minDate.match(/\d+/g) : minDate;
            maxDate = BI.isString(maxDate) ? maxDate.match(/\d+/g) : maxDate;
            if (YY < minDate[0]) {
                back = ["y"];
            } else if (YY > maxDate[0]) {
                back = ["y", 1];
            } else if (YY >= minDate[0] && YY <= maxDate[0]) {
                if (YY == minDate[0]) {
                    if (MM < minDate[1]) {
                        back = ["m"];
                    } else if (MM == minDate[1]) {
                        if (DD < minDate[2]) {
                            back = ["d"];
                        }
                    }
                }
                if (YY == maxDate[0]) {
                    if (MM > maxDate[1]) {
                        back = ["m", 1];
                    } else if (MM == maxDate[1]) {
                        if (DD > maxDate[2]) {
                            back = ["d", 1];
                        }
                    }
                }
            }
            return back;
        },

        checkDateLegal: function (str) {
            var ar = str.match(/\d+/g);
            var YY = ar[0] | 0, MM = ar[1] | 0, DD = ar[2] | 0;
            if (ar.length <= 1) {
                return true;
            }
            if (ar.length <= 2) {
                return MM >= 1 && MM <= 12;
            }
            var MD = Date._MD.slice(0);
            MD[1] = BI.isLeapYear(YY) ? 29 : 28;
            return MM >= 1 && MM <= 12 && DD <= MD[MM - 1];
        },

        parseDateTime: function (str, fmt) {
            var today = BI.getDate();
            var y = 0;
            var m = 0;
            var d = 1;
            // wei : 对于fmt为‘YYYYMM’或者‘YYYYMMdd’的格式,str的值为类似'201111'的形式,因为年月之间没有分隔符,所以正则表达式分割无效,导致bug7376。
            var a = str.split(/\W+/);
            if (fmt.toLowerCase() == "%y%x" || fmt.toLowerCase() == "%y%x%d") {
                var yearlength = 4;
                var otherlength = 2;
                a[0] = str.substring(0, yearlength);
                a[1] = str.substring(yearlength, yearlength + otherlength);
                a[2] = str.substring(yearlength + otherlength, yearlength + otherlength * 2);
            }
            var b = fmt.match(/%./g);
            var i = 0, j = 0;
            var hr = 0;
            var min = 0;
            var sec = 0;
            for (i = 0; i < a.length; ++i) {
                switch (b[i]) {
                    case "%d":
                    case "%e":
                        d = parseInt(a[i], 10);
                        break;

                    case "%X":
                        m = parseInt(a[i], 10) - 1;
                        break;
                    case "%x":
                        m = parseInt(a[i], 10) - 1;
                        break;

                    case "%Y":
                    case "%y":
                        y = parseInt(a[i], 10);
                        (y < 100) && (y += (y > 29) ? 1900 : 2000);
                        break;

                    case "%b":
                    case "%B":
                        for (j = 0; j < 12; ++j) {
                            if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) {
                                m = j;
                                break;
                            }
                        }
                        break;

                    case "%H":
                    case "%I":
                    case "%k":
                    case "%l":
                        hr = parseInt(a[i], 10);
                        break;

                    case "%P":
                    case "%p":
                        if (/pm/i.test(a[i]) && hr < 12) {
                            hr += 12;
                        } else if (/am/i.test(a[i]) && hr >= 12) {
                            hr -= 12;
                        }
                        break;

                    case "%M":
                        min = parseInt(a[i], 10);
                    case "%S":
                        sec = parseInt(a[i], 10);
                        break;
                }
            }
            //    if (!a[i]) {
            //        continue;
            //	}
            if (isNaN(y)) {
                y = today.getFullYear();
            }
            if (isNaN(m)) {
                m = today.getMonth();
            }
            if (isNaN(d)) {
                d = today.getDate();
            }
            if (isNaN(hr)) {
                hr = today.getHours();
            }
            if (isNaN(min)) {
                min = today.getMinutes();
            }
            if (isNaN(sec)) {
                sec = today.getSeconds();
            }
            if (y != 0) {
                return BI.getDate(y, m, d, hr, min, sec);
            }
            y = 0;
            m = -1;
            d = 0;
            for (i = 0; i < a.length; ++i) {
                if (a[i].search(/[a-zA-Z]+/) != -1) {
                    var t = -1;
                    for (j = 0; j < 12; ++j) {
                        if (Date._MN[j].substr(0, a[i].length).toLowerCase() == a[i].toLowerCase()) {
                            t = j;
                            break;
                        }
                    }
                    if (t != -1) {
                        if (m != -1) {
                            d = m + 1;
                        }
                        m = t;
                    }
                } else if (parseInt(a[i], 10) <= 12 && m == -1) {
                    m = a[i] - 1;
                } else if (parseInt(a[i], 10) > 31 && y == 0) {
                    y = parseInt(a[i], 10);
                    (y < 100) && (y += (y > 29) ? 1900 : 2000);
                } else if (d == 0) {
                    d = a[i];
                }
            }
            if (y == 0) {
                y = today.getFullYear();
            }
            if (m != -1 && d != 0) {
                return BI.getDate(y, m, d, hr, min, sec);
            }
            return today;
        },

        getDate: function () {
            var length = arguments.length;
            var args = arguments;
            var dt;
            switch (length) {
                // new Date()
                case 0:
                    dt = new Date();
                    break;
                // new Date(long)
                case 1:
                    dt = new Date(args[0]);
                    break;
                // new Date(year, month)
                case 2:
                    dt = new Date(args[0], args[1]);
                    break;
                // new Date(year, month, day)
                case 3:
                    dt = new Date(args[0], args[1], args[2]);
                    break;
                // new Date(year, month, day, hour)
                case 4:
                    dt = new Date(args[0], args[1], args[2], args[3]);
                    break;
                // new Date(year, month, day, hour, minute)
                case 5:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4]);
                    break;
                // new Date(year, month, day, hour, minute, second)
                case 6:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]);
                    break;
                // new Date(year, month, day, hour, minute, second, millisecond)
                case 7:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
                    break;
                default:
                    dt = new Date();
                    break;
            }
            if (BI.isNotNull(BI.timeZone) && (arguments.length === 0 || (arguments.length === 1 && BI.isNumber(arguments[0])))) {
                var localTime = dt.getTime();
                var localOffset = dt.getTimezoneOffset() * 60000; // 获得当地时间偏移的毫秒数
                var utc = localTime + localOffset; // utc即GMT时间标准时区
                return new Date(utc + BI.timeZone);// + Pool.timeZone.offset);
            }
            return dt;

        },

        getTime: function () {
            var length = arguments.length;
            var args = arguments;
            var dt;
            switch (length) {
                // new Date()
                case 0:
                    dt = new Date();
                    break;
                // new Date(long)
                case 1:
                    dt = new Date(args[0]);
                    break;
                // new Date(year, month)
                case 2:
                    dt = new Date(args[0], args[1]);
                    break;
                // new Date(year, month, day)
                case 3:
                    dt = new Date(args[0], args[1], args[2]);
                    break;
                // new Date(year, month, day, hour)
                case 4:
                    dt = new Date(args[0], args[1], args[2], args[3]);
                    break;
                // new Date(year, month, day, hour, minute)
                case 5:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4]);
                    break;
                // new Date(year, month, day, hour, minute, second)
                case 6:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5]);
                    break;
                // new Date(year, month, day, hour, minute, second, millisecond)
                case 7:
                    dt = new Date(args[0], args[1], args[2], args[3], args[4], args[5], args[6]);
                    break;
                default:
                    dt = new Date();
                    break;
            }
            if (BI.isNotNull(BI.timeZone)) {
                return dt.getTime() - BI.timeZone - dt.getTimezoneOffset() * 60000;
            }
            return dt.getTime();

        }
    });

    // 浏览器相关方法
    _.extend(BI, {
        isIE: function () {
            if (this.__isIE == null) {
                this.__isIE = /(msie|trident)/i.test(navigator.userAgent.toLowerCase());
            }
            return this.__isIE;
        },

        getIEVersion: function () {
            if (this.__IEVersion != null) {
                return this.__IEVersion;
            }
            var version = 0;
            var agent = navigator.userAgent.toLowerCase();
            var v1 = agent.match(/(?:msie\s([\w.]+))/);
            var v2 = agent.match(/(?:trident.*rv:([\w.]+))/);
            if (v1 && v2 && v1[1] && v2[1]) {
                version = Math.max(v1[1] * 1, v2[1] * 1);
            } else if (v1 && v1[1]) {
                version = v1[1] * 1;
            } else if (v2 && v2[1]) {
                version = v2[1] * 1;
            } else {
                version = 0;
            }
            return this.__IEVersion = version;
        },

        isIE9Below: function () {
            if (!BI.isIE()) {
                return false;
            }
            return this.getIEVersion() < 9;
        },

        isEdge: function () {
            return /edge/i.test(navigator.userAgent.toLowerCase());
        },

        isChrome: function () {
            return /chrome/i.test(navigator.userAgent.toLowerCase());
        },

        isFireFox: function () {
            return /firefox/i.test(navigator.userAgent.toLowerCase());
        },

        isOpera: function () {
            return /opera/i.test(navigator.userAgent.toLowerCase());
        },

        isSafari: function () {
            return /safari/i.test(navigator.userAgent.toLowerCase());
        },

        isKhtml: function () {
            return /Konqueror|Safari|KHTML/i.test(navigator.userAgent);
        },

        isMac: function () {
            return /macintosh|mac os x/i.test(navigator.userAgent);
        },

        isWindows: function () {
            return /windows|win32/i.test(navigator.userAgent);
        },

        isSupportCss3: function (style) {
            var prefix = ["webkit", "Moz", "ms", "o"],
                i, len,
                humpString = [],
                htmlStyle = document.documentElement.style,
                _toHumb = function (string) {
                    return string.replace(/-(\w)/g, function ($0, $1) {
                        return $1.toUpperCase();
                    });
                };

            for (i in prefix) {
                humpString.push(_toHumb(prefix[i] + "-" + style));
            }
            humpString.push(_toHumb(style));

            for (i = 0, len = humpString.length; i < len; i++) {
                if (humpString[i] in htmlStyle) {
                    return true;
                }
            }
            return false;
        }
    });
    // BI请求
    _.extend(BI, {

        ajax: function (option) {
            option || (option = {});
            var async = option.async;
            option.data = BI.cjkEncodeDO(option.data || {});

            $.ajax({
                url: option.url,
                type: "POST",
                data: option.data,
                async: async,
                error: option.error,
                complete: function (res, status) {
                    if (BI.isFunction(option.complete)) {
                        option.complete(BI.jsonDecode(res.responseText), status);
                    }
                }
            });
        }
    });
})();/**
 * 客户端观察者,主要处理事件的添加、删除、执行等
 * @class BI.OB
 * @abstract
 */
BI.OB = function (config) {
    var props = this.props;
    if (BI.isFunction(this.props)) {
        props = this.props(config);
    }
    this.options = (window.$ || window._).extend(this._defaultConfig(config), props, config);
    this._init();
    this._initRef();
};
_.extend(BI.OB.prototype, {
    props: {},
    init: null,
    destroyed: null,

    _defaultConfig: function (config) {
        return {};
    },

    _init: function () {
        this._initListeners();
        this.init && this.init();
    },

    _initListeners: function () {
        var self = this;
        if (this.options.listeners != null) {
            _.each(this.options.listeners, function (lis) {
                (lis.target ? lis.target : self)[lis.once ? "once" : "on"]
                (lis.eventName, _.bind(lis.action, self));
            });
            delete this.options.listeners;
        }
    },

    // 获得一个当前对象的引用
    _initRef: function () {
        if (this.options.ref) {
            this.options.ref.call(this, this);
        }
    },

    //释放当前对象
    _purgeRef: function(){
        if (this.options.ref) {
            this.options.ref.call(null);
        }
    },

    _getEvents: function () {
        if (!_.isArray(this.events)) {
            this.events = [];
        }
        return this.events;
    },

    /**
     * 给观察者绑定一个事件
     * @param {String} eventName 事件的名字
     * @param {Function} fn 事件对应的执行函数
     */
    on: function (eventName, fn) {
        eventName = eventName.toLowerCase();
        var fns = this._getEvents()[eventName];
        if (!_.isArray(fns)) {
            fns = [];
            this._getEvents()[eventName] = fns;
        }
        fns.push(fn);
    },

    /**
     * 给观察者绑定一个只执行一次的事件
     * @param {String} eventName 事件的名字
     * @param {Function} fn 事件对应的执行函数
     */
    once: function (eventName, fn) {
        var proxy = function () {
            fn.apply(this, arguments);
            this.un(eventName, proxy);
        };
        this.on(eventName, proxy);
    },
    /**
     * 解除观察者绑定的指定事件
     * @param {String} eventName 要解除绑定事件的名字
     * @param {Function} fn 事件对应的执行函数,该参数是可选的,没有该参数时,将解除绑定所有同名字的事件
     */
    un: function (eventName, fn) {
        eventName = eventName.toLowerCase();

        /* alex:如果fn是null,就是把eventName上面所有方法都un掉*/
        if (fn == null) {
            delete this._getEvents()[eventName];
        } else {
            var fns = this._getEvents()[eventName];
            if (_.isArray(fns)) {
                var newFns = [];
                _.each(fns, function (ifn) {
                    if (ifn != fn) {
                        newFns.push(ifn);
                    }
                });
                this._getEvents()[eventName] = newFns;
            }
        }
    },
    /**
     * 清除观察者的所有事件绑定
     */
    purgeListeners: function () {
        /* alex:清空events*/
        this.events = [];
    },
    /**
     * 触发绑定过的事件
     *
     * @param {String} eventName 要触发的事件的名字
     * @returns {Boolean} 如果事件函数返回false,则返回false并中断其他同名事件的执行,否则执行所有的同名事件并返回true
     */
    fireEvent: function () {
        var eventName = arguments[0].toLowerCase();
        var fns = this._getEvents()[eventName];
        if (BI.isArray(fns)) {
            if (BI.isArguments(arguments[1])) {
                for (var i = 0; i < fns.length; i++) {
                    if (fns[i].apply(this, arguments[1]) === false) {
                        return false;
                    }
                }
            } else {
                var args = Array.prototype.slice.call(arguments, 1);
                for (var i = 0; i < fns.length; i++) {
                    if (fns[i].apply(this, args) === false) {
                        return false;
                    }
                }
            }
        }
        return true;
    },

    destroy: function () {
        this.destroyed && this.destroyed();
        this._purgeRef();
        this.purgeListeners();
    }
});/**
 * Widget超类
 * @class BI.Widget
 * @extends BI.OB
 *
 * @cfg {JSON} options 配置属性
 */
BI.Widget = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.Widget.superclass._defaultConfig.apply(this), {
            root: false,
            tagName: "div",
            attributes: null,
            data: null,

            tag: null,
            disabled: false,
            invisible: false,
            invalid: false,
            baseCls: "",
            extraCls: "",
            cls: ""
        });
    },

    beforeInit: null,

    // 生命周期函数
    beforeCreate: null,

    created: null,

    render: null,

    beforeMount: null,

    mounted: null,

    shouldUpdate: null,

    update: function () {
    },

    beforeDestroy: null,

    destroyed: null,

    _init: function () {
        BI.Widget.superclass._init.apply(this, arguments);
        this._initRoot();
        this._initElementWidth();
        this._initElementHeight();
        this._initVisual();
        this._initState();
        if (this.beforeInit) {
            this.__asking = true;
            this.beforeInit(BI.bind(this._render, this));
            if (this.__asking === true) {
                this.__async = true;
            }
        } else {
            this._render();
        }
    },

    _render: function () {
        this.__asking = false;
        this.beforeCreate && this.beforeCreate();
        this._initElement();
        this._initEffects();
        this.created && this.created();
    },

    /**
     * 初始化根节点
     * @private
     */
    _initRoot: function () {
        var o = this.options;
        this.widgetName = o.widgetName || BI.uniqueId("widget");
        this._isRoot = o.root;
        if (BI.isWidget(o.element)) {
            if (o.element instanceof BI.Widget) {
                this._parent = o.element;
                this._parent.addWidget(this.widgetName, this);
            } else {
                this._isRoot = true;
            }
            this.element = this.options.element.element;
        } else if (o.element) {
            // if (o.root !== true) {
            //     throw new Error("root is a required property");
            // }
            this.element = $(o.element);
            this._isRoot = true;
        } else {
            this.element = $(document.createElement(o.tagName));
        }
        this.element._isWidget = true;
        if (o.baseCls || o.extraCls || o.cls) {
            this.element.addClass((o.baseCls || "") + " " + (o.extraCls || "") + " " + (o.cls || ""));
        }
        if (o.attributes) {
            this.element.attr(o.attributes);
        }
        if (o.data) {
            this.element.data(o.data);
        }
        this._children = {};
    },

    _initElementWidth: function () {
        var o = this.options;
        if (BI.isWidthOrHeight(o.width)) {
            this.element.css("width", o.width);
        }
    },

    _initElementHeight: function () {
        var o = this.options;
        if (BI.isWidthOrHeight(o.height)) {
            this.element.css("height", o.height);
        }
    },

    _initVisual: function () {
        var o = this.options;
        if (o.invisible) {
            // 用display属性做显示和隐藏,否则jquery会在显示时将display设为block会覆盖掉display:flex属性
            this.element.css("display", "none");
        }
    },

    _initEffects: function () {
        var o = this.options;
        if (o.disabled || o.invalid) {
            if (this.options.disabled) {
                this.setEnable(false);
            }
            if (this.options.invalid) {
                this.setValid(false);
            }
        }
    },

    _initState: function () {
        this._isMounted = false;
    },

    _initElement: function () {
        var self = this;
        var els = this.render && this.render();
        if (BI.isPlainObject(els)) {
            els = [els];
        }
        if (BI.isArray(els)) {
            BI.each(els, function (i, el) {
                BI.createWidget(el, {
                    element: self
                });
            });
        }
        // if (this._isRoot === true || !(this instanceof BI.Layout)) {
        this._mount();
        // }
    },

    _setParent: function (parent) {
        this._parent = parent;
    },

    _mount: function () {
        var self = this;
        var isMounted = this._isMounted;
        if (isMounted || !this.isVisible() || this.__asking === true) {
            return;
        }
        if (this._isRoot === true) {
            isMounted = true;
        } else if (this._parent && this._parent._isMounted === true) {
            isMounted = true;
        }
        if (!isMounted) {
            return;
        }
        this.beforeMount && this.beforeMount();
        this._isMounted = true;
        this._mountChildren && this._mountChildren();
        BI.each(this._children, function (i, widget) {
            !self.isEnabled() && widget._setEnable(false);
            !self.isValid() && widget._setValid(false);
            widget._mount && widget._mount();
        });
        this.mounted && this.mounted();
    },

    _mountChildren: null,

    isMounted: function () {
        return this._isMounted;
    },

    setWidth: function (w) {
        this.options.width = w;
        this._initElementWidth();
    },

    setHeight: function (h) {
        this.options.height = h;
        this._initElementHeight();
    },

    _setEnable: function (enable) {
        if (enable === true) {
            this.options.disabled = false;
        } else if (enable === false) {
            this.options.disabled = true;
        }
        // 递归将所有子组件使能
        BI.each(this._children, function (i, child) {
            !child._manualSetEnable && child._setEnable && child._setEnable(enable);
        });
    },

    _setValid: function (valid) {
        if (valid === true) {
            this.options.invalid = false;
        } else if (valid === false) {
            this.options.invalid = true;
        }
        // 递归将所有子组件使有效
        BI.each(this._children, function (i, child) {
            !child._manualSetValid && child._setValid && child._setValid(valid);
        });
    },

    _setVisible: function (visible) {
        if (visible === true) {
            this.options.invisible = false;
        } else if (visible === false) {
            this.options.invisible = true;
        }
    },

    setEnable: function (enable) {
        this._manualSetEnable = true;
        this._setEnable(enable);
        if (enable === true) {
            this.element.removeClass("base-disabled disabled");
        } else if (enable === false) {
            this.element.addClass("base-disabled disabled");
        }
    },

    setVisible: function (visible) {
        this._setVisible(visible);
        if (visible === true) {
            // 用this.element.show()会把display属性改成block
            this.element.css("display", "");
            this._mount();
        } else if (visible === false) {
            this.element.css("display", "none");
        }
        this.fireEvent(BI.Events.VIEW, visible);
    },

    setValid: function (valid) {
        this._manualSetValid = true;
        this._setValid(valid);
        if (valid === true) {
            this.element.removeClass("base-invalid invalid");
        } else if (valid === false) {
            this.element.addClass("base-invalid invalid");
        }
    },

    doBehavior: function () {
        var args = arguments;
        // 递归将所有子组件使有效
        BI.each(this._children, function (i, child) {
            child.doBehavior && child.doBehavior.apply(child, args);
        });
    },

    getWidth: function () {
        return this.options.width;
    },

    getHeight: function () {
        return this.options.height;
    },

    isValid: function () {
        return !this.options.invalid;
    },

    addWidget: function (name, widget) {
        var self = this;
        if (name instanceof BI.Widget) {
            widget = name;
            name = widget.getName();
        }
        if (BI.isKey(name)) {
            name = name + "";
        }
        name = name || widget.getName() || BI.uniqueId("widget");
        if (this._children[name]) {
            throw new Error("name has already been existed");
        }
        widget._setParent && widget._setParent(this);
        widget.on(BI.Events.DESTROY, function () {
            BI.remove(self._children, this);
        });
        return (this._children[name] = widget);
    },

    getWidgetByName: function (name) {
        if (!BI.isKey(name) || name === this.getName()) {
            return this;
        }
        name = name + "";
        var widget = void 0, other = {};
        BI.any(this._children, function (i, wi) {
            if (i === name) {
                widget = wi;
                return true;
            }
            other[i] = wi;
        });
        if (!widget) {
            BI.any(other, function (i, wi) {
                return (widget = wi.getWidgetByName(i));
            });
        }
        return widget;
    },

    removeWidget: function (nameOrWidget) {
        var self = this;
        if (BI.isWidget(nameOrWidget)) {
            BI.remove(this._children, nameOrWidget);
        } else {
            delete this._children[nameOrWidget];
        }
    },

    hasWidget: function (name) {
        return this._children[name] != null;
    },

    getName: function () {
        return this.widgetName;
    },

    setTag: function (tag) {
        this.options.tag = tag;
    },

    getTag: function () {
        return this.options.tag;
    },

    attr: function (key, value) {
        var self = this;
        if (BI.isPlainObject(key)) {
            BI.each(key, function (k, v) {
                self.attr(k, v);
            });
            return;
        }
        if (BI.isNotNull(value)) {
            return this.options[key] = value;
        }
        return this.options[key];
    },

    getText: function () {

    },

    setText: function (text) {

    },

    getValue: function () {

    },

    setValue: function (value) {

    },

    isEnabled: function () {
        return !this.options.disabled;
    },

    isVisible: function () {
        return !this.options.invisible;
    },

    disable: function () {
        this.setEnable(false);
    },

    enable: function () {
        this.setEnable(true);
    },

    valid: function () {
        this.setValid(true);
    },

    invalid: function () {
        this.setValid(false);
    },

    invisible: function () {
        this.setVisible(false);
    },

    visible: function () {
        this.setVisible(true);
    },

    __d: function () {
        this.beforeDestroy && this.beforeDestroy();
        BI.each(this._children, function (i, widget) {
            widget && widget._unMount && widget._unMount();
        });
        this._children = {};
        this._parent = null;
        this._isMounted = false;
        this.destroyed && this.destroyed();
    },

    _unMount: function () {
        this.__d();
        this.fireEvent(BI.Events.UNMOUNT);
        this.purgeListeners();
    },

    isolate: function () {
        if (this._parent) {
            this._parent.removeWidget(this);
        }
        BI.DOM.hang([this]);
    },

    empty: function () {
        BI.each(this._children, function (i, widget) {
            widget && widget._unMount && widget._unMount();
        });
        this._children = {};
        this.element.empty();
    },

    _destroy: function () {
        this.__d();
        this.element.destroy();
        this.purgeListeners();
    },

    destroy: function () {
        this.__d();
        this.element.destroy();
        this.fireEvent(BI.Events.DESTROY);
        this._purgeRef();
        this.purgeListeners();
    }
});(function () {
    var kv = {};
    BI.shortcut = function (xtype, cls) {
        if (kv[xtype] != null) {
            console.error("shortcut:[" + xtype + "] has been registed");
        }
        kv[xtype] = cls;
    };

    // 根据配置属性生成widget
    var createWidget = function (config) {
        if (config["classType"]) {
            return new (new Function("return " + config["classType"] + ";")())(config);
        }

        var cls = kv[config.type];
        return new cls(config);
    };

    BI.createWidget = function (item, options, context) {
        var el, w;
        item || (item = {});
        if (BI.isWidget(options)) {
            context = options;
            options = {};
        } else {
            options || (options = {});
        }
        if (BI.isEmpty(item) && BI.isEmpty(options)) {
            return BI.createWidget({
                type: "bi.layout"
            });
        }
        if (BI.isWidget(item)) {
            return item;
        }
        if (item.type || options.type) {
            el = BI.extend({}, options, item);
            w = BI.Plugin.getWidget(el.type, el);
            return w.type === el.type ? BI.Plugin.getObject(el.type, createWidget(w)) : BI.createWidget(BI.extend({}, item, {type: w.type}, options));
        }
        if (item.el && (item.el.type || options.type)) {
            el = BI.extend({}, options, item.el);
            w = BI.Plugin.getWidget(el.type, el);
            return w.type === el.type ? BI.Plugin.getObject(el.type, createWidget(w)) : BI.createWidget(BI.extend({}, item, {type: w.type}, options));
        }
        if (BI.isWidget(item.el)) {
            return item.el;
        }
        throw new Error("无法根据item创建组件");
    };

})();(function (window, undefined) {
    function aspect (type) {
        return function (target, methodName, advice) {
            var exist = target[methodName],
                dispatcher;

            if (!exist || exist.target != target) {
                dispatcher = target[methodName] = function () {
                    // before methods
                    var beforeArr = dispatcher.before;
                    var args = arguments, next;
                    for (var l = beforeArr.length; l--;) {
                        next = beforeArr[l].advice.apply(this, args);
                        if (next === false) {
                            return false;
                        }
                        args = next || args;
                    }
                    // target method
                    var rs = dispatcher.method.apply(this, args);
                    // after methods
                    var afterArr = dispatcher.after;
                    for (var i = 0, ii = afterArr.length; i < ii; i++) {
                        next = afterArr[i].advice.call(this, rs, args);
                        if (rs === false) {
                            return false;
                        }
                        args = next || args;
                    }
                    return rs;
                };

                dispatcher.before = [];
                dispatcher.after = [];

                if (exist) {
                    dispatcher.method = exist;
                }
                dispatcher.target = target;
            }

            var aspectArr = (dispatcher || exist)[type];
            var obj = {
                advice: advice,
                _index: aspectArr.length,
                remove: function () {
                    aspectArr.splice(this._index, 1);
                }
            };
            aspectArr.push(obj);

            return obj;
        };
    }

    BI.aspect = {
        before: aspect("before"),
        after: aspect("after")
    };

    return BI.aspect;

})(window);
!(function () {

    var _keyStr = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=";


    // private method for UTF-8 encoding
    var _utf8_encode = function (string) {
        string = string.replace(/\r\n/g, "\n");
        var utftext = "";

        for (var n = 0; n < string.length; n++) {

            var c = string.charCodeAt(n);

            if (c < 128) {
                utftext += String.fromCharCode(c);
            } else if ((c > 127) && (c < 2048)) {
                utftext += String.fromCharCode((c >> 6) | 192);
                utftext += String.fromCharCode((c & 63) | 128);
            } else {
                utftext += String.fromCharCode((c >> 12) | 224);
                utftext += String.fromCharCode(((c >> 6) & 63) | 128);
                utftext += String.fromCharCode((c & 63) | 128);
            }

        }

        return utftext;
    };

    // private method for UTF-8 decoding
    var _utf8_decode = function (utftext) {
        var string = "";
        var i = 0;
        var c = 0, c3 = 0, c2 = 0;

        while (i < utftext.length) {

            c = utftext.charCodeAt(i);

            if (c < 128) {
                string += String.fromCharCode(c);
                i++;
            } else if ((c > 191) && (c < 224)) {
                c2 = utftext.charCodeAt(i + 1);
                string += String.fromCharCode(((c & 31) << 6) | (c2 & 63));
                i += 2;
            } else {
                c2 = utftext.charCodeAt(i + 1);
                c3 = utftext.charCodeAt(i + 2);
                string += String.fromCharCode(((c & 15) << 12) | ((c2 & 63) << 6) | (c3 & 63));
                i += 3;
            }

        }
        return string;
    };

    _.extend(BI, {

        encode: function (input) {
            var output = "";
            var chr1, chr2, chr3, enc1, enc2, enc3, enc4;
            var i = 0;

            input = _utf8_encode(input);

            while (i < input.length) {

                chr1 = input.charCodeAt(i++);
                chr2 = input.charCodeAt(i++);
                chr3 = input.charCodeAt(i++);

                enc1 = chr1 >> 2;
                enc2 = ((chr1 & 3) << 4) | (chr2 >> 4);
                enc3 = ((chr2 & 15) << 2) | (chr3 >> 6);
                enc4 = chr3 & 63;

                if (isNaN(chr2)) {
                    enc3 = enc4 = 64;
                } else if (isNaN(chr3)) {
                    enc4 = 64;
                }

                output = output + _keyStr.charAt(enc1) + _keyStr.charAt(enc2) + _keyStr.charAt(enc3) + _keyStr.charAt(enc4);

            }

            return output;
        },

        // public method for decoding
        decode: function (input) {
            var output = "";
            var chr1, chr2, chr3;
            var enc1, enc2, enc3, enc4;
            var i = 0;

            input = input.replace(/[^A-Za-z0-9\+\/\=]/g, "");

            while (i < input.length) {

                enc1 = _keyStr.indexOf(input.charAt(i++));
                enc2 = _keyStr.indexOf(input.charAt(i++));
                enc3 = _keyStr.indexOf(input.charAt(i++));
                enc4 = _keyStr.indexOf(input.charAt(i++));

                chr1 = (enc1 << 2) | (enc2 >> 4);
                chr2 = ((enc2 & 15) << 4) | (enc3 >> 2);
                chr3 = ((enc3 & 3) << 6) | enc4;

                output = output + String.fromCharCode(chr1);

                if (enc3 != 64) {
                    output = output + String.fromCharCode(chr2);
                }
                if (enc4 != 64) {
                    output = output + String.fromCharCode(chr3);
                }

            }

            output = _utf8_decode(output);

            return output;

        }
    });
})();
BI.Cache = {
    _prefix: "bi",
    setUsername: function (username) {
        localStorage.setItem(BI.Cache._prefix + ".username", (username + "" || "").toUpperCase());
    },
    getUsername: function () {
        return localStorage.getItem(BI.Cache._prefix + ".username") || "";
    },
    _getKeyPrefix: function () {
        return BI.Cache.getUsername() + "." + BI.Cache._prefix + ".";
    },
    _generateKey: function (key) {
        return BI.Cache._getKeyPrefix() + (key || "");
    },
    getItem: function (key) {
        return localStorage.getItem(BI.Cache._generateKey(key));
    },
    setItem: function (key, value) {
        localStorage.setItem(BI.Cache._generateKey(key), value);
    },
    removeItem: function (key) {
        localStorage.removeItem(BI.Cache._generateKey(key));
    },
    clear: function () {
        for (var i = localStorage.length; i >= 0; i--) {
            var key = localStorage.key(i);
            if (key) {
                if (key.indexOf(BI.Cache._getKeyPrefix()) === 0) {
                    localStorage.removeItem(key);
                }
            }
        }
    },
    keys: function () {
        var result = [];
        for (var i = localStorage.length; i >= 0; i--) {
            var key = localStorage.key(i);
            if (key) {
                var prefix = BI.Cache._getKeyPrefix();
                if (key.indexOf(prefix) === 0) {
                    result[result.length] = key.substring(prefix.length);
                }
            }
        }
        return result;
    },

    addCookie: function (name, value, path, expiresHours) {
        var cookieString = name + "=" + escape(value);
        // 判断是否设置过期时间
        if (expiresHours && expiresHours > 0) {
            var date = new Date();
            date.setTime(BI.getTime() + expiresHours * 3600 * 1000);
            cookieString = cookieString + "; expires=" + date.toGMTString();
        }
        if (path) {
            cookieString = cookieString + "; path=" + path;
        }
        document.cookie = cookieString;
    },
    getCookie: function (name) {
        var arr, reg = new RegExp("(^| )" + name + "=([^;]*)(;|$)");
        if (arr = document.cookie.match(reg)) {return unescape(arr[2]);}
        return null;
    },
    deleteCookie: function (name, path) {
        var date = new Date();
        date.setTime(BI.getTime() - 10000);
        var cookieString = name + "=v; expires=" + date.toGMTString();
        if (path) {
            cookieString = cookieString + "; path=" + path;
        }
        document.cookie = cookieString;
    }
};BI.CellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize) {
    this._cellSizeGetter = cellSizeGetter;
    this._cellCount = cellCount;
    this._estimatedCellSize = estimatedCellSize;
    this._cellSizeAndPositionData = {};
    this._lastMeasuredIndex = -1;
};

BI.CellSizeAndPositionManager.prototype = {
    constructor: BI.CellSizeAndPositionManager,
    configure: function (cellCount, estimatedCellSize) {
        this._cellCount = cellCount;
        this._estimatedCellSize = estimatedCellSize;
    },

    getCellCount: function () {
        return this._cellCount;
    },

    getEstimatedCellSize: function () {
        return this._estimatedCellSize;
    },

    getLastMeasuredIndex: function () {
        return this._lastMeasuredIndex;
    },

    getSizeAndPositionOfCell: function (index) {
        if (index < 0 || index >= this._cellCount) {
            return;
        }
        if (index > this._lastMeasuredIndex) {
            var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
            var offset = lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size;

            for (var i = this._lastMeasuredIndex + 1; i <= index; i++) {
                var size = this._cellSizeGetter(i);

                if (size == null || isNaN(size)) {
                    continue;
                }

                this._cellSizeAndPositionData[i] = {
                    offset: offset,
                    size: size
                };

                offset += size;
            }

            this._lastMeasuredIndex = index;
        }
        return this._cellSizeAndPositionData[index];
    },

    getSizeAndPositionOfLastMeasuredCell: function () {
        return this._lastMeasuredIndex >= 0
            ? this._cellSizeAndPositionData[this._lastMeasuredIndex]
            : {
                offset: 0,
                size: 0
            };
    },

    getTotalSize: function () {
        var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
        return lastMeasuredCellSizeAndPosition.offset + lastMeasuredCellSizeAndPosition.size + (this._cellCount - this._lastMeasuredIndex - 1) * this._estimatedCellSize;
    },

    getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) {
        var datum = this.getSizeAndPositionOfCell(targetIndex);
        var maxOffset = datum.offset;
        var minOffset = maxOffset - containerSize + datum.size;

        var idealOffset;

        switch (align) {
            case "start":
                idealOffset = maxOffset;
                break;
            case "end":
                idealOffset = minOffset;
                break;
            case "center":
                idealOffset = maxOffset - ((containerSize - datum.size) / 2);
                break;
            default:
                idealOffset = Math.max(minOffset, Math.min(maxOffset, currentOffset));
                break;
        }

        var totalSize = this.getTotalSize();

        return Math.max(0, Math.min(totalSize - containerSize, idealOffset));
    },

    getVisibleCellRange: function (containerSize, offset) {
        var totalSize = this.getTotalSize();

        if (totalSize === 0) {
            return {};
        }

        var maxOffset = offset + containerSize;
        var start = this._findNearestCell(offset);

        var datum = this.getSizeAndPositionOfCell(start);
        offset = datum.offset + datum.size;

        var stop = start;

        while (offset < maxOffset && stop < this._cellCount - 1) {
            stop++;
            offset += this.getSizeAndPositionOfCell(stop).size;
        }

        return {
            start: start,
            stop: stop
        };
    },

    resetCell: function (index) {
        this._lastMeasuredIndex = Math.min(this._lastMeasuredIndex, index - 1);
    },

    _binarySearch: function (high, low, offset) {
        var middle;
        var currentOffset;

        while (low <= high) {
            middle = low + Math.floor((high - low) / 2);
            currentOffset = this.getSizeAndPositionOfCell(middle).offset;

            if (currentOffset === offset) {
                return middle;
            } else if (currentOffset < offset) {
                low = middle + 1;
            } else if (currentOffset > offset) {
                high = middle - 1;
            }
        }

        if (low > 0) {
            return low - 1;
        }
    },

    _exponentialSearch: function (index, offset) {
        var interval = 1;

        while (index < this._cellCount && this.getSizeAndPositionOfCell(index).offset < offset) {
            index += interval;
            interval *= 2;
        }

        return this._binarySearch(Math.min(index, this._cellCount - 1), Math.floor(index / 2), offset);
    },

    _findNearestCell: function (offset) {
        if (isNaN(offset)) {
            return;
        }

        offset = Math.max(0, offset);

        var lastMeasuredCellSizeAndPosition = this.getSizeAndPositionOfLastMeasuredCell();
        var lastMeasuredIndex = Math.max(0, this._lastMeasuredIndex);

        if (lastMeasuredCellSizeAndPosition.offset >= offset) {
            return this._binarySearch(lastMeasuredIndex, 0, offset);
        }
        return this._exponentialSearch(lastMeasuredIndex, offset);
        
    }
};

BI.ScalingCellSizeAndPositionManager = function (cellCount, cellSizeGetter, estimatedCellSize, maxScrollSize) {
    this._cellSizeAndPositionManager = new BI.CellSizeAndPositionManager(cellCount, cellSizeGetter, estimatedCellSize);
    this._maxScrollSize = maxScrollSize || 10000000;
};

BI.ScalingCellSizeAndPositionManager.prototype = {
    constructor: BI.ScalingCellSizeAndPositionManager,

    configure: function () {
        this._cellSizeAndPositionManager.configure.apply(this._cellSizeAndPositionManager, arguments);
    },

    getCellCount: function () {
        return this._cellSizeAndPositionManager.getCellCount();
    },

    getEstimatedCellSize: function () {
        return this._cellSizeAndPositionManager.getEstimatedCellSize();
    },

    getLastMeasuredIndex: function () {
        return this._cellSizeAndPositionManager.getLastMeasuredIndex();
    },

    getOffsetAdjustment: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize);

        return Math.round(offsetPercentage * (safeTotalSize - totalSize));
    },

    getSizeAndPositionOfCell: function (index) {
        return this._cellSizeAndPositionManager.getSizeAndPositionOfCell(index);
    },

    getSizeAndPositionOfLastMeasuredCell: function () {
        return this._cellSizeAndPositionManager.getSizeAndPositionOfLastMeasuredCell();
    },

    getTotalSize: function () {
        return Math.min(this._maxScrollSize, this._cellSizeAndPositionManager.getTotalSize());
    },

    getUpdatedOffsetForIndex: function (align, containerSize, currentOffset, targetIndex) {
        currentOffset = this._safeOffsetToOffset(containerSize, currentOffset);

        var offset = this._cellSizeAndPositionManager.getUpdatedOffsetForIndex(align, containerSize, currentOffset, targetIndex);

        return this._offsetToSafeOffset(containerSize, offset);
    },

    getVisibleCellRange: function (containerSize, offset) {
        offset = this._safeOffsetToOffset(containerSize, offset);

        return this._cellSizeAndPositionManager.getVisibleCellRange(containerSize, offset);
    },

    resetCell: function (index) {
        this._cellSizeAndPositionManager.resetCell(index);
    },

    _getOffsetPercentage: function (containerSize, offset, totalSize) {
        return totalSize <= containerSize
            ? 0
            : offset / (totalSize - containerSize);
    },

    _offsetToSafeOffset: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();

        if (totalSize === safeTotalSize) {
            return offset;
        }
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, totalSize);

        return Math.round(offsetPercentage * (safeTotalSize - containerSize));
        
    },

    _safeOffsetToOffset: function (containerSize, offset) {
        var totalSize = this._cellSizeAndPositionManager.getTotalSize();
        var safeTotalSize = this.getTotalSize();

        if (totalSize === safeTotalSize) {
            return offset;
        }
        var offsetPercentage = this._getOffsetPercentage(containerSize, offset, safeTotalSize);

        return Math.round(offsetPercentage * (totalSize - containerSize));
        
    }
};/**
 * 汉字拼音索引
 */

!(function () {
    var _ChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSCYYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZJJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZSBSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCNNJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQTGLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMBDTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZASYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXHLGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJFFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJCLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJGBMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLLSDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYLJSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYLYMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPPBFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBMLSFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZYGPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJPWXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDYTCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTXJCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZWGPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDGCYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTLFYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSLCMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZSYMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDASWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGSXWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMCPJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXYYRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMTCJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDHZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJYZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHLYQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEEYYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQYTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYWYWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZGMDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMTYBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBSDZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZXJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFHTSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQYPKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWSZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCPMMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQJSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQHHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBBZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJLJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDSDPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZBYWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQGYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJYEMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGDXJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYSPYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZSXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJKHWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQUNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJYJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZBLCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZDQQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPHZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPBYKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRTQZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZSXQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBPCCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZCQQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDESJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMHQNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXSRGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMBZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQPWQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSYCZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQDFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYSYXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYPJYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWTYYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYLMSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXHQLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRPYWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZYHYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCRYLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCDJJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYSLBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXXTXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYXLSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHXCJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZXRWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNTYJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLYCYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGWHKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZMDPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZQYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPPMHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMXCTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGENQLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDFXQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZLLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTCTSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYSJYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJPDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZCFJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQGKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZLSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFLCJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFSZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJHZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXYWGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBTYNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXSTJTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRLFSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFXPYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQYCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJFZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJKYHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJPXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJXYCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSGLJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBGMYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJYHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJDQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGHGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXXNCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCXTLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMBDZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBHAWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBLZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZKBXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFYWLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGCULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJLLQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLLLPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDWFGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKTYYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLYXXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZYXXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZLJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWDXZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJHOJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYBSQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPXYYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZBYZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQSQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZKZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLCTZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYCZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZFYBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBBCBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWSCSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYYLLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYMRBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZXJCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLFNDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZCZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLMLWZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLMLHBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHTLKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQJZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGYZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZLPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPCQDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQKTWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDLMJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZSJNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYADTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZPKJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQHYWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQBSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFSYZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZNSDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJPZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPCQBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZTDKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDDNXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSDDTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZHLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELGLXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZBYFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJTEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTMXGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZGLHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQQMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTTSSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWPYMLGKDLDLGKQQBGYCHJXY";

    // 此处收录了375个多音字,数据来自于http://www.51window.net/page/pinyin
    var oMultiDiff = {
        19969: "DZ",
        19975: "WM",
        19988: "QJ",
        20048: "YL",
        20056: "SC",
        20060: "NM",
        20094: "QG",
        20127: "QJ",
        20167: "QC",
        20193: "YG",
        20250: "KH",
        20256: "ZC",
        20282: "SC",
        20285: "QJG",
        20291: "TD",
        20314: "YD",
        20315: "BF",
        20340: "NE",
        20375: "TD",
        20389: "YJ",
        20391: "CZ",
        20415: "PB",
        20446: "YS",
        20447: "SQ",
        20504: "TC",
        20608: "KG",
        20854: "QJ",
        20857: "ZC",
        20911: "PF",
        20985: "AW",
        21032: "PB",
        21048: "XQ",
        21049: "SC",
        21089: "YS",
        21119: "JC",
        21242: "SB",
        21273: "SC",
        21305: "YP",
        21306: "QO",
        21330: "ZC",
        21333: "SDC",
        21345: "QK",
        21378: "CA",
        21397: "SC",
        21414: "XS",
        21442: "SC",
        21477: "JG",
        21480: "TD",
        21484: "ZS",
        21494: "YX",
        21505: "YX",
        21512: "HG",
        21523: "XH",
        21537: "PB",
        21542: "PF",
        21549: "KH",
        21571: "E",
        21574: "DA",
        21588: "TD",
        21589: "O",
        21618: "ZC",
        21621: "KHA",
        21632: "ZJ",
        21654: "KG",
        21679: "LKG",
        21683: "KH",
        21710: "A",
        21719: "YH",
        21734: "WOE",
        21769: "A",
        21780: "WN",
        21804: "XH",
        21834: "A",
        21899: "ZD",
        21903: "RN",
        21908: "WO",
        21939: "ZC",
        21956: "SA",
        21964: "YA",
        21970: "TD",
        22003: "A",
        22031: "JG",
        22040: "XS",
        22060: "ZC",
        22066: "ZC",
        22079: "MH",
        22129: "XJ",
        22179: "XA",
        22237: "NJ",
        22244: "TD",
        22280: "JQ",
        22300: "YH",
        22313: "XW",
        22331: "YQ",
        22343: "YJ",
        22351: "PH",
        22395: "DC",
        22412: "TD",
        22484: "PB",
        22500: "PB",
        22534: "ZD",
        22549: "DH",
        22561: "PB",
        22612: "TD",
        22771: "KQ",
        22831: "HB",
        22841: "JG",
        22855: "QJ",
        22865: "XQ",
        23013: "ML",
        23081: "WM",
        23487: "SX",
        23558: "QJ",
        23561: "YW",
        23586: "YW",
        23614: "YW",
        23615: "SN",
        23631: "PB",
        23646: "ZS",
        23663: "ZT",
        23673: "YG",
        23762: "TD",
        23769: "ZS",
        23780: "QJ",
        23884: "QK",
        24055: "XH",
        24113: "DC",
        24162: "ZC",
        24191: "GA",
        24273: "QJ",
        24324: "NL",
        24377: "TD",
        24378: "QJ",
        24439: "PF",
        24554: "ZS",
        24683: "TD",
        24694: "WE",
        24733: "LK",
        24925: "TN",
        25094: "ZG",
        25100: "XQ",
        25103: "XH",
        25153: "PB",
        25170: "PB",
        25179: "KG",
        25203: "PB",
        25240: "ZS",
        25282: "FB",
        25303: "NA",
        25324: "KG",
        25341: "ZY",
        25373: "WZ",
        25375: "XJ",
        25384: "A",
        25457: "A",
        25528: "SD",
        25530: "SC",
        25552: "TD",
        25774: "ZC",
        25874: "ZC",
        26044: "YW",
        26080: "WM",
        26292: "PB",
        26333: "PB",
        26355: "ZY",
        26366: "CZ",
        26397: "ZC",
        26399: "QJ",
        26415: "ZS",
        26451: "SB",
        26526: "ZC",
        26552: "JG",
        26561: "TD",
        26588: "JG",
        26597: "CZ",
        26629: "ZS",
        26638: "YL",
        26646: "XQ",
        26653: "KG",
        26657: "XJ",
        26727: "HG",
        26894: "ZC",
        26937: "ZS",
        26946: "ZC",
        26999: "KJ",
        27099: "KJ",
        27449: "YQ",
        27481: "XS",
        27542: "ZS",
        27663: "ZS",
        27748: "TS",
        27784: "SC",
        27788: "ZD",
        27795: "TD",
        27812: "O",
        27850: "PB",
        27852: "MB",
        27895: "SL",
        27898: "PL",
        27973: "QJ",
        27981: "KH",
        27986: "HX",
        27994: "XJ",
        28044: "YC",
        28065: "WG",
        28177: "SM",
        28267: "QJ",
        28291: "KH",
        28337: "ZQ",
        28463: "TL",
        28548: "DC",
        28601: "TD",
        28689: "PB",
        28805: "JG",
        28820: "QG",
        28846: "PB",
        28952: "TD",
        28975: "ZC",
        29100: "A",
        29325: "QJ",
        29575: "SL",
        29602: "FB",
        30010: "TD",
        30044: "CX",
        30058: "PF",
        30091: "YSP",
        30111: "YN",
        30229: "XJ",
        30427: "SC",
        30465: "SX",
        30631: "YQ",
        30655: "QJ",
        30684: "QJG",
        30707: "SD",
        30729: "XH",
        30796: "LG",
        30917: "PB",
        31074: "NM",
        31085: "JZ",
        31109: "SC",
        31181: "ZC",
        31192: "MLB",
        31293: "JQ",
        31400: "YX",
        31584: "YJ",
        31896: "ZN",
        31909: "ZY",
        31995: "XJ",
        32321: "PF",
        32327: "ZY",
        32418: "HG",
        32420: "XQ",
        32421: "HG",
        32438: "LG",
        32473: "GJ",
        32488: "TD",
        32521: "QJ",
        32527: "PB",
        32562: "ZSQ",
        32564: "JZ",
        32735: "ZD",
        32793: "PB",
        33071: "PF",
        33098: "XL",
        33100: "YA",
        33152: "PB",
        33261: "CX",
        33324: "BP",
        33333: "TD",
        33406: "YA",
        33426: "WM",
        33432: "PB",
        33445: "JG",
        33486: "ZN",
        33493: "TS",
        33507: "QJ",
        33540: "QJ",
        33544: "ZC",
        33564: "XQ",
        33617: "YT",
        33632: "QJ",
        33636: "XH",
        33637: "YX",
        33694: "WG",
        33705: "PF",
        33728: "YW",
        33882: "SR",
        34067: "WM",
        34074: "YW",
        34121: "QJ",
        34255: "ZC",
        34259: "XL",
        34425: "JH",
        34430: "XH",
        34485: "KH",
        34503: "YS",
        34532: "HG",
        34552: "XS",
        34558: "YE",
        34593: "ZL",
        34660: "YQ",
        34892: "XH",
        34928: "SC",
        34999: "QJ",
        35048: "PB",
        35059: "SC",
        35098: "ZC",
        35203: "TQ",
        35265: "JX",
        35299: "JX",
        35782: "SZ",
        35828: "YS",
        35830: "E",
        35843: "TD",
        35895: "YG",
        35977: "MH",
        36158: "JG",
        36228: "QJ",
        36426: "XQ",
        36466: "DC",
        36710: "JC",
        36711: "ZYG",
        36767: "PB",
        36866: "SK",
        36951: "YW",
        37034: "YX",
        37063: "XH",
        37218: "ZC",
        37325: "ZC",
        38063: "PB",
        38079: "TD",
        38085: "QY",
        38107: "DC",
        38116: "TD",
        38123: "YD",
        38224: "HG",
        38241: "XTC",
        38271: "ZC",
        38415: "YE",
        38426: "KH",
        38461: "YD",
        38463: "AE",
        38466: "PB",
        38477: "XJ",
        38518: "YT",
        38551: "WK",
        38585: "ZC",
        38704: "XS",
        38739: "LJ",
        38761: "GJ",
        38808: "SQ",
        39048: "JG",
        39049: "XJ",
        39052: "HG",
        39076: "CZ",
        39271: "XT",
        39534: "TD",
        39552: "TD",
        39584: "PB",
        39647: "SB",
        39730: "LG",
        39748: "TPB",
        40109: "ZQ",
        40479: "ND",
        40516: "HG",
        40536: "HG",
        40583: "QJ",
        40765: "YQ",
        40784: "QJ",
        40840: "YK",
        40863: "QJG"
    };

    var _checkPYCh = function (ch) {
        var uni = ch.charCodeAt(0);
        // 如果不在汉字处理范围之内,返回原字符,也可以调用自己的处理函数
        if (uni > 40869 || uni < 19968) {return ch;} // dealWithOthers(ch);
        return (oMultiDiff[uni] ? oMultiDiff[uni] : (_ChineseFirstPY.charAt(uni - 19968)));
    };

    var _mkPYRslt = function (arr) {
        var arrRslt = [""], k;
        for (var i = 0, len = arr.length; i < len; i++) {
            var str = arr[i];
            var strlen = str.length;
            if (strlen == 1) {
                for (k = 0; k < arrRslt.length; k++) {
                    arrRslt[k] += str;
                }
            } else {
                var tmpArr = arrRslt.slice(0);
                arrRslt = [];
                for (k = 0; k < strlen; k++) {
                    // 复制一个相同的arrRslt
                    var tmp = tmpArr.slice(0);
                    // 把当前字符str[k]添加到每个元素末尾
                    for (var j = 0; j < tmp.length; j++) {
                        tmp[j] += str.charAt(k);
                    }
                    // 把复制并修改后的数组连接到arrRslt上
                    arrRslt = arrRslt.concat(tmp);
                }
            }
        }
        return arrRslt.join("").toLowerCase();
    };

    _.extend(BI, {
        makeFirstPY: function (str) {
            if (typeof (str) !== "string") {return "" + str;}
            var arrResult = []; // 保存中间结果的数组
            for (var i = 0, len = str.length; i < len; i++) {
                // 获得unicode码
                var ch = str.charAt(i);
                // 检查该unicode码是否在处理范围之内,在则返回该码对映汉字的拼音首字母,不在则调用其它函数处理
                arrResult.push(_checkPYCh(ch));
            }
            // 处理arrResult,返回所有可能的拼音首字母串数组
            return _mkPYRslt(arrResult);
        }
    });
})();/**
 * Detect Element Resize.
 * Forked in order to guard against unsafe 'window' and 'document' references.
 *
 * https://github.com/sdecima/javascript-detect-element-resize
 * Sebastian Decima
 *
 * version: 0.5.3
 **/
!(function () {
    // Check `document` and `window` in case of server-side rendering
    var _window;
    if (typeof window !== "undefined") {
        _window = window;
    } else if (typeof self !== "undefined") {
        _window = self;
    } else {
        _window = this;
    }

    var addEventListener = typeof document !== "undefined" && document.addEventListener;
    var stylesCreated = false;

    if (addEventListener) {
        var requestFrame = (function () {
            var raf = _window.requestAnimationFrame || _window.mozRequestAnimationFrame || _window.webkitRequestAnimationFrame ||
                function (fn) {
                    return _window.setTimeout(fn, 20);
                };
            return function (fn) {
                return raf(fn);
            };
        })();

        var cancelFrame = (function () {
            var cancel = _window.cancelAnimationFrame || _window.mozCancelAnimationFrame || _window.webkitCancelAnimationFrame ||
                _window.clearTimeout;
            return function (id) {
                return cancel(id);
            };
        })();

        var resetTriggers = function (element) {
            var triggers = element.__resizeTriggers__,
                expand = triggers.firstElementChild,
                contract = triggers.lastElementChild,
                expandChild = expand.firstElementChild;
            contract.scrollLeft = contract.scrollWidth;
            contract.scrollTop = contract.scrollHeight;
            expandChild.style.width = expand.offsetWidth + 1 + "px";
            expandChild.style.height = expand.offsetHeight + 1 + "px";
            expand.scrollLeft = expand.scrollWidth;
            expand.scrollTop = expand.scrollHeight;
        };

        var checkTriggers = function (element) {
            return element.offsetWidth !== element.__resizeLast__.width ||
                element.offsetHeight !== element.__resizeLast__.height;
        };

        var scrollListener = function (e) {
            var element = this;
            resetTriggers(this);
            if (this.__resizeRAF__) cancelFrame(this.__resizeRAF__);
            this.__resizeRAF__ = requestFrame(function () {
                if (checkTriggers(element)) {
                    element.__resizeLast__.width = element.offsetWidth;
                    element.__resizeLast__.height = element.offsetHeight;
                    element.__resizeListeners__.forEach(function (fn) {
                        fn.call(element, e);
                    });
                }
            });
        };

        /* Detect CSS Animations support to detect element display/re-attach */
        var animation = false,
            animationstring = "animation",
            keyframeprefix = "",
            animationstartevent = "animationstart",
            domPrefixes = "Webkit Moz O ms".split(" "),
            startEvents = "webkitAnimationStart animationstart oAnimationStart MSAnimationStart".split(" "),
            pfx = "";
        {
            var elm = document.createElement("fakeelement");
            if (elm.style.animationName !== undefined) {
                animation = true;
            }

            if (animation === false) {
                for (var i = 0; i < domPrefixes.length; i++) {
                    if (elm.style[domPrefixes[i] + "AnimationName"] !== undefined) {
                        pfx = domPrefixes[i];
                        animationstring = pfx + "Animation";
                        keyframeprefix = "-" + pfx.toLowerCase() + "-";
                        animationstartevent = startEvents[i];
                        animation = true;
                        break;
                    }
                }
            }
        }

        var animationName = "resizeanim";
        var animationKeyframes = "@" + keyframeprefix + "keyframes " + animationName + " { from { opacity: 0; } to { opacity: 0; } } ";
        var animationStyle = keyframeprefix + "animation: 1ms " + animationName + "; ";
    }

    var createStyles = function () {
        if (!stylesCreated) {
            // opacity:0 works around a chrome bug https://code.google.com/p/chromium/issues/detail?id=286360
            var css = (animationKeyframes ? animationKeyframes : "") +
                    ".resize-triggers { " + (animationStyle ? animationStyle : "") + "visibility: hidden; opacity: 0; } " +
                    ".resize-triggers, .resize-triggers > div, .contract-trigger:before { content: \" \"; display: block; position: absolute; top: 0; left: 0; height: 100%; width: 100%; overflow: hidden; } .resize-triggers > div { background: #eee; overflow: auto; } .contract-trigger:before { width: 200%; height: 200%; }",
                head = document.head || document.getElementsByTagName("head")[0],
                style = document.createElement("style");

            style.type = "text/css";
            if (style.styleSheet) {
                style.styleSheet.cssText = css;
            } else {
                style.appendChild(document.createTextNode(css));
            }

            head.appendChild(style);
            stylesCreated = true;
        }
    };

    var addResizeListener = function (element, fn) {
        if (addEventListener) {
            if (!element.__resizeTriggers__) {
                if (getComputedStyle(element).position === "static") element.style.position = "relative";
                createStyles();
                element.__resizeLast__ = {};
                element.__resizeListeners__ = [];
                (element.__resizeTriggers__ = document.createElement("div")).className = "resize-triggers";
                element.__resizeTriggers__.innerHTML = "<div class=\"expand-trigger\"><div></div></div>" +
                    "<div class=\"contract-trigger\"></div>";
                element.appendChild(element.__resizeTriggers__);
                resetTriggers(element);
                element.addEventListener("scroll", scrollListener, true);

                /* Listen for a css animation to detect element display/re-attach */
                animationstartevent && element.__resizeTriggers__.addEventListener(animationstartevent, function (e) {
                    if (e.animationName === animationName) {resetTriggers(element);}
                });
            }
            element.__resizeListeners__.push(fn);

        } else {
            element.attachEvent("onresize", fn);
        }
    };

    var removeResizeListener = function (element, fn) {
        if (addEventListener) {
            element.__resizeListeners__.splice(element.__resizeListeners__.indexOf(fn), 1);
            if (!element.__resizeListeners__.length) {
                element.removeEventListener("scroll", scrollListener, true);
                element.__resizeTriggers__ = !element.removeChild(element.__resizeTriggers__);
            }
        } else {
            element.detachEvent("onresize", fn);
        }
    };

    BI.ResizeDetector = {
        addResizeListener: function (widget, fn) {
            addResizeListener(widget.element[0], fn);
            return function () {
                removeResizeListener(widget.element[0], fn);
            };
        },
        removeResizeListener: function (widget, fn) {
            removeResizeListener(widget.element[0], fn);
        }
    };
}());

(function () {
    function defaultComparator (a, b) {
        return a < b;
    }

    BI.Heap = function (items, comparator) {
        this._items = items || [];
        this._size = this._items.length;
        this._comparator = comparator || defaultComparator;
        this._heapify();
    };

    BI.Heap.prototype = {
        constructor: BI.Heap,
        empty: function () {
            return this._size === 0;
        },

        pop: function () {
            if (this._size === 0) {
                return;
            }

            var elt = this._items[0];

            var lastElt = this._items.pop();
            this._size--;

            if (this._size > 0) {
                this._items[0] = lastElt;
                this._sinkDown(0);
            }

            return elt;
        },

        push: function (item) {
            this._items[this._size++] = item;
            this._bubbleUp(this._size - 1);
        },

        size: function () {
            return this._size;
        },

        peek: function () {
            if (this._size === 0) {
                return;
            }

            return this._items[0];
        },

        _heapify: function () {
            for (var index = Math.floor((this._size + 1) / 2); index >= 0; index--) {
                this._sinkDown(index);
            }
        },

        _bubbleUp: function (index) {
            var elt = this._items[index];
            while (index > 0) {
                var parentIndex = Math.floor((index + 1) / 2) - 1;
                var parentElt = this._items[parentIndex];

                // if parentElt < elt, stop
                if (this._comparator(parentElt, elt)) {
                    return;
                }

                // swap
                this._items[parentIndex] = elt;
                this._items[index] = parentElt;
                index = parentIndex;
            }
        },

        _sinkDown: function (index) {
            var elt = this._items[index];

            while (true) {
                var leftChildIndex = 2 * (index + 1) - 1;
                var rightChildIndex = 2 * (index + 1);
                var swapIndex = -1;

                if (leftChildIndex < this._size) {
                    var leftChild = this._items[leftChildIndex];
                    if (this._comparator(leftChild, elt)) {
                        swapIndex = leftChildIndex;
                    }
                }

                if (rightChildIndex < this._size) {
                    var rightChild = this._items[rightChildIndex];
                    if (this._comparator(rightChild, elt)) {
                        if (swapIndex === -1 ||
                            this._comparator(rightChild, this._items[swapIndex])) {
                            swapIndex = rightChildIndex;
                        }
                    }
                }

                // if we don't have a swap, stop
                if (swapIndex === -1) {
                    return;
                }

                this._items[index] = this._items[swapIndex];
                this._items[swapIndex] = elt;
                index = swapIndex;
            }
        }
    };
})();
(function () {
    var clamp = function (min, value, max) {
        if (value < min) {
            return min;
        }
        if (value > max) {
            return max;
        }
        return value;
    };

    var BUFFER_ROWS = 5;
    var NO_ROWS_SCROLL_RESULT = {
        index: 0,
        offset: 0,
        position: 0,
        contentHeight: 0
    };

    BI.TableScrollHelper = function (rowCount,
        defaultRowHeight,
        viewportHeight,
        rowHeightGetter) {
        this._rowOffsets = BI.PrefixIntervalTree.uniform(rowCount, defaultRowHeight);
        this._storedHeights = new Array(rowCount);
        for (var i = 0; i < rowCount; ++i) {
            this._storedHeights[i] = defaultRowHeight;
        }
        this._rowCount = rowCount;
        this._position = 0;
        this._contentHeight = rowCount * defaultRowHeight;
        this._defaultRowHeight = defaultRowHeight;
        this._rowHeightGetter = rowHeightGetter ?
            rowHeightGetter : function () {
                return defaultRowHeight;
            };
        this._viewportHeight = viewportHeight;

        this._updateHeightsInViewport(0, 0);
    };

    BI.TableScrollHelper.prototype = {
        constructor: BI.TableScrollHelper,
        setRowHeightGetter: function (rowHeightGetter) {
            this._rowHeightGetter = rowHeightGetter;
        },

        setViewportHeight: function (viewportHeight) {
            this._viewportHeight = viewportHeight;
        },

        getContentHeight: function () {
            return this._contentHeight;
        },

        _updateHeightsInViewport: function (firstRowIndex,
            firstRowOffset) {
            var top = firstRowOffset;
            var index = firstRowIndex;
            while (top <= this._viewportHeight && index < this._rowCount) {
                this._updateRowHeight(index);
                top += this._storedHeights[index];
                index++;
            }
        },

        _updateHeightsAboveViewport: function (firstRowIndex) {
            var index = firstRowIndex - 1;
            while (index >= 0 && index >= firstRowIndex - BUFFER_ROWS) {
                var delta = this._updateRowHeight(index);
                this._position += delta;
                index--;
            }
        },

        _updateRowHeight: function (rowIndex) {
            if (rowIndex < 0 || rowIndex >= this._rowCount) {
                return 0;
            }
            var newHeight = this._rowHeightGetter(rowIndex);
            if (newHeight !== this._storedHeights[rowIndex]) {
                var change = newHeight - this._storedHeights[rowIndex];
                this._rowOffsets.set(rowIndex, newHeight);
                this._storedHeights[rowIndex] = newHeight;
                this._contentHeight += change;
                return change;
            }
            return 0;
        },

        getRowPosition: function (rowIndex) {
            this._updateRowHeight(rowIndex);
            return this._rowOffsets.sumUntil(rowIndex);
        },

        scrollBy: function (delta) {
            if (this._rowCount === 0) {
                return NO_ROWS_SCROLL_RESULT;
            }
            var firstRow = this._rowOffsets.greatestLowerBound(this._position);
            firstRow = clamp(firstRow, 0, Math.max(this._rowCount - 1, 0));
            var firstRowPosition = this._rowOffsets.sumUntil(firstRow);
            var rowIndex = firstRow;
            var position = this._position;

            var rowHeightChange = this._updateRowHeight(rowIndex);
            if (firstRowPosition !== 0) {
                position += rowHeightChange;
            }
            var visibleRowHeight = this._storedHeights[rowIndex] -
                (position - firstRowPosition);

            if (delta >= 0) {

                while (delta > 0 && rowIndex < this._rowCount) {
                    if (delta < visibleRowHeight) {
                        position += delta;
                        delta = 0;
                    } else {
                        delta -= visibleRowHeight;
                        position += visibleRowHeight;
                        rowIndex++;
                    }
                    if (rowIndex < this._rowCount) {
                        this._updateRowHeight(rowIndex);
                        visibleRowHeight = this._storedHeights[rowIndex];
                    }
                }
            } else if (delta < 0) {
                delta = -delta;
                var invisibleRowHeight = this._storedHeights[rowIndex] - visibleRowHeight;

                while (delta > 0 && rowIndex >= 0) {
                    if (delta < invisibleRowHeight) {
                        position -= delta;
                        delta = 0;
                    } else {
                        position -= invisibleRowHeight;
                        delta -= invisibleRowHeight;
                        rowIndex--;
                    }
                    if (rowIndex >= 0) {
                        var change = this._updateRowHeight(rowIndex);
                        invisibleRowHeight = this._storedHeights[rowIndex];
                        position += change;
                    }
                }
            }

            var maxPosition = this._contentHeight - this._viewportHeight;
            position = clamp(position, 0, maxPosition);
            this._position = position;
            var firstRowIndex = this._rowOffsets.greatestLowerBound(position);
            firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0));
            firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex);
            var firstRowOffset = firstRowPosition - position;

            this._updateHeightsInViewport(firstRowIndex, firstRowOffset);
            this._updateHeightsAboveViewport(firstRowIndex);

            return {
                index: firstRowIndex,
                offset: firstRowOffset,
                position: this._position,
                contentHeight: this._contentHeight
            };
        },

        _getRowAtEndPosition: function (rowIndex) {
            // We need to update enough rows above the selected one to be sure that when
            // we scroll to selected position all rows between first shown and selected
            // one have most recent heights computed and will not resize
            this._updateRowHeight(rowIndex);
            var currentRowIndex = rowIndex;
            var top = this._storedHeights[currentRowIndex];
            while (top < this._viewportHeight && currentRowIndex >= 0) {
                currentRowIndex--;
                if (currentRowIndex >= 0) {
                    this._updateRowHeight(currentRowIndex);
                    top += this._storedHeights[currentRowIndex];
                }
            }
            var position = this._rowOffsets.sumTo(rowIndex) - this._viewportHeight;
            if (position < 0) {
                position = 0;
            }
            return position;
        },

        scrollTo: function (position) {
            if (this._rowCount === 0) {
                return NO_ROWS_SCROLL_RESULT;
            }
            if (position <= 0) {
                // If position less than or equal to 0 first row should be fully visible
                // on top
                this._position = 0;
                this._updateHeightsInViewport(0, 0);

                return {
                    index: 0,
                    offset: 0,
                    position: this._position,
                    contentHeight: this._contentHeight
                };
            } else if (position >= this._contentHeight - this._viewportHeight) {
                // If position is equal to or greater than max scroll value, we need
                // to make sure to have bottom border of last row visible.
                var rowIndex = this._rowCount - 1;
                position = this._getRowAtEndPosition(rowIndex);
            }
            this._position = position;

            var firstRowIndex = this._rowOffsets.greatestLowerBound(position);
            firstRowIndex = clamp(firstRowIndex, 0, Math.max(this._rowCount - 1, 0));
            var firstRowPosition = this._rowOffsets.sumUntil(firstRowIndex);
            var firstRowOffset = firstRowPosition - position;

            this._updateHeightsInViewport(firstRowIndex, firstRowOffset);
            this._updateHeightsAboveViewport(firstRowIndex);

            return {
                index: firstRowIndex,
                offset: firstRowOffset,
                position: this._position,
                contentHeight: this._contentHeight
            };
        },

        /**
         * Allows to scroll to selected row with specified offset. It always
         * brings that row to top of viewport with that offset
         */
        scrollToRow: function (rowIndex, offset) {
            rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0));
            offset = clamp(offset, -this._storedHeights[rowIndex], 0);
            var firstRow = this._rowOffsets.sumUntil(rowIndex);
            return this.scrollTo(firstRow - offset);
        },

        /**
         * Allows to scroll to selected row by bringing it to viewport with minimal
         * scrolling. This that if row is fully visible, scroll will not be changed.
         * If top border of row is above top of viewport it will be scrolled to be
         * fully visible on the top of viewport. If the bottom border of row is
         * below end of viewport, it will be scrolled up to be fully visible on the
         * bottom of viewport.
         */
        scrollRowIntoView: function (rowIndex) {
            rowIndex = clamp(rowIndex, 0, Math.max(this._rowCount - 1, 0));
            var rowBegin = this._rowOffsets.sumUntil(rowIndex);
            var rowEnd = rowBegin + this._storedHeights[rowIndex];
            if (rowBegin < this._position) {
                return this.scrollTo(rowBegin);
            } else if (this._position + this._viewportHeight < rowEnd) {
                var position = this._getRowAtEndPosition(rowIndex);
                return this.scrollTo(position);
            }
            return this.scrollTo(this._position);
        }
    };

})();
// Data structure that allows to store values and assign positions to them
// in a way to minimize changing positions of stored values when new ones are
// added or when some values are replaced. Stored elements are alwasy assigned
// a consecutive set of positoins startin from 0 up to count of elements less 1
// Following actions can be executed
// * get position assigned to given value (null if value is not stored)
// * create new entry for new value and get assigned position back
// * replace value that is furthest from specified value range with new value
//   and get it's position back
// All operations take amortized log(n) time where n is number of elements in
// the set.
BI.IntegerBufferSet = function () {
    this._valueToPositionMap = {};
    this._size = 0;
    this._smallValues = new BI.Heap(
        [], // Initial data in the heap
        this._smallerComparator
    );
    this._largeValues = new BI.Heap(
        [], // Initial data in the heap
        this._greaterComparator
    );

};

BI.IntegerBufferSet.prototype = {
    constructor: BI.IntegerBufferSet,
    getSize: function () /* number*/ {
        return this._size;
    },

    getValuePosition: function (/* number*/ value) /* ?number*/ {
        if (this._valueToPositionMap[value] === undefined) {
            return null;
        }
        return this._valueToPositionMap[value];
    },

    getNewPositionForValue: function (/* number*/ value) /* number*/ {
        var newPosition = this._size;
        this._size++;
        this._pushToHeaps(newPosition, value);
        this._valueToPositionMap[value] = newPosition;
        return newPosition;
    },

    replaceFurthestValuePosition: function (/* number*/ lowValue,
        /* number*/ highValue,
        /* number*/ newValue) /* ?number*/ {
        this._cleanHeaps();
        if (this._smallValues.empty() || this._largeValues.empty()) {
            // Threre are currently no values stored. We will have to create new
            // position for this value.
            return null;
        }

        var minValue = this._smallValues.peek().value;
        var maxValue = this._largeValues.peek().value;
        if (minValue >= lowValue && maxValue <= highValue) {
            // All values currently stored are necessary, we can't reuse any of them.
            return null;
        }

        var valueToReplace;
        if (lowValue - minValue > maxValue - highValue) {
            // minValue is further from provided range. We will reuse it's position.
            valueToReplace = minValue;
            this._smallValues.pop();
        } else {
            valueToReplace = maxValue;
            this._largeValues.pop();
        }
        var position = this._valueToPositionMap[valueToReplace];
        delete this._valueToPositionMap[valueToReplace];
        this._valueToPositionMap[newValue] = position;
        this._pushToHeaps(position, newValue);

        return position;
    },

    _pushToHeaps: function (/* number*/ position, /* number*/ value) {
        var element = {
            position: position,
            value: value
        };
        // We can reuse the same object in both heaps, because we don't mutate them
        this._smallValues.push(element);
        this._largeValues.push(element);
    },

    _cleanHeaps: function () {
        // We not usually only remove object from one heap while moving value.
        // Here we make sure that there is no stale data on top of heaps.
        this._cleanHeap(this._smallValues);
        this._cleanHeap(this._largeValues);
        var minHeapSize =
            Math.min(this._smallValues.size(), this._largeValues.size());
        var maxHeapSize =
            Math.max(this._smallValues.size(), this._largeValues.size());
        if (maxHeapSize > 10 * minHeapSize) {
            // There are many old values in one of heaps. We nned to get rid of them
            // to not use too avoid memory leaks
            this._recreateHeaps();
        }
    },

    _recreateHeaps: function () {
        var sourceHeap = this._smallValues.size() < this._largeValues.size() ?
            this._smallValues :
            this._largeValues;
        var newSmallValues = new Heap(
            [], // Initial data in the heap
            this._smallerComparator
        );
        var newLargeValues = new Heap(
            [], // Initial datat in the heap
            this._greaterComparator
        );
        while (!sourceHeap.empty()) {
            var element = sourceHeap.pop();
            // Push all stil valid elements to new heaps
            if (this._valueToPositionMap[element.value] !== undefined) {
                newSmallValues.push(element);
                newLargeValues.push(element);
            }
        }
        this._smallValues = newSmallValues;
        this._largeValues = newLargeValues;
    },

    _cleanHeap: function (/* object*/ heap) {
        while (!heap.empty() &&
        this._valueToPositionMap[heap.peek().value] === undefined) {
            heap.pop();
        }
    },

    _smallerComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ {
        return lhs.value < rhs.value;
    },

    _greaterComparator: function (/* object*/ lhs, /* object*/ rhs) /* boolean*/ {
        return lhs.value > rhs.value;
    }
};

!(function () {
    BI.LinkHashMap = function () {
        this.array = [];
        this.map = {};
    };
    BI.LinkHashMap.prototype = {
        constructor: BI.LinkHashMap,
        has: function (key) {
            if (key in this.map) {
                return true;
            }
            return false;
        },

        add: function (key, value) {
            if (typeof key === "undefined") {
                return;
            }
            if (key in this.map) {
                this.map[key] = value;
            } else {
                this.array.push(key);
                this.map[key] = value;
            }
        },

        remove: function (key) {
            if (key in this.map) {
                delete this.map[key];
                for (var i = 0; i < this.array.length; i++) {
                    if (this.array[i] == key) {
                        this.array.splice(i, 1);
                        break;
                    }
                }
            }
        },

        size: function () {
            return this.array.length;
        },

        each: function (fn, scope) {
            var scope = scope || window;
            var fn = fn || null;
            if (fn == null || typeof (fn) !== "function") {
                return;
            }
            for (var i = 0; i < this.array.length; i++) {
                var key = this.array[i];
                var value = this.map[key];
                var re = fn.call(scope, key, value, i, this.array, this.map);
                if (re == false) {
                    break;
                }
            }
        },

        get: function (key) {
            return this.map[key];
        },

        toArray: function () {
            var array = [];
            this.each(function (key, value) {
                array.push(value);
            });
            return array;
        }
    };
})();_.extend(BI, {
    $import: function () {
        var _LOADED = {}; // alex:保存加载过的
        function loadReady (src, must) {
            var $scripts = $("head script, body script");
            $.each($scripts, function (i, item) {
                if (item.src.indexOf(src) != -1) {
                    _LOADED[src] = true;
                }
            });
            var $links = $("head link");
            $.each($links, function (i, item) {
                if (item.href.indexOf(src) != -1 && must) {
                    _LOADED[src] = false;
                    $(item).remove();
                }
            });
        }

        // must=true 强行加载
        return function (src, ext, must) {
            loadReady(src, must);
            // alex:如果已经加载过了的,直接return
            if (_LOADED[src] === true) {
                return;
            }
            if (ext === "css") {
                var link = document.createElement("link");
                link.rel = "stylesheet";
                link.type = "text/css";
                link.href = src;
                var head = document.getElementsByTagName("head")[0];
                head.appendChild(link);
                _LOADED[src] = true;
            } else {
                // alex:这里用同步调用的方式,必须等待ajax完成
                $.ajax({
                    url: src,
                    dataType: "script", // alex:指定dataType为script,jquery会帮忙做globalEval的事情
                    async: false,
                    cache: true,
                    complete: function (res, status) {
                        /*
                         * alex:发现jquery会很智能地判断一下返回的数据类型是不是script,然后做一个globalEval
                         * 所以当status为success时就不需要再把其中的内容加到script里面去了
                         */
                        if (status == "success") {
                            _LOADED[src] = true;
                        }
                    }
                });
            }
        };
    }()
});
!(function () {
    BI.LRU = function (limit) {
        this.size = 0;
        this.limit = limit;
        this.head = this.tail = undefined;
        this._keymap = {};
    };

    var p = BI.LRU.prototype;

    p.put = function (key, value) {
        var removed;
        if (this.size === this.limit) {
            removed = this.shift();
        }

        var entry = this.get(key, true);
        if (!entry) {
            entry = {
                key: key
            };
            this._keymap[key] = entry;
            if (this.tail) {
                this.tail.newer = entry;
                entry.older = this.tail;
            } else {
                this.head = entry;
            }
            this.tail = entry;
            this.size++;
        }
        entry.value = value;

        return removed;
    };

    p.shift = function () {
        var entry = this.head;
        if (entry) {
            this.head = this.head.newer;
            this.head.older = undefined;
            entry.newer = entry.older = undefined;
            this._keymap[entry.key] = undefined;
            this.size--;
        }
        return entry;
    };


    p.get = function (key, returnEntry) {
        var entry = this._keymap[key];
        if (entry === undefined) return;
        if (entry === this.tail) {
            return returnEntry
                ? entry
                : entry.value;
        }
        // HEAD--------------TAIL
        //   <.older   .newer>
        //  <--- add direction --
        //   A  B  C  <D>  E
        if (entry.newer) {
            if (entry === this.head) {
                this.head = entry.newer;
            }
            entry.newer.older = entry.older; // C <-- E.
        }
        if (entry.older) {
            entry.older.newer = entry.newer; // C. --> E
        }
        entry.newer = undefined; // D --x
        entry.older = this.tail; // D. --> E
        if (this.tail) {
            this.tail.newer = entry; // E. <-- D
        }
        this.tail = entry;
        return returnEntry
            ? entry
            : entry.value;
    };

    p.has = function (key) {
        return this._keymap[key] != null;
    };
})();
!(function () {
    var MD5 = function (hexcase) {
        this.hexcase = !hexcase ? 0 : 1;
        /* hex output format. 0 - lowercase; 1 - uppercase */
        this.b64pad = "";
        /* base-64 pad character. "=" for strict RFC compliance */
        this.chrsz = 8;
        /* bits per input character. 8 - ASCII; 16 - Unicode */
    };

    /*
     * These are the functions you'll usually want to call
     * They take string arguments and return either hex or base-64 encoded strings
     */
    MD5.prototype.hex_md5 = function (s) {
        return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.hex_md5_salt = function (s) {
        var md5ed = this.hex_md5(s);

        var items1 = [];
        var items2 = [];
        for (var i = 0; i < md5ed.length; i++) {
            if (i % 2 === 0) {
                items1.push(md5ed.charAt(i));
            } else {
                items2.push(md5ed.charAt(i));
            }
        }
        var result = ":" + items1.join("") + items2.join("");
        return result;
    };

    MD5.prototype.b64_md5 = function (s) {
        return this.binl2b64(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.hex_hmac_md5 = function (key, data) {
        return this.binl2hex(this.core_hmac_md5(key, data));
    };

    MD5.prototype.b64_hmac_md5 = function (key, data) {
        return this.binl2b64(this.core_hmac_md5(key, data));
    };

    /* Backwards compatibility - same as hex_md5() */
    MD5.prototype.calcMD5 = function (s) {
        return this.binl2hex(this.core_md5(this.str2binl(s), s.length * this.chrsz));
    };

    MD5.prototype.core_md5 = function (x, len) {
        /* append padding */
        x[len >> 5] |= 0x80 << ((len) % 32);
        x[(((len + 64) >>> 9) << 4) + 14] = len;

        var a = 1732584193;
        var b = -271733879;
        var c = -1732584194;
        var d = 271733878;

        for (var i = 0; i < x.length; i += 16) {
            var olda = a;
            var oldb = b;
            var oldc = c;
            var oldd = d;

            a = this.md5_ff(a, b, c, d, x[i + 0], 7, -680876936);
            d = this.md5_ff(d, a, b, c, x[i + 1], 12, -389564586);
            c = this.md5_ff(c, d, a, b, x[i + 2], 17, 606105819);
            b = this.md5_ff(b, c, d, a, x[i + 3], 22, -1044525330);
            a = this.md5_ff(a, b, c, d, x[i + 4], 7, -176418897);
            d = this.md5_ff(d, a, b, c, x[i + 5], 12, 1200080426);
            c = this.md5_ff(c, d, a, b, x[i + 6], 17, -1473231341);
            b = this.md5_ff(b, c, d, a, x[i + 7], 22, -45705983);
            a = this.md5_ff(a, b, c, d, x[i + 8], 7, 1770035416);
            d = this.md5_ff(d, a, b, c, x[i + 9], 12, -1958414417);
            c = this.md5_ff(c, d, a, b, x[i + 10], 17, -42063);
            b = this.md5_ff(b, c, d, a, x[i + 11], 22, -1990404162);
            a = this.md5_ff(a, b, c, d, x[i + 12], 7, 1804603682);
            d = this.md5_ff(d, a, b, c, x[i + 13], 12, -40341101);
            c = this.md5_ff(c, d, a, b, x[i + 14], 17, -1502002290);
            b = this.md5_ff(b, c, d, a, x[i + 15], 22, 1236535329);

            a = this.md5_gg(a, b, c, d, x[i + 1], 5, -165796510);
            d = this.md5_gg(d, a, b, c, x[i + 6], 9, -1069501632);
            c = this.md5_gg(c, d, a, b, x[i + 11], 14, 643717713);
            b = this.md5_gg(b, c, d, a, x[i + 0], 20, -373897302);
            a = this.md5_gg(a, b, c, d, x[i + 5], 5, -701558691);
            d = this.md5_gg(d, a, b, c, x[i + 10], 9, 38016083);
            c = this.md5_gg(c, d, a, b, x[i + 15], 14, -660478335);
            b = this.md5_gg(b, c, d, a, x[i + 4], 20, -405537848);
            a = this.md5_gg(a, b, c, d, x[i + 9], 5, 568446438);
            d = this.md5_gg(d, a, b, c, x[i + 14], 9, -1019803690);
            c = this.md5_gg(c, d, a, b, x[i + 3], 14, -187363961);
            b = this.md5_gg(b, c, d, a, x[i + 8], 20, 1163531501);
            a = this.md5_gg(a, b, c, d, x[i + 13], 5, -1444681467);
            d = this.md5_gg(d, a, b, c, x[i + 2], 9, -51403784);
            c = this.md5_gg(c, d, a, b, x[i + 7], 14, 1735328473);
            b = this.md5_gg(b, c, d, a, x[i + 12], 20, -1926607734);

            a = this.md5_hh(a, b, c, d, x[i + 5], 4, -378558);
            d = this.md5_hh(d, a, b, c, x[i + 8], 11, -2022574463);
            c = this.md5_hh(c, d, a, b, x[i + 11], 16, 1839030562);
            b = this.md5_hh(b, c, d, a, x[i + 14], 23, -35309556);
            a = this.md5_hh(a, b, c, d, x[i + 1], 4, -1530992060);
            d = this.md5_hh(d, a, b, c, x[i + 4], 11, 1272893353);
            c = this.md5_hh(c, d, a, b, x[i + 7], 16, -155497632);
            b = this.md5_hh(b, c, d, a, x[i + 10], 23, -1094730640);
            a = this.md5_hh(a, b, c, d, x[i + 13], 4, 681279174);
            d = this.md5_hh(d, a, b, c, x[i + 0], 11, -358537222);
            c = this.md5_hh(c, d, a, b, x[i + 3], 16, -722521979);
            b = this.md5_hh(b, c, d, a, x[i + 6], 23, 76029189);
            a = this.md5_hh(a, b, c, d, x[i + 9], 4, -640364487);
            d = this.md5_hh(d, a, b, c, x[i + 12], 11, -421815835);
            c = this.md5_hh(c, d, a, b, x[i + 15], 16, 530742520);
            b = this.md5_hh(b, c, d, a, x[i + 2], 23, -995338651);

            a = this.md5_ii(a, b, c, d, x[i + 0], 6, -198630844);
            d = this.md5_ii(d, a, b, c, x[i + 7], 10, 1126891415);
            c = this.md5_ii(c, d, a, b, x[i + 14], 15, -1416354905);
            b = this.md5_ii(b, c, d, a, x[i + 5], 21, -57434055);
            a = this.md5_ii(a, b, c, d, x[i + 12], 6, 1700485571);
            d = this.md5_ii(d, a, b, c, x[i + 3], 10, -1894986606);
            c = this.md5_ii(c, d, a, b, x[i + 10], 15, -1051523);
            b = this.md5_ii(b, c, d, a, x[i + 1], 21, -2054922799);
            a = this.md5_ii(a, b, c, d, x[i + 8], 6, 1873313359);
            d = this.md5_ii(d, a, b, c, x[i + 15], 10, -30611744);
            c = this.md5_ii(c, d, a, b, x[i + 6], 15, -1560198380);
            b = this.md5_ii(b, c, d, a, x[i + 13], 21, 1309151649);
            a = this.md5_ii(a, b, c, d, x[i + 4], 6, -145523070);
            d = this.md5_ii(d, a, b, c, x[i + 11], 10, -1120210379);
            c = this.md5_ii(c, d, a, b, x[i + 2], 15, 718787259);
            b = this.md5_ii(b, c, d, a, x[i + 9], 21, -343485551);

            a = this.safe_add(a, olda);
            b = this.safe_add(b, oldb);
            c = this.safe_add(c, oldc);
            d = this.safe_add(d, oldd);
        }
        return Array(a, b, c, d);

    };

    /*
     * These functions implement the four basic operations the algorithm uses.
     */
    MD5.prototype.md5_cmn = function (q, a, b, x, s, t) {
        return this.safe_add(this.bit_rol(this.safe_add(this.safe_add(a, q), this.safe_add(x, t)), s), b);
    };
    MD5.prototype.md5_ff = function (a, b, c, d, x, s, t) {
        return this.md5_cmn((b & c) | ((~b) & d), a, b, x, s, t);
    };
    MD5.prototype.md5_gg = function (a, b, c, d, x, s, t) {
        return this.md5_cmn((b & d) | (c & (~d)), a, b, x, s, t);
    };
    MD5.prototype.md5_hh = function (a, b, c, d, x, s, t) {
        return this.md5_cmn(b ^ c ^ d, a, b, x, s, t);
    };
    MD5.prototype.md5_ii = function (a, b, c, d, x, s, t) {
        return this.md5_cmn(c ^ (b | (~d)), a, b, x, s, t);
    };

    /*
     * Calculate the HMAC-MD5, of a key and some data
     */
    MD5.prototype.core_hmac_md5 = function (key, data) {
        var bkey = this.str2binl(key);
        if (bkey.length > 16) {bkey = this.core_md5(bkey, key.length * this.chrsz);}

        var ipad = Array(16), opad = Array(16);
        for (var i = 0; i < 16; i++) {
            ipad[i] = bkey[i] ^ 0x36363636;
            opad[i] = bkey[i] ^ 0x5C5C5C5C;
        }

        var hash = this.core_md5(ipad.concat(this.str2binl(data)), 512 + data.length * this.chrsz);
        return this.core_md5(opad.concat(hash), 512 + 128);
    };

    /*
     * Add integers, wrapping at 2^32. This uses 16-bit operations internally
     * to work around bugs in some JS interpreters.
     */
    MD5.prototype.safe_add = function (x, y) {
        var lsw = (x & 0xFFFF) + (y & 0xFFFF);
        var msw = (x >> 16) + (y >> 16) + (lsw >> 16);
        return (msw << 16) | (lsw & 0xFFFF);
    };

    /*
     * Bitwise rotate a 32-bit number to the left.
     */
    MD5.prototype.bit_rol = function (num, cnt) {
        return (num << cnt) | (num >>> (32 - cnt));
    };

    /*
     * Convert a string to an array of little-endian words
     * If chrsz is ASCII, characters >255 have their hi-byte silently ignored.
     */
    MD5.prototype.str2binl = function (str) {
        var bin = Array();
        var mask = (1 << this.chrsz) - 1;
        for (var i = 0; i < str.length * this.chrsz; i += this.chrsz) {bin[i >> 5] |= (str.charCodeAt(i / this.chrsz) & mask) << (i % 32);}
        return bin;
    };

    /*
     * Convert an array of little-endian words to a hex string.
     */
    MD5.prototype.binl2hex = function (binarray) {
        var hex_tab = this.hexcase ? "0123456789ABCDEF" : "0123456789abcdef";
        var str = "";
        for (var i = 0; i < binarray.length * 4; i++) {
            str += hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8 + 4)) & 0xF)
                + hex_tab.charAt((binarray[i >> 2] >> ((i % 4) * 8)) & 0xF);
        }
        return str;
    };

    /*
     * Convert an array of little-endian words to a base-64 string
     */
    MD5.prototype.binl2b64 = function (binarray) {
        var tab = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/";
        var str = "";
        for (var i = 0; i < binarray.length * 4; i += 3) {
            var triplet = (((binarray[i >> 2] >> 8 * (i % 4)) & 0xFF) << 16)
                | (((binarray[i + 1 >> 2] >> 8 * ((i + 1) % 4)) & 0xFF) << 8)
                | ((binarray[i + 2 >> 2] >> 8 * ((i + 2) % 4)) & 0xFF);
            for (var j = 0; j < 4; j++) {
                if (i * 8 + j * 6 > binarray.length * 32) {str += this.b64pad;} else {str += tab.charAt((triplet >> 6 * (3 - j)) & 0x3F);}
            }
        }
        return str;
    };
    BI.MD5 = new MD5();
})();// 线段树
(function () {
    var parent = function (node) {
        return Math.floor(node / 2);
    };

    var Int32Array = window.Int32Array || function (size) {
        var xs = [];
        for (var i = size - 1; i >= 0; --i) {
            xs[i] = 0;
        }
        return xs;
    };

    var ceilLog2 = function (x) {
        var y = 1;
        while (y < x) {
            y *= 2;
        }
        return y;
    };

    BI.PrefixIntervalTree = function (xs) {
        this._size = xs.length;
        this._half = ceilLog2(this._size);
        this._heap = new Int32Array(2 * this._half);

        var i;
        for (i = 0; i < this._size; ++i) {
            this._heap[this._half + i] = xs[i];
        }

        for (i = this._half - 1; i > 0; --i) {
            this._heap[i] = this._heap[2 * i] + this._heap[2 * i + 1];
        }
    };

    BI.PrefixIntervalTree.prototype = {
        constructor: BI.PrefixIntervalTree,
        set: function (index, value) {
            var node = this._half + index;
            this._heap[node] = value;

            node = parent(node);
            for (; node !== 0; node = parent(node)) {
                this._heap[node] =
                    this._heap[2 * node] + this._heap[2 * node + 1];
            }
        },

        get: function (index) {
            var node = this._half + index;
            return this._heap[node];
        },

        getSize: function () {
            return this._size;
        },

        /**
         * get(0) + get(1) + ... + get(end - 1).
         */
        sumUntil: function (end) {
            if (end === 0) {
                return 0;
            }

            var node = this._half + end - 1;
            var sum = this._heap[node];
            for (; node !== 1; node = parent(node)) {
                if (node % 2 === 1) {
                    sum += this._heap[node - 1];
                }
            }

            return sum;
        },

        /**
         * get(0) + get(1) + ... + get(inclusiveEnd).
         */
        sumTo: function (inclusiveEnd) {
            return this.sumUntil(inclusiveEnd + 1);
        },

        /**
         * sum get(begin) + get(begin + 1) + ... + get(end - 1).
         */
        sum: function (begin, end) {
            return this.sumUntil(end) - this.sumUntil(begin);
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and sumUntil(i) <= t, or
         * -1 if no such i exists.
         */
        greatestLowerBound: function (t) {
            if (t < 0) {
                return -1;
            }

            var node = 1;
            if (this._heap[node] <= t) {
                return this._size;
            }

            while (node < this._half) {
                var leftSum = this._heap[2 * node];
                if (t < leftSum) {
                    node = 2 * node;
                } else {
                    node = 2 * node + 1;
                    t -= leftSum;
                }
            }

            return node - this._half;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and sumUntil(i) < t, or
         * -1 if no such i exists.
         */
        greatestStrictLowerBound: function (t) {
            if (t <= 0) {
                return -1;
            }

            var node = 1;
            if (this._heap[node] < t) {
                return this._size;
            }

            while (node < this._half) {
                var leftSum = this._heap[2 * node];
                if (t <= leftSum) {
                    node = 2 * node;
                } else {
                    node = 2 * node + 1;
                    t -= leftSum;
                }
            }

            return node - this._half;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and t <= sumUntil(i), or
         * size + 1 if no such i exists.
         */
        leastUpperBound: function (t) {
            return this.greatestStrictLowerBound(t) + 1;
        },

        /**
         * Returns the smallest i such that 0 <= i <= size and t < sumUntil(i), or
         * size + 1 if no such i exists.
         */
        leastStrictUpperBound: function (t) {
            return this.greatestLowerBound(t) + 1;
        }
    };

    BI.PrefixIntervalTree.uniform = function (size, initialValue) {
        var xs = [];
        for (var i = size - 1; i >= 0; --i) {
            xs[i] = initialValue;
        }

        return new BI.PrefixIntervalTree(xs);
    };

    BI.PrefixIntervalTree.empty = function (size) {
        return BI.PrefixIntervalTree.uniform(size, 0);
    };

})();

!(function () {
    BI.Queue = function (capacity) {
        this.capacity = capacity;
        this.array = [];
    };
    BI.Queue.prototype = {
        constructor: BI.Queue,

        contains: function (v) {
            return this.array.contains(v);
        },

        indexOf: function (v) {
            return this.array.contains(v);
        },

        getElementByIndex: function (index) {
            return this.array[index];
        },

        push: function (v) {
            this.array.push(v);
            if (this.capacity && this.array.length > this.capacity) {
                this.array.shift();
            }
        },

        pop: function () {
            this.array.pop();
        },

        shift: function () {
            this.array.shift();
        },

        unshift: function (v) {
            this.array.unshift(v);
            if (this.capacity && this.array.length > this.capacity) {
                this.array.pop();
            }
        },

        remove: function (v) {
            this.array.remove(v);
        },

        splice: function () {
            this.array.splice.apply(this.array, arguments);
        },

        slice: function () {
            this.array.slice.apply(this.array, arguments);
        },

        size: function () {
            return this.array.length;
        },

        each: function (fn, scope) {
            var scope = scope || window;
            var fn = fn || null;
            if (fn == null || typeof (fn) !== "function") {
                return;
            }
            for (var i = 0; i < this.array.length; i++) {
                var re = fn.call(scope, i, this.array[i], this.array);
                if (re == false) {
                    break;
                }
            }
        },

        toArray: function () {
            return this.array;
        },

        fromArray: function (array) {
            var self = this;
            BI.each(array, function (i, v) {
                self.push(v);
            });
        },

        clear: function () {
            this.array.length = 0;
        }
    };
})();!(function () {
    var Section = function (height, width, x, y) {
        this.height = height;
        this.width = width;
        this.x = x;
        this.y = y;

        this._indexMap = {};
        this._indices = [];
    };

    Section.prototype = {
        constructor: Section,
        addCellIndex: function (index) {
            if (!this._indexMap[index]) {
                this._indexMap[index] = true;
                this._indices.push(index);
            }
        },

        getCellIndices: function () {
            return this._indices;
        }
    };

    var SECTION_SIZE = 100;
    BI.SectionManager = function (sectionSize) {
        this._sectionSize = sectionSize || SECTION_SIZE;
        this._cellMetadata = [];
        this._sections = {};
    };

    BI.SectionManager.prototype = {
        constructor: BI.SectionManager,
        getCellIndices: function (height, width, x, y) {
            var indices = {};

            BI.each(this.getSections(height, width, x, y), function (i, section) {
                BI.each(section.getCellIndices(), function (j, index) {
                    indices[index] = index;
                });
            });

            return BI.map(BI.keys(indices), function (i, index) {
                return indices[index];
            });
        },

        getCellMetadata: function (index) {
            return this._cellMetadata[index];
        },

        getSections: function (height, width, x, y) {
            var sectionXStart = Math.floor(x / this._sectionSize);
            var sectionXStop = Math.floor((x + width - 1) / this._sectionSize);
            var sectionYStart = Math.floor(y / this._sectionSize);
            var sectionYStop = Math.floor((y + height - 1) / this._sectionSize);

            var sections = [];

            for (var sectionX = sectionXStart; sectionX <= sectionXStop; sectionX++) {
                for (var sectionY = sectionYStart; sectionY <= sectionYStop; sectionY++) {
                    var key = sectionX + "." + sectionY;

                    if (!this._sections[key]) {
                        this._sections[key] = new Section(this._sectionSize, this._sectionSize, sectionX * this._sectionSize, sectionY * this._sectionSize);
                    }

                    sections.push(this._sections[key]);
                }
            }

            return sections;
        },

        getTotalSectionCount: function () {
            return BI.size(this._sections);
        },

        registerCell: function (cellMetadatum, index) {
            this._cellMetadata[index] = cellMetadatum;

            BI.each(this.getSections(cellMetadatum.height, cellMetadatum.width, cellMetadatum.x, cellMetadatum.y), function (i, section) {
                section.addCellIndex(index);
            });
        }
    };
})();
(function () {
    var clamp = function (value, min, max) {
        if (value < min) {
            return min;
        }
        if (value > max) {
            return max;
        }
        return value;
    };
    var MIN_BUFFER_ROWS = 6;
    var MAX_BUFFER_ROWS = 10;

    BI.TableRowBuffer = function (rowsCount,
        defaultRowHeight,
        viewportHeight,
        rowHeightGetter) {
        this._bufferSet = new BI.IntegerBufferSet();
        this._defaultRowHeight = defaultRowHeight;
        this._viewportRowsBegin = 0;
        this._viewportRowsEnd = 0;
        this._maxVisibleRowCount = Math.ceil(viewportHeight / defaultRowHeight) + 1;
        // this._bufferRowsCount = Math.floor(this._maxVisibleRowCount / 2);
        this._bufferRowsCount = clamp(
            Math.floor(this._maxVisibleRowCount / 2),
            MIN_BUFFER_ROWS,
            MAX_BUFFER_ROWS
        );
        this._rowsCount = rowsCount;
        this._rowHeightGetter = rowHeightGetter;
        this._rows = [];
        this._viewportHeight = viewportHeight;

    };
    BI.TableRowBuffer.prototype = {
        constructor: BI.TableRowBuffer,

        getRowsWithUpdatedBuffer: function () {
            var remainingBufferRows = 2 * this._bufferRowsCount;
            var bufferRowIndex =
                Math.max(this._viewportRowsBegin - this._bufferRowsCount, 0);
            while (bufferRowIndex < this._viewportRowsBegin) {
                this._addRowToBuffer(
                    bufferRowIndex,
                    this._viewportRowsBegin,
                    this._viewportRowsEnd - 1
                );
                bufferRowIndex++;
                remainingBufferRows--;
            }
            bufferRowIndex = this._viewportRowsEnd;
            while (bufferRowIndex < this._rowsCount && remainingBufferRows > 0) {
                this._addRowToBuffer(
                    bufferRowIndex,
                    this._viewportRowsBegin,
                    this._viewportRowsEnd - 1
                );
                bufferRowIndex++;
                remainingBufferRows--;
            }
            return this._rows;
        },

        getRows: function (firstRowIndex,
            firstRowOffset) {
            var top = firstRowOffset;
            var totalHeight = top;
            var rowIndex = firstRowIndex;
            var endIndex =
                Math.min(firstRowIndex + this._maxVisibleRowCount, this._rowsCount);

            this._viewportRowsBegin = firstRowIndex;
            while (rowIndex < endIndex ||
            (totalHeight < this._viewportHeight && rowIndex < this._rowsCount)) {
                this._addRowToBuffer(
                    rowIndex,
                    firstRowIndex,
                    endIndex - 1
                );
                totalHeight += this._rowHeightGetter(rowIndex);
                ++rowIndex;
                // Store index after the last viewport row as end, to be able to
                // distinguish when there are no rows rendered in viewport
                this._viewportRowsEnd = rowIndex;
            }

            return this._rows;
        },

        _addRowToBuffer: function (rowIndex,
            firstViewportRowIndex,
            lastViewportRowIndex) {
            var rowPosition = this._bufferSet.getValuePosition(rowIndex);
            var viewportRowsCount = lastViewportRowIndex - firstViewportRowIndex + 1;
            var allowedRowsCount = viewportRowsCount + this._bufferRowsCount * 2;
            if (rowPosition === null &&
                this._bufferSet.getSize() >= allowedRowsCount) {
                rowPosition =
                    this._bufferSet.replaceFurthestValuePosition(
                        firstViewportRowIndex,
                        lastViewportRowIndex,
                        rowIndex
                    );
            }
            if (rowPosition === null) {
                // We can't reuse any of existing positions for this row. We have to
                // create new position
                rowPosition = this._bufferSet.getNewPositionForValue(rowIndex);
                this._rows[rowPosition] = rowIndex;
            } else {
                // This row already is in the table with rowPosition position or it
                // can replace row that is in that position
                this._rows[rowPosition] = rowIndex;
            }
        }
    };

})();

(function () {
    BI.Tree = function () {
        this.root = new BI.Node(BI.UUID());
    };

    BI.Tree.prototype = {
        constructor: BI.Tree,
        addNode: function (node, newNode, index) {
            if (BI.isNull(newNode)) {
                this.root.addChild(node, index);
            } else if (BI.isNull(node)) {
                this.root.addChild(newNode, index);
            } else {
                node.addChild(newNode, index);
            }
        },

        isRoot: function (node) {
            return node === this.root;
        },

        getRoot: function () {
            return this.root;
        },

        clear: function () {
            this.root.clear();
        },

        initTree: function (nodes) {
            var self = this;
            this.clear();
            var queue = [];
            BI.each(nodes, function (i, node) {
                var n = new BI.Node(node);
                n.set("data", node);
                self.addNode(n);
                queue.push(n);
            });
            while (!BI.isEmpty(queue)) {
                var parent = queue.shift();
                var node = parent.get("data");
                BI.each(node.children, function (i, child) {
                    var n = new BI.Node(child);
                    n.set("data", child);
                    queue.push(n);
                    self.addNode(parent, n);
                });
            }
        },

        _toJSON: function (node) {
            var self = this;
            var children = [];
            BI.each(node.getChildren(), function (i, child) {
                children.push(self._toJSON(child));
            });
            return BI.extend({
                id: node.id
            }, BI.deepClone(node.get("data")), (children.length > 0 ? {
                    children: children
                } : {}));
        },

        toJSON: function (node) {
            var self = this, result = [];
            BI.each((node || this.root).getChildren(), function (i, child) {
                result.push(self._toJSON(child));
            });
            return result;
        },

        _toJSONWithNode: function (node) {
            var self = this;
            var children = [];
            BI.each(node.getChildren(), function (i, child) {
                children.push(self._toJSONWithNode(child));
            });
            return BI.extend({
                id: node.id
            }, BI.deepClone(node.get("data")), {
                node: node
            }, (children.length > 0 ? {
                    children: children
                } : {}));
        },

        toJSONWithNode: function (node) {
            var self = this, result = [];
            BI.each((node || this.root).getChildren(), function (i, child) {
                result.push(self._toJSONWithNode(child));
            });
            return result;
        },

        search: function (root, target, param) {
            if (!(root instanceof BI.Node)) {
                return arguments.callee.apply(this, [this.root, root, target]);
            }
            var self = this, next = null;

            if (BI.isNull(target)) {
                return null;
            }
            if (BI.isEqual(root[param || "id"], target)) {
                return root;
            }
            BI.any(root.getChildren(), function (i, child) {
                next = self.search(child, target, param);
                if (null !== next) {
                    return true;
                }
            });
            return next;
        },

        _traverse: function (node, callback) {
            var queue = [];
            queue.push(node);
            while (!BI.isEmpty(queue)) {
                var temp = queue.shift();
                var b = callback && callback(temp);
                if (b === false) {
                    break;
                }
                if (b === true) {
                    continue;
                }
                if (temp != null) {
                    queue = queue.concat(temp.getChildren());
                }
            }
        },

        traverse: function (callback) {
            this._traverse(this.root, callback);
        },

        _recursion: function (node, route, callback) {
            var self = this;
            return BI.every(node.getChildren(), function (i, child) {
                var next = BI.clone(route);
                next.push(child.id);
                var b = callback && callback(child, next);
                if (b === false) {
                    return false;
                }
                if (b === true) {
                    return true;
                }
                return self._recursion(child, next, callback);
            });
        },

        recursion: function (callback) {
            this._recursion(this.root, [], callback);
        },

        inOrderTraverse: function (callback) {
            this._inOrderTraverse(this.root, callback);
        },

        // 中序遍历(递归)
        _inOrderTraverse: function (node, callback) {
            if (node != null) {
                this._inOrderTraverse(node.getLeft());
                callback && callback(node);
                this._inOrderTraverse(node.getRight());
            }
        },

        // 中序遍历(非递归)
        nrInOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;
            while (node != null || !BI.isEmpty(stack)) {
                while (node != null) {
                    stack.push(node);
                    node = node.getLeft();
                }
                node = stack.pop();
                callback && callback(node);
                node = node.getRight();
            }
        },

        preOrderTraverse: function (callback) {
            this._preOrderTraverse(this.root, callback);
        },

        // 先序遍历(递归)
        _preOrderTraverse: function (node, callback) {
            if (node != null) {
                callback && callback(node);
                this._preOrderTraverse(node.getLeft());
                this._preOrderTraverse(node.getRight());
            }
        },

        // 先序遍历(非递归)
        nrPreOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;

            while (node != null || !BI.isEmpty(stack)) {

                while (node != null) {
                    callback && callback(node);
                    stack.push(node);
                    node = node.getLeft();
                }
                node = stack.pop();
                node = node.getRight();
            }
        },

        postOrderTraverse: function (callback) {
            this._postOrderTraverse(this.root, callback);
        },

        // 后序遍历(递归)
        _postOrderTraverse: function (node, callback) {
            if (node != null) {
                this._postOrderTraverse(node.getLeft());
                this._postOrderTraverse(node.getRight());
                callback && callback(node);
            }
        },

        // 后续遍历(非递归)
        nrPostOrderTraverse: function (callback) {

            var stack = [];
            var node = this.root;
            var preNode = null;// 表示最近一次访问的节点

            while (node != null || !BI.isEmpty(stack)) {

                while (node != null) {
                    stack.push(node);
                    node = node.getLeft();
                }

                node = BI.last(stack);

                if (node.getRight() == null || node.getRight() == preNode) {
                    callback && callback(node);
                    node = stack.pop();
                    preNode = node;
                    node = null;
                } else {
                    node = node.getRight();
                }
            }
        }
    };

    BI.Node = function (id) {
        if (BI.isObject(id)) {
            BI.extend(this, id);
        } else {
            this.id = id;
        }
        this.clear.apply(this, arguments);
    };

    BI.Node.prototype = {
        constructor: BI.Node,

        set: function (key, value) {
            if (BI.isObject(key)) {
                BI.extend(this, key);
                return;
            }
            this[key] = value;
        },

        get: function (key) {
            return this[key];
        },

        isLeaf: function () {
            return BI.isEmpty(this.children);
        },

        getChildren: function () {
            return this.children;
        },

        getChildrenLength: function () {
            return this.children.length;
        },

        getFirstChild: function () {
            return BI.first(this.children);
        },

        getLastChild: function () {
            return BI.last(this.children);
        },

        setLeft: function (left) {
            this.left = left;
        },

        getLeft: function () {
            return this.left;
        },

        setRight: function (right) {
            this.right = right;
        },

        getRight: function () {
            return this.right;
        },

        setParent: function (parent) {
            this.parent = parent;
        },

        getParent: function () {
            return this.parent;
        },

        getChild: function (index) {
            return this.children[index];
        },

        getChildIndex: function (id) {
            return BI.findIndex(this.children, function (i, ch) {
                return ch.get("id") === id;
            });
        },

        removeChild: function (id) {
            this.removeChildByIndex(this.getChildIndex(id));
        },

        removeChildByIndex: function (index) {
            var before = this.getChild(index - 1);
            var behind = this.getChild(index + 1);
            if (before != null) {
                before.setRight(behind || null);
            }
            if (behind != null) {
                behind.setLeft(before || null);
            }
            this.children.splice(index, 1);
        },

        removeAllChilds: function () {
            this.children = [];
        },

        addChild: function (child, index) {
            var cur = null;
            if (BI.isUndefined(index)) {
                cur = this.children.length - 1;
            } else {
                cur = index - 1;
            }
            child.setParent(this);
            if (cur >= 0) {
                this.getChild(cur) && this.getChild(cur).setRight(child);
                child.setLeft(this.getChild(cur));
            }
            if (BI.isUndefined(index)) {
                this.children.push(child);
            } else {
                this.children.splice(index, 0, child);
            }
        },

        equals: function (obj) {
            return this === obj || this.id === obj.id;
        },

        clear: function () {
            this.parent = null;
            this.left = null;
            this.right = null;
            this.children = [];
        }
    };

    BI.extend(BI.Tree, {
        transformToArrayFormat: function (nodes, pId) {
            if (!nodes) return [];
            var r = [];
            if (BI.isArray(nodes)) {
                for (var i = 0, l = nodes.length; i < l; i++) {
                    var node = BI.clone(nodes[i]);
                    node.pId = node.pId == null ? pId : node.pId;
                    delete node.children;
                    r.push(node);
                    if (nodes[i]["children"]) {
                        r = r.concat(BI.Tree.transformToArrayFormat(nodes[i]["children"], node.id));
                    }
                }
            } else {
                var newNodes = BI.clone(nodes);
                newNodes.pId = newNodes.pId == null ? pId : newNodes.pId;
                delete newNodes.children;
                r.push(newNodes);
                if (nodes["children"]) {
                    r = r.concat(BI.Tree.transformToArrayFormat(nodes["children"], newNodes.id));
                }
            }
            return r;
        },

        arrayFormat: function (nodes, pId) {
            if (!nodes) {
                return [];
            }
            var r = [];
            if (BI.isArray(nodes)) {
                for (var i = 0, l = nodes.length; i < l; i++) {
                    var node = nodes[i];
                    node.pId = node.pId == null ? pId : node.pId;
                    r.push(node);
                    if (nodes[i]["children"]) {
                        r = r.concat(BI.Tree.arrayFormat(nodes[i]["children"], node.id));
                    }
                }
            } else {
                var newNodes = nodes;
                newNodes.pId = newNodes.pId == null ? pId : newNodes.pId;
                r.push(newNodes);
                if (nodes["children"]) {
                    r = r.concat(BI.Tree.arrayFormat(nodes["children"], newNodes.id));
                }
            }
            return r;
        },

        transformToTreeFormat: function (sNodes) {
            var i, l;
            if (!sNodes) {
                return [];
            }

            if (BI.isArray(sNodes)) {
                var r = [];
                var tmpMap = [];
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (BI.isNull(sNodes[i].id)) {
                        return sNodes;
                    }
                    tmpMap[sNodes[i].id] = BI.clone(sNodes[i]);
                }
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) {
                        if (!tmpMap[sNodes[i].pId].children) {
                            tmpMap[sNodes[i].pId].children = [];
                        }
                        tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]);
                    } else {
                        r.push(tmpMap[sNodes[i].id]);
                    }
                    delete tmpMap[sNodes[i].id].pId;
                }
                return r;
            }
            return [sNodes];
            
        },

        treeFormat: function (sNodes) {
            var i, l;
            if (!sNodes) {
                return [];
            }

            if (BI.isArray(sNodes)) {
                var r = [];
                var tmpMap = [];
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (BI.isNull(sNodes[i].id)) {
                        return sNodes;
                    }
                    tmpMap[sNodes[i].id] = sNodes[i];
                }
                for (i = 0, l = sNodes.length; i < l; i++) {
                    if (tmpMap[sNodes[i].pId] && sNodes[i].id !== sNodes[i].pId) {
                        if (!tmpMap[sNodes[i].pId].children) {
                            tmpMap[sNodes[i].pId].children = [];
                        }
                        tmpMap[sNodes[i].pId].children.push(tmpMap[sNodes[i].id]);
                    } else {
                        r.push(tmpMap[sNodes[i].id]);
                    }
                }
                return r;
            }
            return [sNodes];
            
        },

        traversal: function (array, callback) {
            if (BI.isNull(array)) {
                return;
            }
            var self = this;
            BI.any(array, function (i, item) {
                if (callback(i, item) === false) {
                    return true;
                }
                self.traversal(item.children, callback);
            });
        }
    });
})();// 向量操作
BI.Vector = function (x, y) {
    this.x = x;
    this.y = y;
};
BI.Vector.prototype = {
    constructor: BI.Vector,
    cross: function (v) {
        return (this.x * v.y - this.y * v.x);
    },
    length: function (v) {
        return (Math.sqrt(this.x * v.x + this.y * v.y));
    }
};
BI.Region = function (x, y, w, h) {
    this.x = x;
    this.y = y;
    this.w = w;
    this.h = h;
};
BI.Region.prototype = {
    constructor: BI.Region,
    // 判断两个区域是否相交,若相交,则要么顶点互相包含,要么矩形边界(或对角线)相交
    isIntersects: function (obj) {
        if (this.isPointInside(obj.x, obj.y) ||
            this.isPointInside(obj.x + obj.w, obj.y) ||
            this.isPointInside(obj.x, obj.y + obj.h) ||
            this.isPointInside(obj.x + obj.w, obj.y + obj.h)) {
            return true;
        } else if (obj.isPointInside(this.x, this.y) ||
            obj.isPointInside(this.x + this.w, this.y) ||
            obj.isPointInside(this.x, this.y + this.h) ||
            obj.isPointInside(this.x + this.w, this.y + this.h)) {
            return true;
        } else if (obj.x != null && obj.y != null)// 判断矩形对角线相交 |v1 X v2||v1 X v3| < 0
        {
            var vector1 = new BI.Vector(this.w, this.h);// 矩形对角线向量
            var vector2 = new BI.Vector(obj.x - this.x, obj.y - this.y);
            var vector3 = new BI.Vector(vector2.x + obj.w, vector2.y + obj.h);
            if ((vector1.cross(vector2) * vector1.cross(vector3)) < 0) {
                return true;
            }
        }
        return false;
    },
    // 判断一个点是否在这个区域内部
    isPointInside: function (x, y) {
        if (this.x == null || this.y == null) {
            return false;
        }
        if (x >= this.x && x <= this.x + this.w && y >= this.y && y <= this.y + this.h) {
            return true;
        }
        return false;
    },
    // 返回区域的重心,因为是矩形所以返回中点
    getPosition: function () {
        var pos = [];
        pos.push(this.x + this.w / 2);
        pos.push(this.y + this.h / 2);
        return pos;
    }
};BI.BehaviorFactory = {
    createBehavior: function (key, options) {
        var behavior;
        switch (key) {
            case "highlight":
                behavior = BI.HighlightBehavior;
                break;
            case "redmark":
                behavior = BI.RedMarkBehavior;
                break;
        }
        return new behavior(options);
    }
};

/**
 * guy
 * 行为控件
 * @class BI.Behavior
 * @extends BI.OB
 */
BI.Behavior = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.Behavior.superclass._defaultConfig.apply(this, arguments), {
            rule: function () {return true;}
        });
    },

    _init: function () {
        BI.Behavior.superclass._init.apply(this, arguments);

    },

    doBehavior: function () {

    }
});/**
 * 布局容器类
 * @class BI.Layout
 * @extends BI.Widget
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Boolean} [options.scrollable=false] 子组件超出容器边界之后是否会出现滚动条
 * @cfg {Boolean} [options.scrollx=false] 子组件超出容器边界之后是否会出现横向滚动条
 * @cfg {Boolean} [options.scrolly=false] 子组件超出容器边界之后是否会出现纵向滚动条
 */
BI.Layout = BI.inherit(BI.Widget, {
    props: function () {
        return {
            scrollable: null, // true, false, null
            scrollx: false, // true, false
            scrolly: false, // true, false
            items: []
        };
    },

    render: function () {
        this._init4Margin();
        this._init4Scroll();
    },

    _init4Margin: function () {
        if (this.options.top) {
            this.element.css("top", this.options.top);
        }
        if (this.options.left) {
            this.element.css("left", this.options.left);
        }
        if (this.options.bottom) {
            this.element.css("bottom", this.options.bottom);
        }
        if (this.options.right) {
            this.element.css("right", this.options.right);
        }
    },

    _init4Scroll: function () {
        switch (this.options.scrollable) {
            case true:
                this.element.css("overflow", "auto");
                break;
            case false:
                this.element.css("overflow", "hidden");
                break;
            default :
                break;
        }
        if (this.options.scrollx) {
            this.element.css({
                "overflow-x": "auto",
                "overflow-y": "hidden"
            });
        }
        if (this.options.scrolly) {
            this.element.css({
                "overflow-x": "hidden",
                "overflow-y": "auto"
            });
        }
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.element.append(frag);
        }
    },

    _getChildName: function (index) {
        return index + "";
    },

    _addElement: function (i, item) {
        var self = this, w;
        if (!this.hasWidget(this._getChildName(i))) {
            w = BI.createWidget(item);
            w.on(BI.Events.DESTROY, function () {
                BI.each(self._children, function (name, child) {
                    if (child === w) {
                        BI.remove(self._children, child);
                        self.removeItemAt(name | 0);
                    }
                });
            });
            this.addWidget(this._getChildName(i), w);
        } else {
            w = this.getWidgetByName(this._getChildName(i));
        }
        return w;
    },

    _getOptions: function (item) {
        if (item instanceof BI.Widget) {
            item = item.options;
        }
        item = BI.stripEL(item);
        if (item instanceof BI.Widget) {
            item = item.options;
        }
        return item;
    },

    _compare: function (item1, item2) {
        var self = this;
        return eq(item1, item2);

        // 不比较函数
        function eq (a, b, aStack, bStack) {
            if (a === b) {
                return a !== 0 || 1 / a === 1 / b;
            }
            if (a == null || b == null) {
                return a === b;
            }
            var className = Object.prototype.toString.call(a);
            switch (className) {
                case "[object RegExp]":
                case "[object String]":
                    return "" + a === "" + b;
                case "[object Number]":
                    if (+a !== +a) {
                        return +b !== +b;
                    }
                    return +a === 0 ? 1 / +a === 1 / b : +a === +b;
                case "[object Date]":
                case "[object Boolean]":
                    return +a === +b;
            }

            var areArrays = className === "[object Array]";
            if (!areArrays) {
                if (BI.isFunction(a) && BI.isFunction(b)) {
                    return true;
                }
                a = self._getOptions(a);
                b = self._getOptions(b);
            }

            aStack = aStack || [];
            bStack = bStack || [];
            var length = aStack.length;
            while (length--) {
                if (aStack[length] === a) {
                    return bStack[length] === b;
                }
            }

            aStack.push(a);
            bStack.push(b);

            if (areArrays) {
                length = a.length;
                if (length !== b.length) {
                    return false;
                }
                while (length--) {
                    if (!eq(a[length], b[length], aStack, bStack)) {
                        return false;
                    }
                }
            } else {
                var keys = _.keys(a), key;
                length = keys.length;
                if (_.keys(b).length !== length) {
                    return false;
                }
                while (length--) {
                    key = keys[length];
                    if (!(_.has(b, key) && eq(a[key], b[key], aStack, bStack))) {
                        return false;
                    }
                }
            }
            aStack.pop();
            bStack.pop();
            return true;
        }
    },

    _getWrapper: function () {
        return this.element;
    },

    _addItemAt: function (index, item) {
        for (var i = this.options.items.length; i > index; i--) {
            this._children[this._getChildName(i)] = this._children[this._getChildName(i - 1)];
        }
        delete this._children[this._getChildName(index)];
        this.options.items.splice(index, 0, item);
    },

    _removeItemAt: function (index) {
        for (var i = index; i < this.options.items.length - 1; i++) {
            this._children[this._getChildName(i)] = this._children[this._getChildName(i + 1)];
        }
        delete this._children[this._getChildName(this.options.items.length - 1)];
        this.options.items.splice(index, 1);
    },

    /**
     * 添加一个子组件到容器中
     * @param {JSON/BI.Widget} item 子组件
     */
    addItem: function (item) {
        return this.addItemAt(this.options.items.length, item);
    },

    prependItem: function (item) {
        return this.addItemAt(0, item);
    },

    addItemAt: function (index, item) {
        if (index < 0 || index > this.options.items.length) {
            return;
        }
        this._addItemAt(index, item);
        var w = this._addElement(index, item);
        if (index > 0) {
            this._children[this._getChildName(index - 1)].element.after(w.element);
        } else {
            w.element.prependTo(this._getWrapper());
        }
        w._mount();
        return w;
    },

    removeItemAt: function (indexes) {
        indexes = BI.isArray(indexes) ? indexes : [indexes];
        var deleted = [];
        var newItems = [], newChildren = {};
        for (var i = 0, len = this.options.items.length; i < len; i++) {
            var child = this._children[this._getChildName(i)];
            if (indexes.contains(i)) {
                child && deleted.push(child);
            } else {
                newChildren[this._getChildName(newItems.length)] = child;
                newItems.push(this.options.items[i]);
            }
        }
        this.options.items = newItems;
        this._children = newChildren;
        BI.each(deleted, function (i, c) {
            c._destroy();
        });
    },

    shouldUpdateItem: function (index, item) {
        if (index < 0 || index > this.options.items.length - 1) {
            return false;
        }
        var child = this._children[this._getChildName(index)];
        if (!child.shouldUpdate) {
            return null;
        }
        return child.shouldUpdate(this._getOptions(item)) === true;
    },

    updateItemAt: function (index, item) {
        if (index < 0 || index > this.options.items.length - 1) {
            return;
        }

        var child = this._children[this._getChildName(index)];
        var updated;
        if (updated = child.update(this._getOptions(item))) {
            return updated;
        }
        var del = this._children[this._getChildName(index)];
        delete this._children[this._getChildName(index)];
        this.options.items.splice(index, 1);
        var w = this._addElement(index, item);
        this.options.items.splice(index, 0, item);
        this._children[this._getChildName(index)] = w;
        if (index > 0) {
            this._children[this._getChildName(index - 1)].element.after(w.element);
        } else {
            w.element.prependTo(this._getWrapper());
        }
        del._destroy();
        w._mount();
    },

    addItems: function (items) {
        var self = this, o = this.options;
        var fragment = document.createDocumentFragment();
        var added = [];
        BI.each(items, function (i, item) {
            var w = self._addElement(o.items.length, item);
            self._children[self._getChildName(o.items.length)] = w;
            o.items.push(item);
            added.push(w);
            fragment.appendChild(w.element[0]);
        });
        this._getWrapper().append(fragment);
        BI.each(added, function (i, w) {
            w._mount();
        });
    },

    prependItems: function (items) {
        var self = this;
        items = items || [];
        var fragment = document.createDocumentFragment();
        var added = [];
        for (var i = items.length - 1; i >= 0; i--) {
            this._addItemAt(0, items[i]);
            var w = this._addElement(0, items[i]);
            self._children[self._getChildName(0)] = w;
            this.options.items.unshift(items[i]);
            added.push(w);
            fragment.appendChild(w.element[0]);
        }
        this._getWrapper().prepend(fragment);
        BI.each(added, function (i, w) {
            w._mount();
        });
    },

    getValue: function () {
        var self = this, value = [], child;
        BI.each(this.options.items, function (i) {
            if (child = self._children[self._getChildName(i)]) {
                var v = child.getValue();
                v = BI.isArray(v) ? v : [v];
                value = value.concat(v);
            }
        });
        return value;
    },

    setValue: function (v) {
        var self = this, child;
        BI.each(this.options.items, function (i) {
            if (child = self._children[self._getChildName(i)]) {
                child.setValue(v);
            }
        });
    },

    setText: function (v) {
        var self = this, child;
        BI.each(this.options.items, function (i) {
            if (child = self._children[self._getChildName(i)]) {
                child.setText(v);
            }
        });
    },

    patchItem: function (oldVnode, vnode, index) {
        var shouldUpdate = this.shouldUpdateItem(index, vnode);
        if (shouldUpdate === true || (shouldUpdate === null && !this._compare(oldVnode, vnode))) {
            return this.updateItemAt(index, vnode);
        }
    },

    updateChildren: function (oldCh, newCh) {
        var self = this;
        var oldStartIdx = 0, newStartIdx = 0;
        var oldEndIdx = oldCh.length - 1;
        var oldStartVnode = oldCh[0];
        var oldEndVnode = oldCh[oldEndIdx];
        var newEndIdx = newCh.length - 1;
        var newStartVnode = newCh[0];
        var newEndVnode = newCh[newEndIdx];
        var before;
        var updated;
        var children = {};
        BI.each(oldCh, function (i, child) {
            child = self._getOptions(child);
            var key = child.key == null ? i : child.key;
            if (BI.isKey(key)) {
                children[key] = self._children[self._getChildName(i)];
            }
        });

        while (oldStartIdx <= oldEndIdx && newStartIdx <= newEndIdx) {
            if (BI.isNull(oldStartVnode)) {
                oldStartVnode = oldCh[++oldStartIdx];
            } else if (BI.isNull(oldEndVnode)) {
                oldEndVnode = oldCh[--oldEndIdx];
            } else if (sameVnode(oldStartVnode, newStartVnode, oldStartIdx, newStartIdx)) {
                updated = this.patchItem(oldStartVnode, newStartVnode, oldStartIdx) || updated;
                children[oldStartVnode.key == null ? this._getChildName(oldStartIdx) : oldStartVnode.key] = this._children[this._getChildName(oldStartIdx)];
                oldStartVnode = oldCh[++oldStartIdx];
                newStartVnode = newCh[++newStartIdx];
            } else if (sameVnode(oldEndVnode, newEndVnode, oldEndIdx, newEndIdx)) {
                updated = this.patchItem(oldEndVnode, newEndVnode, oldEndIdx) || updated;
                children[oldEndVnode.key == null ? this._getChildName(oldEndIdx) : oldEndVnode.key] = this._children[this._getChildName(oldEndIdx)];
                oldEndVnode = oldCh[--oldEndIdx];
                newEndVnode = newCh[--newEndIdx];
            } else if (sameVnode(oldStartVnode, newEndVnode)) {
                updated = this.patchItem(oldStartVnode, newEndVnode, oldStartIdx) || updated;
                children[oldStartVnode.key == null ? this._getChildName(oldStartIdx) : oldStartVnode.key] = this._children[this._getChildName(oldStartIdx)];
                insertBefore(oldStartVnode, oldEndVnode, true);
                oldStartVnode = oldCh[++oldStartIdx];
                newEndVnode = newCh[--newEndIdx];
            } else if (sameVnode(oldEndVnode, newStartVnode)) {
                updated = this.patchItem(oldEndVnode, newStartVnode, oldEndIdx) || updated;
                children[oldEndVnode.key == null ? this._getChildName(oldEndIdx) : oldEndVnode.key] = this._children[this._getChildName(oldEndIdx)];
                insertBefore(oldEndVnode, oldStartVnode);
                oldEndVnode = oldCh[--oldEndIdx];
                newStartVnode = newCh[++newStartIdx];
            } else {
                var node = addNode(newStartVnode);
                insertBefore(node, oldStartVnode);
                newStartVnode = newCh[++newStartIdx];
            }
        }
        if (oldStartIdx > oldEndIdx) {
            before = BI.isNull(newCh[newEndIdx + 1]) ? null : newCh[newEndIdx + 1].elm;
            addVnodes(before, newCh, newStartIdx, newEndIdx);
        } else if (newStartIdx > newEndIdx) {
            removeVnodes(oldCh, oldStartIdx, oldEndIdx);
        }

        this._children = {};
        BI.each(newCh, function (i, child) {
            var node = self._getOptions(child);
            var key = node.key == null ? i : node.key;
            children[key]._mount();
            self._children[self._getChildName(i)] = children[key];
        });

        function sameVnode (vnode1, vnode2, oldIndex, newIndex) {
            vnode1 = self._getOptions(vnode1);
            vnode2 = self._getOptions(vnode2);
            if (BI.isKey(vnode1.key)) {
                return vnode1.key === vnode2.key;
            }
            if (oldIndex >= 0) {
                return oldIndex === newIndex;
            }
        }

        function addNode (vnode, index) {
            var opt = self._getOptions(vnode);
            var key = opt.key == null ? index : opt.key;
            return children[key] = self._addElement(key, vnode);
        }

        function addVnodes (before, vnodes, startIdx, endIdx) {
            for (; startIdx <= endIdx; ++startIdx) {
                var node = addNode(vnodes[startIdx], startIdx);
                insertBefore(node, before, false, startIdx);
            }
        }

        function removeVnodes (vnodes, startIdx, endIdx) {
            for (; startIdx <= endIdx; ++startIdx) {
                var node = self._getOptions(vnodes[startIdx]);
                var key = node.key == null ? startIdx : node.key;
                children[key]._destroy();
            }
        }

        function insertBefore (insert, before, isNext, index) {
            insert = self._getOptions(insert);
            before = before && self._getOptions(before);
            var insertKey = BI.isKey(insert.key) ? insert.key : index;
            if (before && children[before.key]) {
                var beforeKey = BI.isKey(before.key) ? before.key : index;
                var next;
                if (isNext) {
                    next = children[beforeKey].element.next();
                } else {
                    next = children[beforeKey].element;
                }
                if (next.length > 0) {
                    next.before(children[insertKey].element);
                } else {
                    self._getWrapper().append(children[insertKey].element);
                }
            } else {
                self._getWrapper().append(children[insertKey].element);
            }
        }

        return updated;
    },

    update: function (opt) {
        var o = this.options;
        var items = opt.items || [];
        var updated = this.updateChildren(o.items, items);
        this.options.items = items;
        return updated;
        // var updated, i, len;
        // for (i = 0, len = Math.min(o.items.length, items.length); i < len; i++) {
        //     if (!this._compare(o.items[i], items[i])) {
        //         updated = this.updateItemAt(i, items[i]) || updated;
        //     }
        // }
        // if (o.items.length > items.length) {
        //     var deleted = [];
        //     for (i = items.length; i < o.items.length; i++) {
        //         deleted.push(this._children[this._getChildName(i)]);
        //         delete this._children[this._getChildName(i)];
        //     }
        //     o.items.splice(items.length);
        //     BI.each(deleted, function (i, w) {
        //         w._destroy();
        //     })
        // } else if (items.length > o.items.length) {
        //     for (i = o.items.length; i < items.length; i++) {
        //         this.addItemAt(i, items[i]);
        //     }
        // }
        // return updated;
    },

    stroke: function (items) {
        var self = this;
        BI.each(items, function (i, item) {
            if (item) {
                self._addElement(i, item);
            }
        });
    },

    removeWidget: function (nameOrWidget) {
        var removeIndex;
        if (BI.isWidget(nameOrWidget)) {
            BI.each(this._children, function (name, child) {
                if (child === nameOrWidget) {
                    removeIndex = name;
                }
            });
        } else {
            removeIndex = nameOrWidget;
        }
        if (removeIndex) {
            this._removeItemAt(removeIndex | 0);
        }
    },

    empty: function () {
        BI.Layout.superclass.empty.apply(this, arguments);
        this.options.items = [];
    },

    destroy: function () {
        BI.Layout.superclass.destroy.apply(this, arguments);
        this.options.items = [];
    },

    populate: function (items) {
        var self = this, o = this.options;
        items = items || [];
        if (this._isMounted) {
            this.update({items: items});
            return;
        }
        this.options.items = items;
        this.stroke(items);
    },

    resize: function () {

    }
});
BI.shortcut("bi.layout", BI.Layout);BI.Plugin = BI.Plugin || {};
!(function () {
    var _WidgetsPlugin = {};
    var _ObjectPlugin = {};
    var _ConfigPlugin = {};
    var _GlobalWidgetConfigFn, _GlobalObjectConfigFn;
    BI.extend(BI.Plugin, {

        getWidget: function (type, options) {
            if (_GlobalWidgetConfigFn) {
                _GlobalWidgetConfigFn(type, options);
            }
            if (_ConfigPlugin[type]) {
                for (var i = _ConfigPlugin[type].length - 1; i >= 0; i--) {
                    _ConfigPlugin[type][i](options);
                }
            }
            if (_WidgetsPlugin[type]) {
                var res;
                for (var i = _WidgetsPlugin[type].length - 1; i >= 0; i--) {
                    if (res = _WidgetsPlugin[type][i](options)) {
                        return res;
                    }
                }
            }
            return options;
        },

        config: function (widgetConfigFn, objectConfigFn) {
            _GlobalWidgetConfigFn = widgetConfigFn;
            _GlobalObjectConfigFn = objectConfigFn;
        },

        configWidget: function (type, fn) {
            if (!_ConfigPlugin[type]) {
                _ConfigPlugin[type] = [];
            }
            _ConfigPlugin[type].push(fn);
        },

        registerWidget: function (type, fn) {
            if (!_WidgetsPlugin[type]) {
                _WidgetsPlugin[type] = [];
            }
            if (_WidgetsPlugin[type].length > 0) {
                console.log("组件已经注册过了!");
            }
            _WidgetsPlugin[type].push(fn);
        },

        relieveWidget: function (type) {
            delete _WidgetsPlugin[type];
        },

        getObject: function (type, object) {
            if (_GlobalObjectConfigFn) {
                _GlobalObjectConfigFn(type, object);
            }
            if (_ObjectPlugin[type]) {
                var res;
                for (var i = 0, len = _ObjectPlugin[type].length; i < len; i++) {
                    res = _ObjectPlugin[type][i](object);
                }
            }
            return res || object;
        },

        registerObject: function (type, fn) {
            if (!_ObjectPlugin[type]) {
                _ObjectPlugin[type] = [];
            }
            if (_ObjectPlugin[type].length > 0) {
                console.log("对象已经注册过了!");
            }
            _ObjectPlugin[type].push(fn);
        },

        relieveObject: function (type) {
            delete _ObjectPlugin[type];
        }
    });
})();/**
 * guy
 * 由一个元素切换到另一个元素的行为
 * @class BI.Action
 * @extends BI.OB
 * @abstract
 */
BI.Action = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.Action.superclass._defaultConfig.apply(this, arguments), {
            src: null,
            tar: null
        });
    },

    _init: function () {
        BI.Action.superclass._init.apply(this, arguments);
    },

    actionPerformed: function (src, tar, callback) {

    },

    actionBack: function (tar, src, callback) {

    }
});

BI.ActionFactory = {
    createAction: function (key, options) {
        var action;
        switch (key) {
            case "show":
                action = BI.ShowAction;
                break;
        }
        return new action(options);
    }
};/**
 * guy
 * 由一个元素切换到另一个元素的行为
 * @class BI.ShowAction
 * @extends BI.Action
 */
BI.ShowAction = BI.inherit(BI.Action, {
    _defaultConfig: function () {
        return BI.extend(BI.ShowAction.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.ShowAction.superclass._init.apply(this, arguments);
    },

    actionPerformed: function (src, tar, callback) {
        tar = tar || this.options.tar;
        tar.setVisible(true);
        callback && callback();
    },

    actionBack: function (tar, src, callback) {
        tar = tar || this.options.tar;
        tar.setVisible(false);
        callback && callback();
    }
});(function () {
    if (!window.BI) {
        window.BI = {};
    }

    function isEmpty (value) {
        // 判断是否为空值
        var result = value === "" || value === null || value === undefined;
        return result;
    }

    // 判断是否是无效的日期
    function isInvalidDate (date) {
        return date == "Invalid Date" || date == "NaN";
    }

    /**
     * 科学计数格式
     */
    function _eFormat (text, fmt) {
        var e = fmt.indexOf("E");
        var eleft = fmt.substr(0, e), eright = fmt.substr(e + 1);
        if (/^[0\.-]+$/.test(text)) {
            text = BI._numberFormat(0.0, eleft) + "E" + BI._numberFormat(0, eright);
        } else {
            var isNegative = text < 0;
            if (isNegative) {
                text = text.substr(1);
            }
            var elvl = (eleft.split(".")[0] || "").length;
            var point = text.indexOf(".");
            if (point < 0) {
                point = text.length;
            }
            var i = 0; // 第一个不为0的数的位置
            text = text.replace(".", "");
            for (var len = text.length; i < len; i++) {
                var ech = text.charAt(i);
                if (ech <= "9" && ech >= "1") {
                    break;
                }
            }
            var right = point - i - elvl;
            var left = text.substr(i, elvl);
            var dis = i + elvl - text.length;
            if (dis > 0) {
                // 末位补全0
                for (var k = 0; k < dis; k++) {
                    left += "0";
                }
            } else {
                left += "." + text.substr(i + elvl);
            }
            left = left.replace(/^[0]+/, "");
            if (right < 0 && eright.indexOf("-") < 0) {
                eright += ";-" + eright;
            }
            text = BI._numberFormat(left, eleft) + "E" + BI._numberFormat(right, eright);
            if (isNegative) {
                text = "-" + text;
            }
        }
        return text;
    }

    /**
     * 数字格式
     */
    function _numberFormat (text, format) {
        var text = text + "";
        // 数字格式,区分正负数
        var numMod = format.indexOf(";");
        if (numMod > -1) {
            if (text >= 0) {
                return _numberFormat(text + "", format.substring(0, numMod));
            }
            return _numberFormat((-text) + "", format.substr(numMod + 1));

        }
        // 兼容格式处理负数的情况(copy:fr-jquery.format.js)
        if (+text < 0 && format.charAt(0) !== "-") {
            return _numberFormat((-text) + "", "-" + format);
        }

        var tp = text.split("."), fp = format.split("."),
            tleft = tp[0] || "", fleft = fp[0] || "",
            tright = tp[1] || "", fright = fp[1] || "";
        // 百分比,千分比的小数点移位处理
        if (/[%‰]$/.test(format)) {
            var paddingZero = /[%]$/.test(format) ? "00" : "000";
            tright += paddingZero;
            tleft += tright.substr(0, paddingZero.length);
            tleft = tleft.replace(/^0+/gi, "");
            tright = tright.substr(paddingZero.length).replace(/0+$/gi, "");
        }
        var right = _dealWithRight(tright, fright);
        if (right.leftPlus) {
            // 小数点后有进位
            tleft = parseInt(tleft) + 1 + "";

            tleft = isNaN(tleft) ? "1" : tleft;
        }
        right = right.num;
        var left = _dealWithLeft(tleft, fleft);
        if (!(/[0-9]/.test(left))) {
            left = left + "0";
        }
        if (!(/[0-9]/.test(right))) {
            return left + right;
        }
        return left + "." + right;

    }

    /**
     * 处理小数点右边小数部分
     * @param tright 右边内容
     * @param fright 右边格式
     * @returns {JSON} 返回处理结果和整数部分是否需要进位
     * @private
     */
    function _dealWithRight (tright, fright) {
        var right = "", j = 0, i = 0;
        for (var len = fright.length; i < len; i++) {
            var ch = fright.charAt(i);
            var c = tright.charAt(j);
            switch (ch) {
                case "0":
                    if (isEmpty(c)) {
                        c = "0";
                    }
                    right += c;
                    j++;
                    break;
                case "#":
                    right += c;
                    j++;
                    break;
                default :
                    right += ch;
                    break;
            }
        }
        var rll = tright.substr(j);
        var result = {};
        if (!isEmpty(rll) && rll.charAt(0) > 4) {
            // 有多余字符,需要四舍五入
            result.leftPlus = true;
            var numReg = right.match(/^[0-9]+/);
            if (numReg) {
                var num = numReg[0];
                var orilen = num.length;
                var newnum = parseInt(num) + 1 + "";
                // 进位到整数部分
                if (newnum.length > orilen) {
                    newnum = newnum.substr(1);
                } else {
                    newnum = BI.leftPad(newnum, orilen, "0");
                    result.leftPlus = false;
                }
                right = right.replace(/^[0-9]+/, newnum);
            }
        }
        result.num = right;
        return result;
    }

    /**
     * 处理小数点左边整数部分
     * @param tleft 左边内容
     * @param fleft 左边格式
     * @returns {string} 返回处理结果
     * @private
     */
    function _dealWithLeft (tleft, fleft) {
        var left = "";
        var j = tleft.length - 1;
        var combo = -1, last = -1;
        var i = fleft.length - 1;
        for (; i >= 0; i--) {
            var ch = fleft.charAt(i);
            var c = tleft.charAt(j);
            switch (ch) {
                case "0":
                    if (isEmpty(c)) {
                        c = "0";
                    }
                    last = -1;
                    left = c + left;
                    j--;
                    break;
                case "#":
                    last = i;
                    left = c + left;
                    j--;
                    break;
                case ",":
                    if (!isEmpty(c)) {
                        // 计算一个,分隔区间的长度
                        var com = fleft.match(/,[#0]+/);
                        if (com) {
                            combo = com[0].length - 1;
                        }
                        left = "," + left;
                    }
                    break;
                default :
                    left = ch + left;
                    break;
            }
        }
        if (last > -1) {
            // 处理剩余字符
            var tll = tleft.substr(0, j + 1);
            left = left.substr(0, last) + tll + left.substr(last);
        }
        if (combo > 0) {
            // 处理,分隔区间
            var res = left.match(/[0-9]+,/);
            if (res) {
                res = res[0];
                var newstr = "", n = res.length - 1 - combo;
                for (; n >= 0; n = n - combo) {
                    newstr = res.substr(n, combo) + "," + newstr;
                }
                var lres = res.substr(0, n + combo);
                if (!isEmpty(lres)) {
                    newstr = lres + "," + newstr;
                }
            }
            left = left.replace(/[0-9]+,/, newstr);
        }
        return left;
    }

    BI.cjkEncode = function (text) {
        // alex:如果非字符串,返回其本身(cjkEncode(234) 返回 ""是不对的)
        if (typeof text !== "string") {
            return text;
        }

        var newText = "";
        for (var i = 0; i < text.length; i++) {
            var code = text.charCodeAt(i);
            if (code >= 128 || code === 91 || code === 93) {// 91 is "[", 93 is "]".
                newText += "[" + code.toString(16) + "]";
            } else {
                newText += text.charAt(i);
            }
        }

        return newText;
    };

    /**
     * 将cjkEncode处理过的字符串转化为原始字符串
     *
     * @static
     * @param text 需要做解码的字符串
     * @return {String} 解码后的字符串
     */
    BI.cjkDecode = function (text) {
        if (text == null) {
            return "";
        }
        // 查找没有 "[", 直接返回.  kunsnat:数字的时候, 不支持indexOf方法, 也是直接返回.
        if (!isNaN(text) || text.indexOf("[") == -1) {
            return text;
        }

        var newText = "";
        for (var i = 0; i < text.length; i++) {
            var ch = text.charAt(i);
            if (ch == "[") {
                var rightIdx = text.indexOf("]", i + 1);
                if (rightIdx > i + 1) {
                    var subText = text.substring(i + 1, rightIdx);
                    // james:主要是考虑[CDATA[]]这样的值的出现
                    if (subText.length > 0) {
                        ch = String.fromCharCode(eval("0x" + subText));
                    }

                    i = rightIdx;
                }
            }

            newText += ch;
        }

        return newText;
    };

    // replace the html special tags
    BI.htmlEncode = function (text) {
        return (text == null) ? "" : String(text).replace(/&/g, "&amp;").replace(/\"/g, "&quot;").replace(/</g, "&lt;").replace(/>/g, "&gt;").replace(/\s/g, "&nbsp;");
    };
    // html decode
    BI.htmlDecode = function (text) {
        return (text == null) ? "" : String(text).replace(/&amp;/g, "&").replace(/&quot;/g, "\"").replace(/&lt;/g, "<").replace(/&gt;/g, ">").replace(/&nbsp;/g, " ");
    };

    BI.cjkEncodeDO = function (o) {
        if (BI.isPlainObject(o)) {
            var result = {};
            _.each(o, function (v, k) {
                if (!(typeof v === "string")) {
                    v = BI.jsonEncode(v);
                }
                // wei:bug 43338,如果key是中文,cjkencode后o的长度就加了1,ie9以下版本死循环,所以新建对象result。
                k = BI.cjkEncode(k);
                result[k] = BI.cjkEncode(v);
            });
            return result;
        }
        return o;
    };

    BI.jsonEncode = function (o) {
        // james:这个Encode是抄的EXT的
        var useHasOwn = !!{}.hasOwnProperty;

        // crashes Safari in some instances
        // var validRE = /^("(\\.|[^"\\\n\r])*?"|[,:{}\[\]0-9.\-+Eaeflnr-u \n\r\t])+?$/;

        var m = {
            "\b": "\\b",
            "\t": "\\t",
            "\n": "\\n",
            "\f": "\\f",
            "\r": "\\r",
            "\"": "\\\"",
            "\\": "\\\\"
        };

        var encodeString = function (s) {
            if (/["\\\x00-\x1f]/.test(s)) {
                return "\"" + s.replace(/([\x00-\x1f\\"])/g, function (a, b) {
                    var c = m[b];
                    if (c) {
                        return c;
                    }
                    c = b.charCodeAt();
                    return "\\u00" +
                        Math.floor(c / 16).toString(16) +
                        (c % 16).toString(16);
                }) + "\"";
            }
            return "\"" + s + "\"";
        };

        var encodeArray = function (o) {
            var a = ["["], b, i, l = o.length, v;
            for (i = 0; i < l; i += 1) {
                v = o[i];
                switch (typeof v) {
                    case "undefined":
                    case "function":
                    case "unknown":
                        break;
                    default:
                        if (b) {
                            a.push(",");
                        }
                        a.push(v === null ? "null" : BI.jsonEncode(v));
                        b = true;
                }
            }
            a.push("]");
            return a.join("");
        };

        if (typeof o === "undefined" || o === null) {
            return "null";
        } else if (BI.isArray(o)) {
            return encodeArray(o);
        } else if (o instanceof Date) {
            /*
             * alex:原来只是把年月日时分秒简单地拼成一个String,无法decode
             * 现在这么处理就可以decode了,但是JS.jsonDecode和Java.JSONObject也要跟着改一下
             */
            return BI.jsonEncode({
                __time__: o.getTime()
            });
        } else if (typeof o === "string") {
            return encodeString(o);
        } else if (typeof o === "number") {
            return isFinite(o) ? String(o) : "null";
        } else if (typeof o === "boolean") {
            return String(o);
        } else if (BI.isFunction(o)) {
            return String(o);
        }
        var a = ["{"], b, i, v;
        for (i in o) {
            if (!useHasOwn || o.hasOwnProperty(i)) {
                v = o[i];
                switch (typeof v) {
                    case "undefined":
                    case "unknown":
                        break;
                    default:
                        if (b) {
                            a.push(",");
                        }
                        a.push(BI.jsonEncode(i), ":",
                            v === null ? "null" : BI.jsonEncode(v));
                        b = true;
                }
            }
        }
        a.push("}");
        return a.join("");

    };

    BI.jsonDecode = function (text) {

        try {
            // 注意0啊
            // var jo = $.parseJSON(text) || {};
            var jo = $ ? $.parseJSON(text) : window.JSON.parse(text);
            if (jo == null) {
                jo = {};
            }
        } catch (e) {
            /*
             * richie:浏览器只支持标准的JSON字符串转换,而jQuery会默认调用浏览器的window.JSON.parse()函数进行解析
             * 比如:var str = "{'a':'b'}",这种形式的字符串转换为JSON就会抛异常
             */
            try {
                jo = new Function("return " + text)() || {};
            } catch (e) {
                // do nothing
            }
            if (jo == null) {
                jo = [];
            }
        }
        if (!_hasDateInJson(text)) {
            return jo;
        }

        function _hasDateInJson (json) {
            if (!json || typeof json !== "string") {
                return false;
            }
            return json.indexOf("__time__") != -1;
        }

        return (function (o) {
            if (typeof o === "string") {
                return o;
            }
            if (o && o.__time__ != null) {
                return new Date(o.__time__);
            }
            for (var a in o) {
                if (o[a] == o || typeof o[a] === "object" || _.isFunction(o[a])) {
                    break;
                }
                o[a] = arguments.callee(o[a]);
            }

            return o;
        })(jo);
    };

    BI.contentFormat = function (cv, fmt) {
        if (isEmpty(cv)) {
            // 原值为空,返回空字符
            return "";
        }
        var text = cv.toString();
        if (isEmpty(fmt)) {
            // 格式为空,返回原字符
            return text;
        }
        if (fmt.match(/^T/)) {
            // T - 文本格式
            return text;
        } else if (fmt.match(/^D/)) {
            // D - 日期(时间)格式
            if (!(cv instanceof Date)) {
                if (typeof cv === "number") {
                    // 毫秒数类型
                    cv = new Date(cv);
                } else {
                    // 字符串类型,如yyyyMMdd、MMddyyyy等这样无分隔符的结构
                    cv = Date.parseDate(cv + "", Date.patterns.ISO8601Long);
                }
            }
            if (!BI.isNull(cv)) {
                var needTrim = fmt.match(/^DT/);
                text = BI.date2Str(cv, fmt.substring(needTrim ? 2 : 1));
            }
        } else if (fmt.match(/E/)) {
            // 科学计数格式
            text = _eFormat(text, fmt);
        } else {
            // 数字格式
            var s = [];
            BI.clamp(s);
            text = _numberFormat(text, fmt);
        }
        // ¤ - 货币格式
        text = text.replace(/¤/g, "¥");
        return text;
    };

    /**
     * 将Java提供的日期格式字符串装换为JS识别的日期格式字符串
     * @class FR.parseFmt
     * @param fmt 日期格式
     * @returns {String}
     */
    BI.parseFmt = function (fmt) {
        if (!fmt) {
            return "";
        }
        //日期
        fmt = String(fmt)
        //年
            .replace(/y{4,}/g, "%Y")//yyyy的时候替换为Y
            .replace(/y{2}/g, "%y")//yy的时候替换为y
            //月
            .replace(/M{4,}/g, "%b")//MMMM的时候替换为b,八
            .replace(/M{3}/g, "%B")//MMM的时候替换为M,八月
            .replace(/M{2}/g, "%X")//MM的时候替换为X,08
            .replace(/M{1}/g, "%x")//M的时候替换为x,8
            .replace(/a{1}/g, "%p");
        //天
        if (new RegExp("d{2,}", "g").test(fmt)) {
            fmt = fmt.replace(/d{2,}/g, "%d");//dd的时候替换为d
        } else {
            fmt = fmt.replace(/d{1}/g, "%e");//d的时候替换为j
        }
        //时
        if (new RegExp("h{2,}", "g").test(fmt)) {//12小时制
            fmt = fmt.replace(/h{2,}/g, "%I");
        } else {
            fmt = fmt.replace(/h{1}/g, "%I");
        }
        if (new RegExp("H{2,}", "g").test(fmt)) {//24小时制
            fmt = fmt.replace(/H{2,}/g, "%H");
        } else {
            fmt = fmt.replace(/H{1}/g, "%H");
        }
        fmt = fmt.replace(/m{2,}/g, "%M")//分
        //秒
            .replace(/s{2,}/g, "%S");

        return fmt;
    };

    /**
     * 把字符串按照对应的格式转化成日期对象
     *
     *      @example
     *      var result = FR.str2Date('2013-12-12', 'yyyy-MM-dd');//Thu Dec 12 2013 00:00:00 GMT+0800
     *
     * @class FR.str2Date
     * @param str 字符串
     * @param format 日期格式
     * @returns {*}
     */
    BI.str2Date = function (str, format) {
        if (typeof str != "string" || typeof format != "string") {
            return null;
        }
        var fmt = BI.parseFmt(format);
        return BI.parseDateTime(str, fmt);
    };

    /**
     * 把日期对象按照指定格式转化成字符串
     *
     *      @example
     *      var date = new Date('Thu Dec 12 2013 00:00:00 GMT+0800');
     *      var result = BI.date2Str(date, 'yyyy-MM-dd');//2013-12-12
     *
     * @class BI.date2Str
     * @param date 日期
     * @param format 日期格式
     * @returns {String}
     */
    BI.date2Str = function (date, format) {
        if (!date) {
            return "";
        }
        // O(len(format))
        var len = format.length, result = "";
        if (len > 0) {
            var flagch = format.charAt(0), start = 0, str = flagch;
            for (var i = 1; i < len; i++) {
                var ch = format.charAt(i);
                if (flagch !== ch) {
                    result += compileJFmt({
                        char: flagch,
                        str: str,
                        len: i - start
                    }, date);
                    flagch = ch;
                    start = i;
                    str = flagch;
                } else {
                    str += ch;
                }
            }
            result += compileJFmt({
                char: flagch,
                str: str,
                len: len - start
            }, date);
        }
        return result;

        function compileJFmt (jfmt, date) {
            var str = jfmt.str, len = jfmt.len, ch = jfmt["char"];
            switch (ch) {
                case "E": // 星期
                    str = Date._DN[date.getDay()];
                    break;
                case "y": // 年
                    if (len <= 3) {
                        str = (date.getFullYear() + "").slice(2, 4);
                    } else {
                        str = date.getFullYear();
                    }
                    break;
                case "M": // 月
                    if (len > 2) {
                        str = Date._MN[date.getMonth()];
                    } else if (len < 2) {
                        str = date.getMonth() + 1;
                    } else {
                        str = BI.leftPad(date.getMonth() + 1 + "", 2, "0");
                    }
                    break;
                case "d": // 日
                    if (len > 1) {
                        str = BI.leftPad(date.getDate() + "", 2, "0");
                    } else {
                        str = date.getDate();
                    }
                    break;
                case "h": // 时(12)
                    var hour = date.getHours() % 12;
                    if (hour === 0) {
                        hour = 12;
                    }
                    if (len > 1) {
                        str = BI.leftPad(hour + "", 2, "0");
                    } else {
                        str = hour;
                    }
                    break;
                case "H": // 时(24)
                    if (len > 1) {
                        str = BI.leftPad(date.getHours() + "", 2, "0");
                    } else {
                        str = date.getHours();
                    }
                    break;
                case "m":
                    if (len > 1) {
                        str = BI.leftPad(date.getMinutes() + "", 2, "0");
                    } else {
                        str = date.getMinutes();
                    }
                    break;
                case "s":
                    if (len > 1) {
                        str = BI.leftPad(date.getSeconds() + "", 2, "0");
                    } else {
                        str = date.getSeconds();
                    }
                    break;
                case "a":
                    str = date.getHours() < 12 ? "am" : "pm";
                    break;
                case "z":
                    str = date.getTimezone();
                    break;
                default:
                    str = jfmt.str;
                    break;
            }
            return str;
        }
    };

    BI.object2Number = function (value) {
        if (value == null) {
            return 0;
        }
        if (typeof value === "number") {
            return value;
        }
        var str = value + "";
        if (str.indexOf(".") === -1) {
            return parseInt(str);
        }
        return parseFloat(str);
    };

    BI.object2Date = function (obj) {
        if (obj == null) {
            return new Date();
        }
        if (obj instanceof Date) {
            return obj;
        } else if (typeof obj === "number") {
            return new Date(obj);
        }
        var str = obj + "";
        str = str.replace(/-/g, "/");
        var dt = new Date(str);
        if (!isInvalidDate(dt)) {
            return dt;
        }

        return new Date();

    };

    BI.object2Time = function (obj) {
        if (obj == null) {
            return new Date();
        }
        if (obj instanceof Date) {
            return obj;
        }
        var str = obj + "";
        str = str.replace(/-/g, "/");
        var dt = new Date(str);
        if (!isInvalidDate(dt)) {
            return dt;
        }
        if (str.indexOf("/") === -1 && str.indexOf(":") !== -1) {
            dt = new Date("1970/01/01 " + str);
            if (!isInvalidDate(dt)) {
                return dt;
            }
        }
        dt = BI.parseDateTime(str, "HH:mm:ss");
        if (!isInvalidDate(dt)) {
            return dt;
        }
        return new Date();

    };
})();
/**
 * guy
 *
 * @class BI.HighlightBehavior
 * @extends BI.Behavior
 */
BI.HighlightBehavior = BI.inherit(BI.Behavior, {
    _defaultConfig: function () {
        return BI.extend(BI.HighlightBehavior.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.HighlightBehavior.superclass._init.apply(this, arguments);

    },

    doBehavior: function (items) {
        var args = Array.prototype.slice.call(arguments, 1),
            o = this.options;
        BI.each(items, function (i, item) {
            if (item instanceof BI.Single) {
                var rule = o.rule(item.getValue(), item);

                function doBe (run) {
                    if (run === true) {
                        item.doHighLight && item.doHighLight.apply(item, args);
                    } else {
                        item.unHighLight && item.unHighLight.apply(item, args);
                    }
                }

                if (BI.isFunction(rule)) {
                    rule(doBe);
                } else {
                    doBe(rule);
                }
            } else {
                item.doBehavior && item.doBehavior.apply(item, args);
            }
        });
    }
});/**
 * guy
 * 标红行为
 * @class BI.RedMarkBehavior
 * @extends BI.Behavior
 */
BI.RedMarkBehavior = BI.inherit(BI.Behavior, {
    _defaultConfig: function () {
        return BI.extend(BI.RedMarkBehavior.superclass._defaultConfig.apply(this, arguments), {

        });
    },

    _init: function () {
        BI.RedMarkBehavior.superclass._init.apply(this, arguments);

    },

    doBehavior: function (items) {
        var args  = Array.prototype.slice.call(arguments, 1),
            o     = this.options;
        BI.each(items, function (i, item) {
            if(item instanceof BI.Single) {
                if (o.rule(item.getValue(), item)) {
                    item.doRedMark && item.doRedMark.apply(item, args);
                } else {
                    item.doRedMark && item.unRedMark.apply(item, args);
                }
            } else {
                item.doBehavior && item.doBehavior.apply(item, args);
            }
        });
    }
});// 工程配置
(function () {
    // 注册布局
    var isSupportFlex = BI.isSupportCss3("flex");
    BI.Plugin.registerWidget("bi.horizontal", function (ob) {
        if (!BI.isIE() && isSupportFlex) {
            return BI.extend(ob, {type: "bi.flex_horizontal"});
        }
        return ob;

    });
    BI.Plugin.registerWidget("bi.center_adapt", function (ob) {
        if (!BI.isIE() && isSupportFlex && ob.items && ob.items.length <= 1) {
            // 有滚动条的情况下需要用到flex_wrapper_center布局
            if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) {
                // 不是IE用flex_wrapper_center布局
                return BI.extend(ob, {type: "bi.flex_wrapper_center"});
            }
            return BI.extend(ob, {type: "bi.flex_center"});
        }
        return ob;

    });
    BI.Plugin.registerWidget("bi.vertical_adapt", function (ob) {
        if (!BI.isIE() && isSupportFlex) {
            // 有滚动条的情况下需要用到flex_wrapper_center布局
            if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) {
                // 不是IE用flex_wrapper_center布局
                return BI.extend({}, ob, {type: "bi.flex_wrapper_vertical_center"});
            }
            return BI.extend(ob, {type: "bi.flex_vertical_center"});
        }
        return ob;

    });
    BI.Plugin.registerWidget("bi.float_center_adapt", function (ob) {
        if (!BI.isIE() && isSupportFlex) {
            // 有滚动条的情况下需要用到flex_wrapper_center布局
            if (ob.scrollable === true || ob.scrollx === true || ob.scrolly === true) {
                // 不是IE用flex_wrapper_center布局
                return BI.extend({}, ob, {type: "bi.flex_wrapper_center"});
            }
            return BI.extend(ob, {type: "bi.flex_center"});
        }
        return ob;

    });
    // 注册滚动条
    BI.Plugin.registerWidget("bi.grid_table_scrollbar", function (ob) {
        if (BI.isIE9Below()) {
            return BI.extend(ob, {type: "bi.native_table_scrollbar"});
        }
        return ob;

    });
    BI.Plugin.registerWidget("bi.grid_table_horizontal_scrollbar", function (ob) {
        if (BI.isIE9Below()) {
            return BI.extend(ob, {type: "bi.native_table_horizontal_scrollbar"});
        }
        return ob;

    });

    // 注册控件
    BI.Plugin.registerWidget("bi.grid_table", function (ob) {
        // 非chrome下滚动条滑动效果不好,禁止掉
        if (!(BI.isChrome() && BI.isWindows() && !BI.isEdge())) {
            return BI.extend(ob, {type: "bi.quick_grid_table"});
        }
        return ob;

    });
    BI.Plugin.registerWidget("bi.collection_table", function (ob) {
        // 非chrome下滚动条滑动效果不好,禁止掉
        if (!(BI.isChrome() && BI.isWindows() && !BI.isEdge())) {
            return BI.extend(ob, {type: "bi.quick_collection_table"});
        }
        return ob;

    });
    // IE8下滚动条用原生的
    $(function () {
        if (BI.isIE9Below()) {
            BI.GridTableScrollbar.SIZE = 18;
        }
    });
}());/**
 * guy
 * 控制器
 * Controller层超类
 * @class BI.Controller
 * @extends BI.OB
 * @abstract
 */
BI.Controller = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.Controller.superclass._defaultConfig.apply(this, arguments), {

        });
    },
    _init: function () {
        BI.Controller.superclass._init.apply(this, arguments);
    },

    destroy: function () {

    }
});
BI.Controller.EVENT_CHANGE = "__EVENT_CHANGE__";/**
 * 广播
 *
 * Created by GUY on 2015/12/23.
 * @class
 */
BI.BroadcastController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.BroadcastController.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.BroadcastController.superclass._init.apply(this, arguments);
        this._broadcasts = {};
    },

    on: function (name, fn) {
        var self = this;
        if (!this._broadcasts[name]) {
            this._broadcasts[name] = [];
        }
        this._broadcasts[name].push(fn);
        return function () {
            self.remove(name, fn);
        };
    },

    send: function (name) {
        var args = [].slice.call(arguments, 1);
        BI.each(this._broadcasts[name], function (i, fn) {
            fn.apply(null, args);
        });
    },

    remove: function (name, fn) {
        if (fn) {
            this._broadcasts[name].remove(fn);
            if (this._broadcasts[name].length === 0) {
                delete this._broadcasts[name];
            }
        } else {
            delete this._broadcasts[name];
        }
        return this;
    }
});/**
 * 气泡图控制器
 * 控制气泡图的显示方向
 *
 * Created by GUY on 2015/8/21.
 * @class
 */
BI.BubblesController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.BubblesController.superclass._defaultConfig.apply(this, arguments), {});
    },

    _const: {
        bubbleHeight: 18
    },

    _init: function () {
        BI.BubblesController.superclass._init.apply(this, arguments);
        var self = this;
        this.bubblesManager = {};
        this.storeBubbles = {};
        BI.Resizers.add("bubbleController" + BI.uniqueId(), function () {
            BI.each(self.bubblesManager, function (name) {
                self.remove(name);
            });
            self.bubblesManager = {};
            self.storeBubbles = {};
        });
    },

    _createBubble: function (direct, text, level, height) {
        return BI.createWidget({
            type: "bi.bubble",
            text: text,
            level: level,
            height: height || 18,
            direction: direct
        });
    },

    _getOffsetLeft: function (name, context, offsetStyle) {
        var left = 0;
        if ("center" === offsetStyle) {
            left = context.element.offset().left + (context.element.bounds().width - this.get(name).element.bounds().width) / 2;
            if (left < 0) {
                left = 0;
            }
            return left;
        }
        if ("right" === offsetStyle) {
            left = context.element.offset().left + context.element.bounds().width - this.get(name).element.bounds().width;
            if (left < 0) {
                left = 0;
            }
            return left;
        }
        return context.element.offset().left;
    },

    _getOffsetTop: function (name, context, offsetStyle) {
        var top = 0;
        if ("center" === offsetStyle) {
            top = context.element.offset().top + (context.element.bounds().height - this.get(name).element.bounds().height) / 2;
            if (top < 0) {
                top = 0;
            }
            return top;
        } else if ("right" === offsetStyle) {
            top = context.element.offset().top + context.element.bounds().height - this.get(name).element.bounds().height;
            if (top < 0) {
                top = 0;
            }
            return top;
        }
        return context.element.offset().top;
    },

    _getLeftPosition: function (name, context, offsetStyle) {
        var position = $.getLeftPosition(context, this.get(name));
        position.top = this._getOffsetTop(name, context, offsetStyle);
        return position;
    },

    _getBottomPosition: function (name, context, offsetStyle) {
        var position = $.getBottomPosition(context, this.get(name));
        position.left = this._getOffsetLeft(name, context, offsetStyle);
        return position;
    },

    _getTopPosition: function (name, context, offsetStyle) {
        var position = $.getTopPosition(context, this.get(name));
        position.left = this._getOffsetLeft(name, context, offsetStyle);
        return position;
    },

    _getRightPosition: function (name, context, offsetStyle) {
        var position = $.getRightPosition(context, this.get(name));
        position.top = this._getOffsetTop(name, context, offsetStyle);
        return position;
    },

    /**
     *
     * @param name
     * @param text
     * @param context
     * @param offsetStyle center, left, right三种类型, 默认left
     * @returns {BI.BubblesController}
     */
    show: function (name, text, context, opt) {
        opt || (opt = {});
        var container = opt.container || context;
        var offsetStyle = opt.offsetStyle || {};
        var level = opt.level || "error";
        var adjustLength = opt.adjustLength || 0;
        if (!this.storeBubbles[name]) {
            this.storeBubbles[name] = {};
        }
        if (!this.storeBubbles[name]["top"]) {
            this.storeBubbles[name]["top"] = this._createBubble("top", text, level);
        }
        BI.createWidget({
            type: "bi.absolute",
            element: container,
            items: [{
                el: this.storeBubbles[name]["top"]
            }]
        });
        this.set(name, this.storeBubbles[name]["top"]);
        var position = this._getTopPosition(name, context, offsetStyle);
        this.get(name).element.css({left: position.left, top: position.top - adjustLength});
        this.get(name).invisible();
        if (!$.isTopSpaceEnough(context, this.get(name), adjustLength)) {
            if (!this.storeBubbles[name]["left"]) {
                this.storeBubbles[name]["left"] = this._createBubble("left", text, level, 30);
            }
            BI.createWidget({
                type: "bi.absolute",
                element: container,
                items: [{
                    el: this.storeBubbles[name]["left"]
                }]
            });
            this.set(name, this.storeBubbles[name]["left"]);
            var position = this._getLeftPosition(name, context, offsetStyle);
            this.get(name).element.css({left: position.left - adjustLength, top: position.top});
            this.get(name).invisible();
            if (!$.isLeftSpaceEnough(context, this.get(name), adjustLength)) {
                if (!this.storeBubbles[name]["right"]) {
                    this.storeBubbles[name]["right"] = this._createBubble("right", text, level, 30);
                }
                BI.createWidget({
                    type: "bi.absolute",
                    element: container,
                    items: [{
                        el: this.storeBubbles[name]["right"]
                    }]
                });
                this.set(name, this.storeBubbles[name]["right"]);
                var position = this._getRightPosition(name, context, offsetStyle);
                this.get(name).element.css({left: position.left + adjustLength, top: position.top});
                this.get(name).invisible();
                if (!$.isRightSpaceEnough(context, this.get(name), adjustLength)) {
                    if (!this.storeBubbles[name]["bottom"]) {
                        this.storeBubbles[name]["bottom"] = this._createBubble("bottom", text, level);
                    }
                    BI.createWidget({
                        type: "bi.absolute",
                        element: container,
                        items: [{
                            el: this.storeBubbles[name]["bottom"]
                        }]
                    });
                    this.set(name, this.storeBubbles[name]["bottom"]);
                    var position = this._getBottomPosition(name, context, offsetStyle);
                    this.get(name).element.css({left: position.left, top: position.top + adjustLength});
                    this.get(name).invisible();
                }
            }
        }
        this.get(name).setText(text);
        this.get(name).visible();
        return this;
    },

    hide: function (name) {
        if (!this.has(name)) {
            return this;
        }
        this.get(name).invisible();
        return this;
    },

    add: function (name, bubble) {
        if (this.has(name)) {
            return this;
        }
        this.set(name, bubble);
        return this;
    },

    get: function (name) {
        return this.bubblesManager[name];
    },

    set: function (name, bubble) {
        this.bubblesManager[name] = bubble;
    },

    has: function (name) {
        return this.bubblesManager[name] != null;
    },

    remove: function (name) {
        if (!this.has(name)) {
            return this;
        }
        BI.each(this.storeBubbles[name], function (dir, bubble) {
            bubble.destroy();
        });
        delete this.storeBubbles[name];
        delete this.bubblesManager[name];
        return this;
    }
});/**
 * 弹出层面板控制器, z-index在10w层级
 *
 * Created by GUY on 2015/6/24.
 * @class
 */
BI.LayerController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.LayerController.superclass._defaultConfig.apply(this, arguments), {
            render: "body"
        });
    },

    _init: function () {
        BI.LayerController.superclass._init.apply(this, arguments);
        this.layerManager = {};
        this.layouts = {};
        this.zindex = BI.zIndex_layer;
        BI.Resizers.add("layerController" + BI.uniqueId(), BI.bind(this._resize, this));
    },

    _resize: function () {
        BI.each(this.layouts, function (i, layer) {
            if (layer.element.is(":visible")) {
                layer.element.trigger("__resize__");
            }
        });
    },

    make: function (name, container, op, context) {
        if (BI.isWidget(container)) {
            op = op || {};
            op.container = container;
        } else {
            context = op;
            op = container;
        }
        return this.create(name, null, op, context);
    },

    create: function (name, from, op, context) {
        if (this.has(name)) {
            return this.get(name);
        }
        op || (op = {});
        var offset = op.offset || {};
        var w = from;
        if (BI.isWidget(from)) {
            w = from.element;
        }
        if (BI.isNotEmptyString(w)) {
            w = $(w);
        }
        if (this.has(name)) {
            return this.get(name);
        }
        var widget = BI.createWidget((op.render || {}), BI.extend({
            type: "bi.layout"
        }, op), context);
        var layout = BI.createWidget({
            type: "bi.absolute",
            items: [{
                el: widget,
                left: 0,
                right: 0,
                top: 0,
                bottom: 0
            }]
        }, context);
        BI.createWidget({
            type: "bi.absolute",
            element: op.container || this.options.render,
            items: [{
                el: layout,
                left: offset.left || 0,
                right: offset.right || 0,
                top: offset.top || 0,
                bottom: offset.bottom || 0
            }]
        });
        if (w) {
            layout.element.addClass("bi-popup-view");
            layout.element.css({
                left: w.offset().left + (offset.left || 0),
                top: w.offset().top + (offset.top || 0),
                width: offset.width || (w.outerWidth() - (offset.left || 0) - (offset.right || 0)) || "",
                height: offset.height || (w.outerHeight() - (offset.top || 0) - (offset.bottom || 0)) || ""
            });
            layout.element.on("__resize__", function () {
                w.is(":visible") &&
                layout.element.css({
                    left: w.offset().left + (offset.left || 0),
                    top: w.offset().top + (offset.top || 0),
                    width: offset.width || (w.outerWidth() - (offset.left || 0) - (offset.right || 0)) || "",
                    height: offset.height || (w.outerHeight() - (offset.top || 0) - (offset.bottom || 0)) || ""
                });
            });
        }
        this.add(name, widget, layout);
        return widget;
    },

    hide: function (name, callback) {
        if (!this.has(name)) {
            return this;
        }
        this._getLayout(name).invisible();
        this._getLayout(name).element.hide(0, callback);
        return this;
    },

    show: function (name, callback) {
        if (!this.has(name)) {
            return this;
        }
        this._getLayout(name).visible();
        this._getLayout(name).element.css("z-index", this.zindex++).show(0, callback).trigger("__resize__");
        return this;
    },

    isVisible: function (name) {
        return this.has(name) && this._getLayout(name).isVisible();
    },

    add: function (name, layer, layout) {
        if (this.has(name)) {
            throw new Error("name is already exist");
        }
        layout.setVisible(false);
        this.layerManager[name] = layer;
        this.layouts[name] = layout;
        layout.element.css("z-index", this.zindex++);
        return this;
    },

    _getLayout: function (name) {
        return this.layouts[name];
    },

    get: function (name) {
        return this.layerManager[name];
    },

    has: function (name) {
        return this.layerManager[name] != null;
    },

    remove: function (name) {
        if (!this.has(name)) {
            return this;
        }
        this.layerManager[name].destroy();
        this.layouts[name].destroy();
        delete this.layerManager[name];
        delete this.layouts[name];
        return this;
    }
});/**
 * 遮罩面板, z-index在1亿层级
 *
 * Created by GUY on 2015/6/24.
 * @class
 */
BI.MaskersController = BI.inherit(BI.LayerController, {
    _defaultConfig: function () {
        return BI.extend(BI.MaskersController.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.MaskersController.superclass._init.apply(this, arguments);
        this.zindex = BI.zIndex_masker;
    }
});/**
 * guy
 * popover弹出层控制器, z-index在100w层级
 * @class BI.popoverController
 * @extends BI.Controller
 */
BI.PopoverController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.PopoverController.superclass._defaultConfig.apply(this, arguments), {
            modal: true, // 模态窗口
            render: "body"
        });
    },

    _init: function () {
        BI.PopoverController.superclass._init.apply(this, arguments);
        this.modal = this.options.modal;
        this.floatManager = {};
        this.floatLayer = {};
        this.floatContainer = {};
        this.floatOpened = {};
        this.zindex = BI.zIndex_popover;
        this.zindexMap = {};
    },

    _check: function (name) {
        return BI.isNotNull(this.floatManager[name]);
    },

    create: function (name, options, context) {
        if (this._check(name)) {
            return this;
        }
        var popover = BI.createWidget(options || {}, {
            type: "bi.popover"
        }, context);
        this.add(name, popover, options, context);
        return this;
    },

    add: function (name, popover, options, context) {
        var self = this;
        options || (options = {});
        if (this._check(name)) {
            return this;
        }
        this.floatContainer[name] = BI.createWidget({
            type: "bi.absolute",
            cls: "bi-popup-view",
            items: [{
                el: (this.floatLayer[name] = BI.createWidget({
                    type: "bi.absolute",
                    items: [popover]
                }, context)),
                left: 0,
                right: 0,
                top: 0,
                bottom: 0
            }]
        });
        this.floatManager[name] = popover;
        (function (key) {
            popover.on(BI.Popover.EVENT_CLOSE, function () {
                self.close(key);
            });
        })(name);
        BI.createWidget({
            type: "bi.absolute",
            element: options.container || this.options.render,
            items: [{
                el: this.floatContainer[name],
                left: 0,
                right: 0,
                top: 0,
                bottom: 0
            }]
        });
        return this;
    },

    open: function (name) {
        if (!this._check(name)) {
            return this;
        }
        if (!this.floatOpened[name]) {
            this.floatOpened[name] = true;
            var container = this.floatContainer[name];
            container.element.css("zIndex", this.zindex++);
            this.modal && container.element.__hasZIndexMask__(this.zindexMap[name]) && container.element.__releaseZIndexMask__(this.zindexMap[name]);
            this.zindexMap[name] = this.zindex;
            this.modal && container.element.__buildZIndexMask__(this.zindex++);
            this.get(name).setZindex(this.zindex++);
            this.floatContainer[name].visible();
            var popover = this.get(name);
            popover.show && popover.show();
            var W = $(this.options.render).width(), H = $(this.options.render).height();
            var w = popover.element.width(), h = popover.element.height();
            var left = (W - w) / 2, top = (H - h) / 2;
            if (left < 0) {
                left = 0;
            }
            if (top < 0) {
                top = 0;
            }
            popover.element.css({
                left: left + "px",
                top: top + "px"
            });
        }
        return this;
    },

    close: function (name) {
        if (!this._check(name)) {
            return this;
        }
        if (this.floatOpened[name]) {
            delete this.floatOpened[name];
            this.floatContainer[name].invisible();
            this.modal && this.floatContainer[name].element.__releaseZIndexMask__(this.zindexMap[name]);
        }
        return this;
    },

    get: function (name) {
        return this.floatManager[name];
    },

    remove: function (name) {
        if (!this._check(name)) {
            return this;
        }
        this.floatContainer[name].destroy();
        this.modal && this.floatContainer[name].element.__releaseZIndexMask__(this.zindexMap[name]);
        delete this.floatManager[name];
        delete this.floatLayer[name];
        delete this.zindexMap[name];
        delete this.floatContainer[name];
        delete this.floatOpened[name];
        return this;
    }
});/**
 * window.resize 控制器
 *
 * Created by GUY on 2015/6/24.
 * @class
 */
BI.ResizeController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.ResizeController.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.ResizeController.superclass._init.apply(this, arguments);
        var self = this;
        this.resizerManger = {};
        var fn = BI.debounce(function (ev) {
            // if (BI.isWindow(ev.target)) {
            self._resize(ev);
            // }
        }, 30);
        $(window).resize(fn);
    },

    _resize: function (ev) {
        BI.each(this.resizerManger, function (key, resizer) {
            if (resizer instanceof $) {
                if (resizer.is(":visible")) {
                    resizer.trigger("__resize__");
                }
                return;
            }
            if (resizer instanceof BI.Layout) {
                resizer.resize();
                return;
            }
            if (BI.isFunction(resizer)) {
                resizer(ev);
                return;
            }
        });
    },

    add: function (name, resizer) {
        var self = this;
        if (this.has(name)) {
            return this;
        }
        this.resizerManger[name] = resizer;
        return function () {
            self.remove(name);
        };
    },

    get: function (name) {
        return this.resizerManger[name];
    },

    has: function (name) {
        return this.resizerManger[name] != null;
    },

    remove: function (name) {
        if (!this.has(name)) {
            return this;
        }
        delete this.resizerManger[name];
        return this;
    }
});/**
 * tooltip控制器
 * 控制tooltip的显示,  且页面中只有一个tooltip显示
 *
 * Created by GUY on 2015/9/8.
 * @class BI.TooltipsController
 * @extends BI.Controller
 */
BI.TooltipsController = BI.inherit(BI.Controller, {
    _defaultConfig: function () {
        return BI.extend(BI.TooltipsController.superclass._defaultConfig.apply(this, arguments), {});
    },

    _const: {
        height: 20
    },

    _init: function () {
        BI.TooltipsController.superclass._init.apply(this, arguments);
        this.tooltipsManager = {};
        this.showingTips = {};// 存储正在显示的tooltip
    },

    _createTooltip: function (text, level) {
        return BI.createWidget({
            type: "bi.tooltip",
            text: text,
            level: level,
            stopEvent: true,
            height: this._const.height
        });
    },

    hide: function (name, callback) {
        if (!this.has(name)) {
            return this;
        }
        delete this.showingTips[name];
        this.get(name).element.hide(0, callback);
        this.get(name).invisible();
        return this;
    },

    create: function (name, text, level, context) {
        if (!this.has(name)) {
            var tooltip = this._createTooltip(text, level);
            this.add(name, tooltip);
            BI.createWidget({
                type: "bi.absolute",
                element: context || "body",
                items: [{
                    el: tooltip
                }]
            });
            tooltip.invisible();
        }
        return this.get(name);
    },

    // opt: {container: '', belowMouse: false}
    show: function (e, name, text, level, context, opt) {
        opt || (opt = {});
        var self = this;
        BI.each(this.showingTips, function (i, tip) {
            self.hide(i);
        });
        this.showingTips = {};
        if (!this.has(name)) {
            this.create(name, text, level, opt.container || context);
        }
        if (!opt.belowMouse) {
            var offset = context.element.offset();
            var bounds = context.element.bounds();
            if (bounds.height === 0 || bounds.width === 0) {
                return;
            }
            var top = offset.top + bounds.height + 5;
        }
        var tooltip = this.get(name);
        tooltip.setText(text);
        tooltip.element.css({
            left: "0px",
            top: "0px"
        });
        tooltip.visible();
        tooltip.element.height(tooltip.element[0].scrollHeight);
        this.showingTips[name] = true;
        var x = (e.pageX || e.clientX) + 15, y = (e.pageY || e.clientY) + 15;
        if (x + tooltip.element.outerWidth() > $("body").outerWidth()) {
            x -= tooltip.element.outerWidth() + 15;
        }
        if (y + tooltip.element.outerHeight() > $("body").outerHeight()) {
            y -= tooltip.element.outerHeight() + 15;
            !opt.belowMouse && (y = Math.min(y, offset.top - tooltip.element.outerHeight() - 5));
        } else {
            !opt.belowMouse && (y = Math.max(y, top));
        }
        tooltip.element.css({
            left: x < 0 ? 0 : x + "px",
            top: y < 0 ? 0 : y + "px"
        });
        tooltip.element.hover(function () {
            self.remove(name);
            context.element.trigger("mouseleave.title" + context.getName());
        });
        return this;
    },

    add: function (name, bubble) {
        if (this.has(name)) {
            return this;
        }
        this.set(name, bubble);
        return this;
    },

    get: function (name) {
        return this.tooltipsManager[name];
    },

    set: function (name, bubble) {
        this.tooltipsManager[name] = bubble;
    },

    has: function (name) {
        return this.tooltipsManager[name] != null;
    },

    remove: function (name) {
        if (!this.has(name)) {
            return this;
        }
        this.tooltipsManager[name].destroy();
        delete this.tooltipsManager[name];
        return this;
    }
});/**
 * 事件集合
 * @class BI.Events
 */
_.extend(BI, {
    Events: {

        /**
         * @static
         * @property keydown事件
         */
        KEYDOWN: "_KEYDOWN",

        /**
         * @static
         * @property 回撤事件
         */
        BACKSPACE: "_BACKSPACE",

        /**
         * @static
         * @property 空格事件
         */
        SPACE: "_SPACE",

        /**
         * @static
         * @property 回车事件
         */
        ENTER: "_ENTER",

        /**
         * @static
         * @property 确定事件
         */
        CONFIRM: "_CONFIRM",

        /**
         * @static
         * @property 错误事件
         */
        ERROR: "_ERROR",

        /**
         * @static
         * @property 暂停事件
         */
        PAUSE: "_PAUSE",

        /**
         * @static
         * @property destroy事件
         */
        DESTROY: "_DESTROY",

        /**
         * @static
         * @property 取消挂载事件
         */
        UNMOUNT: "_UNMOUNT",

        /**
         * @static
         * @property 清除选择
         */
        CLEAR: "_CLEAR",

        /**
         * @static
         * @property 添加数据
         */
        ADD: "_ADD",

        /**
         * @static
         * @property 正在编辑状态事件
         */
        EDITING: "_EDITING",

        /**
         * @static
         * @property 空状态事件
         */
        EMPTY: "_EMPTY",

        /**
         * @static
         * @property 显示隐藏事件
         */
        VIEW: "_VIEW",

        /**
         * @static
         * @property 窗体改变大小
         */
        RESIZE: "_RESIZE",

        /**
         * @static
         * @property 编辑前事件
         */
        BEFOREEDIT: "_BEFOREEDIT",

        /**
         * @static
         * @property 编辑后事件
         */
        AFTEREDIT: "_AFTEREDIT",

        /**
         * @static
         * @property 开始编辑事件
         */
        STARTEDIT: "_STARTEDIT",

        /**
         * @static
         * @property 停止编辑事件
         */
        STOPEDIT: "_STOPEDIT",

        /**
         * @static
         * @property 值改变事件
         */
        CHANGE: "_CHANGE",

        /**
         * @static
         * @property 下拉弹出菜单事件
         */
        EXPAND: "_EXPAND",

        /**
         * @static
         * @property 关闭下拉菜单事件
         */
        COLLAPSE: "_COLLAPSE",

        /**
         * @static
         * @property 回调事件
         */
        CALLBACK: "_CALLBACK",

        /**
         * @static
         * @property 点击事件
         */
        CLICK: "_CLICK",

        /**
         * @static
         * @property 状态改变事件,一般是用在复选按钮和单选按钮
         */
        STATECHANGE: "_STATECHANGE",

        /**
         * @static
         * @property 状态改变前事件
         */
        BEFORESTATECHANGE: "_BEFORESTATECHANGE",


        /**
         * @static
         * @property 初始化事件
         */
        INIT: "_INIT",

        /**
         * @static
         * @property 初始化后事件
         */
        AFTERINIT: "_AFTERINIT",

        /**
         * @static
         * @property 滚动条滚动事件
         */
        SCROLL: "_SCROLL",


        /**
         * @static
         * @property 开始加载事件
         */
        STARTLOAD: "_STARTLOAD",

        /**
         * @static
         * @property 加载后事件
         */
        AFTERLOAD: "_AFTERLOAD",


        /**
         * @static
         * @property 提交前事件
         */
        BS: "beforesubmit",

        /**
         * @static
         * @property 提交后事件
         */
        AS: "aftersubmit",

        /**
         * @static
         * @property 提交完成事件
         */
        SC: "submitcomplete",

        /**
         * @static
         * @property 提交失败事件
         */
        SF: "submitfailure",

        /**
         * @static
         * @property 提交成功事件
         */
        SS: "submitsuccess",

        /**
         * @static
         * @property 校验提交前事件
         */
        BVW: "beforeverifywrite",

        /**
         * @static
         * @property 校验提交后事件
         */
        AVW: "afterverifywrite",

        /**
         * @static
         * @property 校验后事件
         */
        AV: "afterverify",

        /**
         * @static
         * @property 填报前事件
         */
        BW: "beforewrite",

        /**
         * @static
         * @property 填报后事件
         */
        AW: "afterwrite",

        /**
         * @static
         * @property 填报成功事件
         */
        WS: "writesuccess",

        /**
         * @static
         * @property 填报失败事件
         */
        WF: "writefailure",

        /**
         * @static
         * @property 添加行前事件
         */
        BA: "beforeappend",

        /**
         * @static
         * @property 添加行后事件
         */
        AA: "afterappend",

        /**
         * @static
         * @property 删除行前事件
         */
        BD: "beforedelete",

        /**
         * @static
         * @property 删除行后事件
         */
        AD: "beforedelete",

        /**
         * @static
         * @property 未提交离开事件
         */
        UC: "unloadcheck",


        /**
         * @static
         * @property PDF导出前事件
         */
        BTOPDF: "beforetopdf",

        /**
         * @static
         * @property PDF导出后事件
         */
        ATOPDF: "aftertopdf",

        /**
         * @static
         * @property Excel导出前事件
         */
        BTOEXCEL: "beforetoexcel",

        /**
         * @static
         * @property Excel导出后事件
         */
        ATOEXCEL: "aftertoexcel",

        /**
         * @static
         * @property Word导出前事件
         */
        BTOWORD: "beforetoword",

        /**
         * @static
         * @property Word导出后事件
         */
        ATOWORD: "aftertoword",

        /**
         * @static
         * @property 图片导出前事件
         */
        BTOIMAGE: "beforetoimage",

        /**
         * @static
         * @property 图片导出后事件
         */
        ATOIMAGE: "aftertoimage",

        /**
         * @static
         * @property HTML导出前事件
         */
        BTOHTML: "beforetohtml",

        /**
         * @static
         * @property HTML导出后事件
         */
        ATOHTML: "aftertohtml",

        /**
         * @static
         * @property Excel导入前事件
         */
        BIMEXCEL: "beforeimportexcel",

        /**
         * @static
         * @property Excel导出后事件
         */
        AIMEXCEL: "afterimportexcel",

        /**
         * @static
         * @property PDF打印前事件
         */
        BPDFPRINT: "beforepdfprint",

        /**
         * @static
         * @property PDF打印后事件
         */
        APDFPRINT: "afterpdfprint",

        /**
         * @static
         * @property Flash打印前事件
         */
        BFLASHPRINT: "beforeflashprint",

        /**
         * @static
         * @property Flash打印后事件
         */
        AFLASHPRINT: "afterflashprint",

        /**
         * @static
         * @property Applet打印前事件
         */
        BAPPLETPRINT: "beforeappletprint",

        /**
         * @static
         * @property Applet打印后事件
         */
        AAPPLETPRINT: "afterappletprint",

        /**
         * @static
         * @property 服务器打印前事件
         */
        BSEVERPRINT: "beforeserverprint",

        /**
         * @static
         * @property 服务器打印后事件
         */
        ASERVERPRINT: "afterserverprint",

        /**
         * @static
         * @property 邮件发送前事件
         */
        BEMAIL: "beforeemail",

        /**
         * @static
         * @property 邮件发送后事件
         */
        AEMAIL: "afteremail"
    }
});/**
 * guy
 * 最基础的dom操作
 */
BI.extend(jQuery.fn, {

    destroy: function () {
        this.remove();
        if (BI.isIE() === true) {
            this[0].outerHTML = "";
        }
    },
    /**
     * 高亮显示
     * @param text 必需
     * @param keyword
     * @param py 必需
     * @returns {*}
     * @private
     */
    __textKeywordMarked__: function (text, keyword, py) {
        if (!BI.isKey(keyword) || (text + "").length > 100) {
            return this.html(BI.htmlEncode(text));
        }
        keyword = keyword + "";
        keyword = BI.toUpperCase(keyword);
        var textLeft = (text || "") + "";
        py = (py || BI.makeFirstPY(text)) + "";
        if (py != null) {
            py = BI.toUpperCase(py);
        }
        this.empty();
        while (true) {
            var tidx = BI.toUpperCase(textLeft).indexOf(keyword);
            var pidx = null;
            if (py != null) {
                pidx = py.indexOf(keyword);
                if (pidx >= 0) {
                    pidx = pidx % text.length;
                }
            }

            if (tidx >= 0) {
                this.append(textLeft.substr(0, tidx));
                this.append($("<span>").addClass("bi-keyword-red-mark")
                    .html(BI.htmlEncode(textLeft.substr(tidx, keyword.length))));

                textLeft = textLeft.substr(tidx + keyword.length);
                if (py != null) {
                    py = py.substr(tidx + keyword.length);
                }
            } else if (pidx != null && pidx >= 0 && Math.floor(pidx / text.length) === Math.floor((pidx + keyword.length - 1) / text.length)) {
                this.append(textLeft.substr(0, pidx));
                this.append($("<span>").addClass("bi-keyword-red-mark")
                    .html(BI.htmlEncode(textLeft.substr(pidx, keyword.length))));
                if (py != null) {
                    py = py.substr(pidx + keyword.length);
                }
                textLeft = textLeft.substr(pidx + keyword.length);
            } else {
                this.append(textLeft);
                break;
            }
        }

        return this;
    },

    getDomHeight: function (parent) {
        var clone = $(this).clone();
        clone.appendTo($(parent || "body"));
        var height = clone.height();
        clone.remove();
        return height;
    },

    // 是否有竖直滚动条
    hasVerticalScroll: function () {
        return this.height() > 0 && this[0].clientWidth < this[0].offsetWidth;
    },

    // 是否有水平滚动条
    hasHorizonScroll: function () {
        return this.width() > 0 && this[0].clientHeight < this[0].offsetHeight;
    },

    // 获取计算后的样式
    getStyle: function (name) {
        var node = this[0];
        var computedStyle = void 0;

        // W3C Standard
        if (window.getComputedStyle) {
            // In certain cases such as within an iframe in FF3, this returns null.
            computedStyle = window.getComputedStyle(node, null);
            if (computedStyle) {
                return computedStyle.getPropertyValue(BI.hyphenate(name));
            }
        }
        // Safari
        if (document.defaultView && document.defaultView.getComputedStyle) {
            computedStyle = document.defaultView.getComputedStyle(node, null);
            // A Safari bug causes this to return null for `display: none` elements.
            if (computedStyle) {
                return computedStyle.getPropertyValue(BI.hyphenate(name));
            }
            if (name === "display") {
                return "none";
            }
        }
        // Internet Explorer
        if (node.currentStyle) {
            if (name === "float") {
                return node.currentStyle.cssFloat || node.currentStyle.styleFloat;
            }
            return node.currentStyle[BI.camelize(name)];
        }
        return node.style && node.style[BI.camelize(name)];
    },

    __isMouseInBounds__: function (e) {
        var offset2Body = this.offset();
        return !(e.pageX < offset2Body.left || e.pageX > offset2Body.left + this.outerWidth()
        || e.pageY < offset2Body.top || e.pageY > offset2Body.top + this.outerHeight());
    },

    __hasZIndexMask__: function (zindex) {
        return zindex && this.zIndexMask[zindex] != null;
    },

    __buildZIndexMask__: function (zindex, domArray) {
        this.zIndexMask = this.zIndexMask || {};// 存储z-index的mask
        this.indexMask = this.indexMask || [];// 存储mask
        var mask = BI.createWidget({
            type: "bi.center_adapt",
            cls: "bi-z-index-mask",
            items: domArray
        });

        mask.element.css({"z-index": zindex});
        BI.createWidget({
            type: "bi.absolute",
            element: this,
            items: [{
                el: mask,
                left: 0,
                right: 0,
                top: 0,
                bottom: 0
            }]
        });
        this.indexMask.push(mask);
        zindex && (this.zIndexMask[zindex] = mask);
        return mask.element;
    },

    __releaseZIndexMask__: function (zindex) {
        if (zindex && this.zIndexMask[zindex]) {
            this.indexMask.remove(this.zIndexMask[zindex]);
            this.zIndexMask[zindex].destroy();
            return;
        }
        this.indexMask = this.indexMask || [];
        var indexMask = this.indexMask.pop();
        indexMask && indexMask.destroy();
    }
});

BI.extend(jQuery, {

    getLeftPosition: function (combo, popup, extraWidth) {
        return {
            left: combo.element.offset().left - popup.element.outerWidth() - (extraWidth || 0)
        };
    },

    getRightPosition: function (combo, popup, extraWidth) {
        var el = combo.element;
        return {
            left: el.offset().left + el.outerWidth() + (extraWidth || 0)
        };
    },

    getTopPosition: function (combo, popup, extraHeight) {
        return {
            top: combo.element.offset().top - popup.element.outerHeight() - (extraHeight || 0)
        };
    },

    getBottomPosition: function (combo, popup, extraHeight) {
        var el = combo.element;
        return {
            top: el.offset().top + el.outerHeight() + (extraHeight || 0)
        };
    },

    isLeftSpaceEnough: function (combo, popup, extraWidth) {
        return $.getLeftPosition(combo, popup, extraWidth).left >= 0;
    },

    isRightSpaceEnough: function (combo, popup, extraWidth) {
        var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds();
        return $.getRightPosition(combo, popup, extraWidth).left + viewBounds.width <= windowBounds.width;
    },

    isTopSpaceEnough: function (combo, popup, extraHeight) {
        return $.getTopPosition(combo, popup, extraHeight).top >= 0;
    },

    isBottomSpaceEnough: function (combo, popup, extraHeight) {
        var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds();
        return $.getBottomPosition(combo, popup, extraHeight).top + viewBounds.height <= windowBounds.height;
    },

    isRightSpaceLarger: function (combo) {
        var windowBounds = $("body").bounds();
        return windowBounds.width - combo.element.offset().left - combo.element.bounds().width >= combo.element.offset().left;
    },

    isBottomSpaceLarger: function (combo) {
        var windowBounds = $("body").bounds();
        return windowBounds.height - combo.element.offset().top - combo.element.bounds().height >= combo.element.offset().top;
    },

    getLeftAlignPosition: function (combo, popup, extraWidth) {
        var viewBounds = popup.element.bounds(), windowBounds = $("body").bounds();
        var left = combo.element.offset().left + extraWidth;
        if (left + viewBounds.width > windowBounds.width) {
            left = windowBounds.width - viewBounds.width;
        }
        if (left < 0) {
            left = 0;
        }
        return {
            left: left
        };
    },

    getLeftAdaptPosition: function (combo, popup, extraWidth) {
        if ($.isLeftSpaceEnough(combo, popup, extraWidth)) {
            return $.getLeftPosition(combo, popup, extraWidth);
        }
        return {
            left: 0
        };
    },

    getRightAlignPosition: function (combo, popup, extraWidth) {
        var comboBounds = combo.element.bounds(), viewBounds = popup.element.bounds();
        var left = combo.element.offset().left + comboBounds.width - viewBounds.width - extraWidth;
        if (left < 0) {
            left = 0;
        }
        return {
            left: left
        };
    },

    getRightAdaptPosition: function (combo, popup, extraWidth) {
        if ($.isRightSpaceEnough(combo, popup, extraWidth)) {
            return $.getRightPosition(combo, popup, extraWidth);
        }
        return {
            left: $("body").bounds().width - popup.element.bounds().width
        };
    },

    getTopAlignPosition: function (combo, popup, extraHeight, needAdaptHeight) {
        var comboOffset = combo.element.offset();
        var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(),
            windowBounds = $("body").bounds();
        var top, adaptHeight;
        if ($.isBottomSpaceEnough(combo, popup, -1 * comboBounds.height + extraHeight)) {
            top = comboOffset.top + extraHeight;
        } else if (needAdaptHeight) {
            top = comboOffset.top + extraHeight;
            adaptHeight = windowBounds.height - top;
        } else {
            top = windowBounds.height - popupBounds.height;
            if (top < extraHeight) {
                adaptHeight = windowBounds.height - extraHeight;
            }
        }
        if (top < extraHeight) {
            top = extraHeight;
        }
        return adaptHeight ? {
            top: top,
            adaptHeight: adaptHeight
        } : {
            top: top
        };
    },

    getTopAdaptPosition: function (combo, popup, extraHeight, needAdaptHeight) {
        var popupBounds = popup.element.bounds(), windowBounds = $("body").bounds();
        if ($.isTopSpaceEnough(combo, popup, extraHeight)) {
            return $.getTopPosition(combo, popup, extraHeight);
        }
        if (needAdaptHeight) {
            return {
                top: 0,
                adaptHeight: combo.element.offset().top - extraHeight
            };
        }
        if (popupBounds.height + extraHeight > windowBounds.height) {
            return {
                top: 0,
                adaptHeight: windowBounds.height - extraHeight
            };
        }
        return {
            top: 0
        };
    },

    getBottomAlignPosition: function (combo, popup, extraHeight, needAdaptHeight) {
        var comboOffset = combo.element.offset();
        var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(),
            windowBounds = $("body").bounds();
        var top, adaptHeight;
        if ($.isTopSpaceEnough(combo, popup, -1 * comboBounds.height + extraHeight)) {
            top = comboOffset.top + comboBounds.height - popupBounds.height - extraHeight;
        } else if (needAdaptHeight) {
            top = 0;
            adaptHeight = comboOffset.top + comboBounds.height - extraHeight;
        } else {
            top = 0;
            if (popupBounds.height + extraHeight > windowBounds.height) {
                adaptHeight = windowBounds.height - extraHeight;
            }
        }
        if (top < 0) {
            top = 0;
        }
        return adaptHeight ? {
            top: top,
            adaptHeight: adaptHeight
        } : {
            top: top
        };
    },

    getBottomAdaptPosition: function (combo, popup, extraHeight, needAdaptHeight) {
        var comboOffset = combo.element.offset();
        var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(),
            windowBounds = $("body").bounds();
        if ($.isBottomSpaceEnough(combo, popup, extraHeight)) {
            return $.getBottomPosition(combo, popup, extraHeight);
        }
        if (needAdaptHeight) {
            return {
                top: comboOffset.top + comboBounds.height + extraHeight,
                adaptHeight: windowBounds.height - comboOffset.top - comboBounds.height - extraHeight
            };
        }
        if (popupBounds.height + extraHeight > windowBounds.height) {
            return {
                top: extraHeight,
                adaptHeight: windowBounds.height - extraHeight
            };
        }
        return {
            top: windowBounds.height - popupBounds.height - extraHeight
        };
    },

    getCenterAdaptPosition: function (combo, popup) {
        var comboOffset = combo.element.offset();
        var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(),
            windowBounds = $("body").bounds();
        var left;
        if (comboOffset.left + comboBounds.width / 2 + popupBounds.width / 2 > windowBounds.width) {
            left = windowBounds.width - popupBounds.width;
        } else {
            left = comboOffset.left + comboBounds.width / 2 - popupBounds.width / 2;
        }
        if (left < 0) {
            left = 0;
        }
        return {
            left: left
        };
    },

    getMiddleAdaptPosition: function (combo, popup) {
        var comboOffset = combo.element.offset();
        var comboBounds = combo.element.bounds(), popupBounds = popup.element.bounds(),
            windowBounds = $("body").bounds();
        var top;
        if (comboOffset.top + comboBounds.height / 2 + popupBounds.height / 2 > windowBounds.height) {
            top = windowBounds.height - popupBounds.height;
        } else {
            top = comboOffset.top + comboBounds.height / 2 - popupBounds.height / 2;
        }
        if (top < 0) {
            top = 0;
        }
        return {
            top: top
        };
    },

    getComboPositionByDirections: function (combo, popup, extraWidth, extraHeight, needAdaptHeight, directions) {
        extraWidth || (extraWidth = 0);
        extraHeight || (extraHeight = 0);
        var i, direct;
        var leftRight = [], topBottom = [];
        var isNeedAdaptHeight = false, tbFirst = false, lrFirst = false;
        var left, top, pos;
        for (i = 0; i < directions.length; i++) {
            direct = directions[i];
            switch (direct) {
                case "left":
                    leftRight.push(direct);
                    break;
                case "right":
                    leftRight.push(direct);
                    break;
                case "top":
                    topBottom.push(direct);
                    break;
                case "bottom":
                    topBottom.push(direct);
                    break;
            }
        }
        for (i = 0; i < directions.length; i++) {
            direct = directions[i];
            switch (direct) {
                case "left":
                    if (!isNeedAdaptHeight) {
                        var tW = tbFirst ? extraHeight : extraWidth, tH = tbFirst ? 0 : extraHeight;
                        if ($.isLeftSpaceEnough(combo, popup, tW)) {
                            left = $.getLeftPosition(combo, popup, tW).left;
                            if (topBottom[0] === "bottom") {
                                pos = $.getTopAlignPosition(combo, popup, tH, needAdaptHeight);
                                pos.dir = "left,bottom";
                            } else {
                                pos = $.getBottomAlignPosition(combo, popup, tH, needAdaptHeight);
                                pos.dir = "left,top";
                            }
                            if (tbFirst) {
                                pos.change = "left";
                            }
                            pos.left = left;
                            return pos;
                        }
                    }
                    lrFirst = true;
                    break;
                case "right":
                    if (!isNeedAdaptHeight) {
                        var tW = tbFirst ? extraHeight : extraWidth, tH = tbFirst ? extraWidth : extraHeight;
                        if ($.isRightSpaceEnough(combo, popup, tW)) {
                            left = $.getRightPosition(combo, popup, tW).left;
                            if (topBottom[0] === "bottom") {
                                pos = $.getTopAlignPosition(combo, popup, tH, needAdaptHeight);
                                pos.dir = "right,bottom";
                            } else {
                                pos = $.getBottomAlignPosition(combo, popup, tH, needAdaptHeight);
                                pos.dir = "right,top";
                            }
                            if (tbFirst) {
                                pos.change = "right";
                            }
                            pos.left = left;
                            return pos;
                        }
                    }
                    lrFirst = true;
                    break;
                case "top":
                    var tW = lrFirst ? extraHeight : extraWidth, tH = lrFirst ? extraWidth : extraHeight;
                    if ($.isTopSpaceEnough(combo, popup, tH)) {
                        top = $.getTopPosition(combo, popup, tH).top;
                        if (leftRight[0] === "right") {
                            pos = $.getLeftAlignPosition(combo, popup, tW, needAdaptHeight);
                            pos.dir = "top,right";
                        } else {
                            pos = $.getRightAlignPosition(combo, popup, tW);
                            pos.dir = "top,left";
                        }
                        if (lrFirst) {
                            pos.change = "top";
                        }
                        pos.top = top;
                        return pos;
                    }
                    if (needAdaptHeight) {
                        isNeedAdaptHeight = true;
                    }
                    tbFirst = true;
                    break;
                case "bottom":
                    var tW = lrFirst ? extraHeight : extraWidth, tH = lrFirst ? extraWidth : extraHeight;
                    if ($.isBottomSpaceEnough(combo, popup, tH)) {
                        top = $.getBottomPosition(combo, popup, tH).top;
                        if (leftRight[0] === "right") {
                            pos = $.getLeftAlignPosition(combo, popup, tW, needAdaptHeight);
                            pos.dir = "bottom,right";
                        } else {
                            pos = $.getRightAlignPosition(combo, popup, tW);
                            pos.dir = "bottom,left";
                        }
                        if (lrFirst) {
                            pos.change = "bottom";
                        }
                        pos.top = top;
                        return pos;
                    }
                    if (needAdaptHeight) {
                        isNeedAdaptHeight = true;
                    }
                    tbFirst = true;
                    break;
            }
        }

        switch (directions[0]) {
            case "left":
            case "right":
                if ($.isRightSpaceLarger(combo)) {
                    left = $.getRightAdaptPosition(combo, popup, extraWidth).left;
                } else {
                    left = $.getLeftAdaptPosition(combo, popup, extraWidth).left;
                }
                if (topBottom[0] === "bottom") {
                    pos = $.getTopAlignPosition(combo, popup, extraHeight, needAdaptHeight);
                    pos.left = left;
                    pos.dir = directions[0] + ",bottom";
                    return pos;
                }
                pos = $.getBottomAlignPosition(combo, popup, extraHeight, needAdaptHeight);
                pos.left = left;
                pos.dir = directions[0] + ",top";
                return pos;
            default :
                if ($.isBottomSpaceLarger(combo)) {
                    pos = $.getBottomAdaptPosition(combo, popup, extraHeight, needAdaptHeight);
                } else {
                    pos = $.getTopAdaptPosition(combo, popup, extraHeight, needAdaptHeight);
                }
                if (leftRight[0] === "right") {
                    left = $.getLeftAlignPosition(combo, popup, extraWidth, needAdaptHeight).left;
                    pos.left = left;
                    pos.dir = directions[0] + ",right";
                    return pos;
                }
                left = $.getRightAlignPosition(combo, popup, extraWidth).left;
                pos.left = left;
                pos.dir = directions[0] + ",left";
                return pos;
        }
    },


    getComboPosition: function (combo, popup, extraWidth, extraHeight, needAdaptHeight, directions, offsetStyle) {
        extraWidth || (extraWidth = 0);
        extraHeight || (extraHeight = 0);
        var bodyHeight = $("body").bounds().height - extraHeight;
        var maxHeight = Math.min(popup.attr("maxHeight") || bodyHeight, bodyHeight);
        popup.resetHeight && popup.resetHeight(maxHeight);
        var position = $.getComboPositionByDirections(combo, popup, extraWidth, extraHeight, needAdaptHeight, directions || ["bottom", "top", "right", "left"]);
        switch (offsetStyle) {
            case "center":
                if (position.change) {
                    var p = $.getMiddleAdaptPosition(combo, popup);
                    position.top = p.top;
                } else {
                    var p = $.getCenterAdaptPosition(combo, popup);
                    position.left = p.left;
                }
                break;
            case "middle":
                if (position.change) {
                    var p = $.getCenterAdaptPosition(combo, popup);
                    position.left = p.left;
                } else {
                    var p = $.getMiddleAdaptPosition(combo, popup);
                    position.top = p.top;
                }
                break;
        }
        if (needAdaptHeight === true) {
            popup.resetHeight && popup.resetHeight(Math.min(bodyHeight - position.top, maxHeight));
        }
        return position;
    }
});/**
 * 基本的函数
 * Created by GUY on 2015/6/24.
 */
BI.Func = {};
BI.extend(BI.Func, {
    /**
     * 创建唯一的名字
     * @param array
     * @param name
     * @returns {*}
     */
    createDistinctName: function (array, name) {
        var src = name, idx = 1;
        name = name || "";
        while (true) {
            if (BI.every(array, function (i, item) {
                    return item.name !== name;
                })) {
                break;
            }
            name = src + (idx++);
        }
        return name;
    },
    /**
     * 获取搜索结果
     * @param items
     * @param keyword
     * @param param  搜索哪个属性
     */
    getSearchResult: function (items, keyword, param) {
        var isArray = BI.isArray(items);
        items = isArray ? BI.flatten(items) : items;
        param || (param = "text");
        if (!BI.isKey(keyword)) {
            return {
                find: BI.deepClone(items),
                match: isArray ? [] : {}
            };
        }
        var t, text, py;
        keyword = BI.toUpperCase(keyword);
        var matched = isArray ? [] : {}, find = isArray ? [] : {};
        BI.each(items, function (i, item) {
            item = BI.deepClone(item);
            t = BI.stripEL(item);
            text = t[param] || t.text || t.value || t.name || t;
            py = BI.makeFirstPY(text);
            text = BI.toUpperCase(text);
            py = BI.toUpperCase(py);
            var pidx;
            if (text.indexOf(keyword) > -1) {
                if (text === keyword) {
                    isArray ? matched.push(item) : (matched[i] = item);
                } else {
                    isArray ? find.push(item) : (find[i] = item);
                }
            } else if (pidx = py.indexOf(keyword), (pidx > -1 && Math.floor(pidx / text.length) === Math.floor((pidx + keyword.length - 1) / text.length))) {
                if (text === keyword || keyword.length === text.length) {
                    isArray ? matched.push(item) : (matched[i] = item);
                } else {
                    isArray ? find.push(item) : (find[i] = item);
                }
            }
        });
        return {
            match: matched,
            find: find
        };
    }
});

/**
 * 对DOM操作的通用函数
 * @type {{}}
 */
BI.DOM = {};
BI.extend(BI.DOM, {

    /**
     * 把dom数组或元素悬挂起来,使其不对html产生影响
     * @param dom
     */
    hang: function (doms) {
        if (BI.isEmpty(doms)) {
            return;
        }
        var frag = document.createDocumentFragment();
        BI.each(doms, function (i, dom) {
            dom instanceof BI.Widget && (dom = dom.element);
            dom instanceof $ && dom[0] && frag.appendChild(dom[0]);
        });
        return frag;
    },

    isExist: function (obj) {
        return $("body").find(obj.element).length > 0;
    },

    // 预加载图片
    preloadImages: function (srcArray, onload) {
        var count = 0, images = [];

        function complete () {
            count++;
            if (count >= srcArray.length) {
                onload();
            }
        }

        BI.each(srcArray, function (i, src) {
            images[i] = new Image();
            images[i].src = src;
            images[i].onload = function () {
                complete();
            };
            images[i].onerror = function () {
                complete();
            };
        });
    },

    isColor: function (color) {
        return color && (this.isRGBColor(color) || this.isHexColor(color));
    },

    isRGBColor: function (color) {
        if (!color) {
            return false;
        }
        return color.substr(0, 3) === "rgb";
    },

    isHexColor: function (color) {
        if (!color) {
            return false;
        }
        return color[0] === "#" && color.length === 7;
    },

    isDarkColor: function (hex) {
        if (!hex || !this.isHexColor(hex)) {
            return false;
        }
        var rgb = this.rgb2json(this.hex2rgb(hex));
        var grayLevel = Math.round(rgb.r * 0.299 + rgb.g * 0.587 + rgb.b * 0.114);
        if (grayLevel < 192/** 网上给的是140**/) {
            return true;
        }
        return false;
    },

    // 获取对比颜色
    getContrastColor: function (color) {
        if (!color || !this.isColor(color)) {
            return "";
        }
        if (this.isDarkColor(color)) {
            return "#ffffff";
        }
        return "#1a1a1a";
    },

    rgb2hex: function (rgbColour) {
        if (!rgbColour || rgbColour.substr(0, 3) != "rgb") {
            return "";
        }
        var rgbValues = rgbColour.match(/\d+(\.\d+)?/g);
        var red = BI.parseInt(rgbValues[0]);
        var green = BI.parseInt(rgbValues[1]);
        var blue = BI.parseInt(rgbValues[2]);

        var hexColour = "#" + this.int2hex(red) + this.int2hex(green) + this.int2hex(blue);

        return hexColour;
    },

    rgb2json: function (rgbColour) {
        if (!rgbColour) {
            return {};
        }
        if (!this.isRGBColor(rgbColour)) {
            return {};
        }
        var rgbValues = rgbColour.match(/\d+(\.\d+)?/g);
        return {
            r: BI.parseInt(rgbValues[0]),
            g: BI.parseInt(rgbValues[1]),
            b: BI.parseInt(rgbValues[2])
        };
    },

    rgba2json: function (rgbColour) {
        if (!rgbColour) {
            return {};
        }
        var rgbValues = rgbColour.match(/\d+(\.\d+)?/g);
        return {
            r: BI.parseInt(rgbValues[0]),
            g: BI.parseInt(rgbValues[1]),
            b: BI.parseInt(rgbValues[2]),
            a: BI.parseFloat(rgbValues[3])
        };
    },

    json2rgb: function (rgb) {
        if (!BI.isKey(rgb.r) || !BI.isKey(rgb.g) || !BI.isKey(rgb.b)) {
            return "";
        }
        return "rgb(" + rgb.r + "," + rgb.g + "," + rgb.b + ")";
    },

    json2rgba: function (rgba) {
        if (!BI.isKey(rgba.r) || !BI.isKey(rgba.g) || !BI.isKey(rgba.b)) {
            return "";
        }
        return "rgba(" + rgba.r + "," + rgba.g + "," + rgba.b + "," + rgba.a + ")";
    },

    int2hex: function (strNum) {
        var hexdig = ["0", "1", "2", "3", "4", "5", "6", "7", "8", "9", "a", "b", "c", "d", "e", "f"];

        return hexdig[strNum >>> 4] + "" + hexdig[strNum & 15];
    },

    hex2rgb: function (color) {
        if (!color) {
            return "";
        }
        if (!this.isHexColor(color)) {
            return color;
        }
        var tempValue = "rgb(", colorArray;

        if (color.length === 7) {
            colorArray = [BI.parseInt("0x" + color.substring(1, 3)),
                BI.parseInt("0x" + color.substring(3, 5)),
                BI.parseInt("0x" + color.substring(5, 7))];
        } else if (color.length === 4) {
            colorArray = [BI.parseInt("0x" + color.substring(1, 2)),
                BI.parseInt("0x" + color.substring(2, 3)),
                BI.parseInt("0x" + color.substring(3, 4))];
        }
        tempValue += colorArray[0] + ",";
        tempValue += colorArray[1] + ",";
        tempValue += colorArray[2] + ")";

        return tempValue;
    },

    rgba2rgb: function (rgbColour, BGcolor) {
        if (BI.isNull(BGcolor)) {
            BGcolor = 1;
        }
        if (rgbColour.substr(0, 4) != "rgba") {
            return "";
        }
        var rgbValues = rgbColour.match(/\d+(\.\d+)?/g);
        if (rgbValues.length < 4) {
            return "";
        }
        var R = BI.parseFloat(rgbValues[0]);
        var G = BI.parseFloat(rgbValues[1]);
        var B = BI.parseFloat(rgbValues[2]);
        var A = BI.parseFloat(rgbValues[3]);

        return "rgb(" + Math.floor(255 * (BGcolor * (1 - A )) + R * A) + "," +
            Math.floor(255 * (BGcolor * (1 - A )) + G * A) + "," +
            Math.floor(255 * (BGcolor * (1 - A )) + B * A) + ")";
    },

    getTextSizeWidth: function (text, fontSize) {
        var span = $("<span></span>").addClass("text-width-span").appendTo($("body"));

        if (fontSize == null) {
            fontSize = 12;
        }
        fontSize = fontSize + "px";

        span.css("font-size", fontSize).text(text);

        var width = span.width();
        span.remove();

        return width;
    },

    // 获取滚动条的宽度
    getScrollWidth: function () {
        if (this._scrollWidth == null) {
            var ul = $("<div>").width(50).height(50).css({
                position: "absolute",
                top: "-9999px",
                overflow: "scroll"
            }).appendTo($("body"));
            this._scrollWidth = ul[0].offsetWidth - ul[0].clientWidth;
            ul.destroy();
        }
        return this._scrollWidth;
    },

    getImage: function (param, fillStyle, backgroundColor) {
        var canvas = document.createElement("canvas");
        var ratio = 2;
        $("body").append(canvas);
        var w = BI.DOM.getTextSizeWidth(param, 14) + 6;
        canvas.width = w * ratio;
        canvas.height = 24 * ratio;
        var ctx = canvas.getContext("2d");
        // ctx.fillStyle = "#EAF2FD";
        ctx.font = 12 * ratio + "px Georgia";
        ctx.fillStyle = fillStyle || "#3D4D66";
        ctx.textBaseline = "middle";
        ctx.fillText(param, 6 * ratio, 12 * ratio);
        $(canvas).destroy();
        var backColor = backgroundColor || "#EAF2FD";
        return {
            width: w,
            height: 24,
            src: canvas.toDataURL("image/png"),
            style: "background-color: " + backColor + ";vertical-align: middle; margin: 0 3px; width:" + w + "px;height: 24px",
            param: param
        };
    }
});(function () {
    var constantInjection = {};
    BI.constant = function (xtype, cls) {
        if (constantInjection[xtype] != null) {
            console.error("constant:[" + xtype + "] has been registed");
        }
        constantInjection[xtype] = cls;
    };

    var modelInjection = {};
    BI.model = function (xtype, cls) {
        if (modelInjection[xtype] != null) {
            console.error("model:[" + xtype + "] has been registed");
        }
        modelInjection[xtype] = cls;
    };

    var storeInjection = {};
    BI.store = function (xtype, cls) {
        if (storeInjection[xtype] != null) {
            console.error("store:[" + xtype + "] has been registed");
        }
        storeInjection[xtype] = cls;
    };

    var serviceInjection = {};
    BI.service = function (xtype, cls) {
        if (serviceInjection[xtype] != null) {
            console.error("service:[" + xtype + "] has been registed");
        }
        serviceInjection[xtype] = cls;
    };

    var providerInjection = {};
    BI.provider = function (xtype, cls) {
        if (providerInjection[xtype] != null) {
            console.error("provider:[" + xtype + "] has been registed");
        }
        providerInjection[xtype] = cls;
    };

    BI.config = function (type, configFn) {
        if (constantInjection[type]) {
            return constantInjection[type] = configFn(constantInjection[type]);
        }
        if (providerInjection[type]) {
            if (!providers[type]) {
                providers[type] = new providerInjection[type]();
            }
            return configFn(providers[type]);
        }
        BI.Plugin.configWidget(type, configFn);
    };

    var actions = {};
    var globalAction = [];
    BI.action = function (type, actionFn) {
        if (BI.isFunction(type)) {
            globalAction.push(type);
            return function () {
                BI.remove(globalAction, actionFn);
            };
        }
        if (!actions[type]) {
            actions[type] = [];
        }
        actions[type].push(actionFn);
        return function () {
            actions[type].remove(actionFn);
            if (actions[type].length === 0) {
                delete actions[type];
            }
        };
    };

    var points = {};
    BI.point = function (type, action, pointFn, after) {
        if (!points[type]) {
            points[type] = {};
        }
        if (!points[type][action]) {
            points[type][action] = {};
        }
        if (!points[type][action][after ? "after" : "before"]) {
            points[type][action][after ? "after" : "before"] = [];
        }
        points[type][action][after ? "after" : "before"].push(pointFn);
    };

    BI.Constants = {
        getConstant: function (type) {
            return constantInjection[type];
        }
    };

    var callPoint = function (inst, type) {
        if (points[type]) {
            for (var action in points[type]) {
                var bfns = points[type][action].before;
                if (bfns) {
                    BI.aspect.before(inst, action, function (bfns) {
                        return function () {
                            for (var i = 0, len = bfns.length; i < len; i++) {
                                try {
                                    bfns[i].apply(inst, arguments);
                                } catch (e) {
                                    console.error(e);
                                }
                            }
                        };
                    }(bfns));
                }
                var afns = points[type][action].after;
                if (afns) {
                    BI.aspect.after(inst, action, function (afns) {
                        return function () {
                            for (var i = 0, len = afns.length; i < len; i++) {
                                try {
                                    afns[i].apply(inst, arguments);
                                } catch (e) {
                                    console.error(e);
                                }
                            }
                        };
                    }(afns));
                }
            }
        }
    };

    BI.Models = {
        getModel: function (type, config) {
            var inst = new modelInjection[type](config);
            callPoint(inst, type);
            return inst;
        }
    };

    var stores = {};

    BI.Stores = {
        getStore: function (type, config) {
            if (stores[type]) {
                return stores[type];
            }
            stores[type] = new storeInjection[type](config);
            callPoint(stores[type], type);
            return stores[type];
        }
    };

    var services = {};

    BI.Services = {
        getService: function (type, config) {
            if (services[type]) {
                return services[type];
            }
            services[type] = new serviceInjection[type](config);
            callPoint(services[type], type);
            return services[type];
        }
    };

    var providers = {}, providerInstance = {};

    BI.Providers = {
        getProvider: function (type, config) {
            if (!providers[type]) {
                providers[type] = new providerInjection[type]();
            }
            if (!providerInstance[type]) {
                providerInstance[type] = new providers[type].$get()(config);
            }
            return providerInstance[type];
        }
    };

    BI.Actions = {
        runAction: function (type, event, config) {
            BI.each(actions[type], function (i, act) {
                try {
                    act(event, config);
                } catch (e) {
                    console.error(e);
                }
            });
        },
        runGlobalAction: function () {
            var args = [].slice.call(arguments);
            BI.each(globalAction, function (i, act) {
                try {
                    act.apply(null, args);
                } catch (e) {
                    console.error(e);
                }
            });
        }
    };
})();
/**
 * guy
 * 检测某个Widget的EventChange事件然后去show某个card
 * @type {*|void|Object}
 * @class BI.ShowListener
 * @extends BI.OB
 */
BI.ShowListener = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.ShowListener.superclass._defaultConfig.apply(this, arguments), {
            eventObj: BI.createWidget(),
            cardLayout: null,
            cardNameCreator: function (v) {
                return v;
            },
            cardCreator: BI.emptyFn,
            afterCardCreated: BI.emptyFn,
            afterCardShow: BI.emptyFn
        });
    },

    _init: function () {
        BI.ShowListener.superclass._init.apply(this, arguments);
        var self = this, o = this.options;
        o.eventObj.on(BI.Controller.EVENT_CHANGE, function (type, v, ob) {
            if (type === BI.Events.CLICK) {
                v = v || o.eventObj.getValue();
                v = BI.isArray(v) ? (v.length > 1 ? v.toString() : v[0]) : v;
                if (BI.isNull(v)) {
                    throw new Error("value cannot be null");
                }
                var cardName = o.cardNameCreator(v);
                if (!o.cardLayout.isCardExisted(cardName)) {
                    var card = o.cardCreator(cardName);
                    o.cardLayout.addCardByName(cardName, card);
                    o.afterCardCreated(cardName);
                }
                o.cardLayout.showCardByName(cardName);
                BI.nextTick(function () {
                    o.afterCardShow(cardName);
                    self.fireEvent(BI.ShowListener.EVENT_CHANGE, cardName);
                });
            }
        });
    }
});
BI.ShowListener.EVENT_CHANGE = "ShowListener.EVENT_CHANGE";/**
 * style加载管理器
 *
 * Created by GUY on 2015/9/7.
 * @class
 */
BI.StyleLoaderManager = BI.inherit(BI.OB, {
    _defaultConfig: function () {
        return BI.extend(BI.StyleLoaderManager.superclass._defaultConfig.apply(this, arguments), {});
    },

    _init: function () {
        BI.StyleLoaderManager.superclass._init.apply(this, arguments);
        this.stylesManager = {};
    },

    loadStyle: function (name, styleString) {
        var d = document, styles = d.createElement("style");
        d.getElementsByTagName("head")[0].appendChild(styles);
        styles.setAttribute("type", "text/css");
        if (styles.styleSheet) {
            styles.styleSheet.cssText = styleString;
        } else {
            styles.appendChild(document.createTextNode(styleString));
        }
        this.stylesManager[name] = styles;

        return this;
    },

    get: function (name) {
        return this.stylesManager[name];
    },

    has: function (name) {
        return this.stylesManager[name] != null;
    },

    removeStyle: function (name) {
        if (!this.has(name)) {
            return this;
        }
        this.stylesManager[name].parentNode.removeChild(this.stylesManager[name]);
        delete this.stylesManager[name];
        return this;
    }
});/**
 * @class BI.Logic
 * @extends BI.OB
 */
BI.Logic = BI.inherit(BI.OB, {
    createLogic: function () {
        return this.options || {};
    }
});

BI.LogicFactory = {
    Type: {
        Vertical: "vertical",
        Horizontal: "horizontal",
        Table: "table",
        HorizontalFill: "horizontal_fill"
    },
    createLogic: function (key, options) {
        var logic;
        switch (key) {
            case BI.LogicFactory.Type.Vertical:
                logic = BI.VerticalLayoutLogic;
                break;
            case BI.LogicFactory.Type.Horizontal:
                logic = BI.HorizontalLayoutLogic;
                break;
            case BI.LogicFactory.Type.Table:
                logic = BI.TableLayoutLogic;
                break;
            case BI.LogicFactory.Type.HorizontalFill:
                logic = BI.HorizontalFillLayoutLogic;
                break;
            default :
                logic = BI.Logic;
                break;
        }
        return new logic(options).createLogic();
    },

    createLogicTypeByDirection: function (direction) {
        switch (direction) {
            case BI.Direction.Top:
            case BI.Direction.Bottom:
            case BI.Direction.Custom:
                return BI.LogicFactory.Type.Vertical;
                break;
            case BI.Direction.Left:
            case BI.Direction.Right:
                return BI.LogicFactory.Type.Horizontal;
        }
    },

    createLogicItemsByDirection: function (direction) {
        var layout;
        var items = Array.prototype.slice.call(arguments, 1);
        items = BI.map(items, function (i, item) {
            if (BI.isWidget(item)) {
                return {
                    el: item,
                    width: item.options.width,
                    height: item.options.height
                };
            }
            return item;
        });
        switch (direction) {
            case BI.Direction.Bottom:
                layout = BI.LogicFactory.Type.Vertical;
                items.reverse();
                break;
            case BI.Direction.Right:
                layout = BI.LogicFactory.Type.Horizontal;
                items.reverse();
                break;
            case BI.Direction.Custom:
                items = items.slice(1);
                break;
        }
        return items;
    }
};/**
 * guy
 * 上下布局逻辑
 * 上下布局的时候要考虑到是动态布局还是静态布局
 *
 * @class BI.VerticalLayoutLogic
 * @extends BI.Logic
 */
BI.VerticalLayoutLogic = BI.inherit(BI.Logic, {
    _defaultConfig: function () {
        return BI.extend(BI.VerticalLayoutLogic.superclass._defaultConfig.apply(this, arguments), {
            dynamic: false,
            scrollable: null,
            scrolly: false,
            scrollx: false,
            items: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    createLogic: function () {
        var layout, o = this.options;
        if (o.dynamic) {
            layout = "bi.vertical";
        } else {
            layout = "bi.vtape";
        }
        return {
            type: layout,
            scrollable: o.scrollable,
            scrolly: o.scrolly,
            scrollx: o.scrollx,
            hgap: o.hgap,
            vgap: o.vgap,
            lgap: o.lgap,
            rgap: o.rgap,
            tgap: o.tgap,
            bgap: o.bgap,
            items: o.items
        };
    },

    _init: function () {
        BI.VerticalLayoutLogic.superclass._init.apply(this, arguments);
    }
});


/**
 * guy
 * 左右布局逻辑
 * 左右布局的时候要考虑到是动态布局还是静态布局
 *
 * @class BI.HorizontalLayoutLogic
 * @extends BI.Logic
 */
BI.HorizontalLayoutLogic = BI.inherit(BI.Logic, {
    _defaultConfig: function () {
        return BI.extend(BI.HorizontalLayoutLogic.superclass._defaultConfig.apply(this, arguments), {
            dynamic: false,
            scrollable: null,
            scrolly: false,
            scrollx: false,
            items: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    createLogic: function () {
        var layout, o = this.options;
        if (o.dynamic) {
            layout = "bi.vertical_adapt";
        } else {
            layout = "bi.htape";
        }
        return {
            type: layout,
            scrollable: o.scrollable,
            scrolly: o.scrolly,
            scrollx: o.scrollx,
            hgap: o.hgap,
            vgap: o.vgap,
            lgap: o.lgap,
            rgap: o.rgap,
            tgap: o.tgap,
            bgap: o.bgap,
            items: o.items
        };
    },

    _init: function () {
        BI.HorizontalLayoutLogic.superclass._init.apply(this, arguments);
    }
});

/**
 * guy
 * 表格布局逻辑
 * 表格布局的时候要考虑到是动态布局还是静态布局
 *
 * @class BI.TableLayoutLogic
 * @extends BI.OB
 */
BI.TableLayoutLogic = BI.inherit(BI.Logic, {
    _defaultConfig: function () {
        return BI.extend(BI.TableLayoutLogic.superclass._defaultConfig.apply(this, arguments), {
            dynamic: false,
            scrollable: null,
            scrolly: false,
            scrollx: false,
            columns: 0,
            rows: 0,
            columnSize: [],
            rowSize: [],
            hgap: 0,
            vgap: 0,
            items: []
        });
    },

    createLogic: function () {
        var layout, o = this.options;
        if (o.dynamic) {
            layout = "bi.table";
        } else {
            layout = "bi.window";
        }
        return {
            type: layout,
            scrollable: o.scrollable,
            scrolly: o.scrolly,
            scrollx: o.scrollx,
            columns: o.columns,
            rows: o.rows,
            columnSize: o.columnSize,
            rowSize: o.rowSize,
            hgap: o.hgap,
            vgap: o.vgap,
            items: o.items
        };
    },

    _init: function () {
        BI.TableLayoutLogic.superclass._init.apply(this, arguments);
    }
});

/**
 * guy
 * 左右充满布局逻辑
 *
 * @class BI.HorizontalFillLayoutLogic
 * @extends BI.Logic
 */
BI.HorizontalFillLayoutLogic = BI.inherit(BI.Logic, {
    _defaultConfig: function () {
        return BI.extend(BI.HorizontalFillLayoutLogic.superclass._defaultConfig.apply(this, arguments), {
            dynamic: false,
            scrollable: null,
            scrolly: false,
            scrollx: false,
            items: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    createLogic: function () {
        var layout, o = this.options;
        var columnSize = [];
        BI.each(o.items, function (i, item) {
            columnSize.push(item.width || 0);
        });
        if (o.dynamic) {
            layout = "bi.horizontal_adapt";
        } else {
            layout = "bi.htape";
        }
        return {
            type: layout,
            columnSize: columnSize,
            scrollable: o.scrollable,
            scrolly: o.scrolly,
            scrollx: o.scrollx,
            hgap: o.hgap,
            vgap: o.vgap,
            lgap: o.lgap,
            rgap: o.rgap,
            tgap: o.tgap,
            bgap: o.bgap,
            items: o.items
        };
    },

    _init: function () {
        BI.HorizontalFillLayoutLogic.superclass._init.apply(this, arguments);
    }
});/**
 * 对数组对象的扩展
 * @class Array
 */
_.extend(Array.prototype, {
    contains: function (o) {
        return this.indexOf(o) > -1;
    },

    /**
     * 从数组中移除指定的值,如果值不在数组中,则不产生任何效果
     * @param {Object} o 要移除的值
     * @return {Array} 移除制定值后的数组
     */
    remove: function (o) {
        var index = this.indexOf(o);
        if (index !== -1) {
            this.splice(index, 1);
        }
        return this;
    },

    pushArray: function (array) {
        for (var i = 0; i < array.length; i++) {
            this.push(array[i]);
        }
    },
    pushDistinct: function (obj) {
        if (!this.contains(obj)) {
            this.push(obj);
        }
    },
    pushDistinctArray: function (array) {
        for (var i = 0, len = array.length; i < len; i++) {
            this.pushDistinct(array[i]);
        }
    }
});
$(function () {
    // 牵扯到国际化这些常量在页面加载后再生效
    // full day names
    Date._DN = [BI.i18nText("BI-Basic_Sunday"),
        BI.i18nText("BI-Basic_Monday"),
        BI.i18nText("BI-Basic_Tuesday"),
        BI.i18nText("BI-Basic_Wednesday"),
        BI.i18nText("BI-Basic_Thursday"),
        BI.i18nText("BI-Basic_Friday"),
        BI.i18nText("BI-Basic_Saturday"),
        BI.i18nText("BI-Basic_Sunday")];

    // short day names
    Date._SDN = [BI.i18nText("BI-Basic_Simple_Sunday"),
        BI.i18nText("BI-Basic_Simple_Monday"),
        BI.i18nText("BI-Basic_Simple_Tuesday"),
        BI.i18nText("BI-Basic_Simple_Wednesday"),
        BI.i18nText("BI-Basic_Simple_Thursday"),
        BI.i18nText("BI-Basic_Simple_Friday"),
        BI.i18nText("BI-Basic_Simple_Saturday"),
        BI.i18nText("BI-Basic_Simple_Sunday")];

    // Monday first, etc.
    Date._FD = 1;

    // full month namesdat
    Date._MN = [
        BI.i18nText("BI-Basic_January"),
        BI.i18nText("BI-Basic_February"),
        BI.i18nText("BI-Basic_March"),
        BI.i18nText("BI-Basic_April"),
        BI.i18nText("BI-Basic_May"),
        BI.i18nText("BI-Basic_June"),
        BI.i18nText("BI-Basic_July"),
        BI.i18nText("BI-Basic_August"),
        BI.i18nText("BI-Basic_September"),
        BI.i18nText("BI-Basic_October"),
        BI.i18nText("BI-Basic_November"),
        BI.i18nText("BI-Basic_December")];

    // short month names
    Date._SMN = [0,
        1,
        2,
        3,
        4,
        5,
        6,
        7,
        8,
        9,
        10,
        11];

    Date._QN = ["", BI.i18nText("BI-Quarter_1"),
        BI.i18nText("BI-Quarter_2"),
        BI.i18nText("BI-Quarter_3"),
        BI.i18nText("BI-Quarter_4")];

    /** Adds the number of days array to the Date object. */
    Date._MD = [31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31];
});
/** Constants used for time computations */
Date.SECOND = 1000;
Date.MINUTE = 60 * Date.SECOND;
Date.HOUR = 60 * Date.MINUTE;
Date.DAY = 24 * Date.HOUR;
Date.WEEK = 7 * Date.DAY;

/**
 * 获取时区
 * @returns {String}
 */
Date.prototype.getTimezone = function () {
    return this.toString().replace(/^.* (?:\((.*)\)|([A-Z]{1,4})(?:[\-+][0-9]{4})?(?: -?\d+)?)$/, "$1$2").replace(/[^A-Z]/g, "");
};

/** Returns the number of days in the current month */
Date.prototype.getMonthDays = function (month) {
    var year = this.getFullYear();
    if (typeof month === "undefined") {
        month = this.getMonth();
    }
    if (((0 == (year % 4)) && ( (0 != (year % 100)) || (0 == (year % 400)))) && month == 1) {
        return 29;
    }
    return Date._MD[month];

};

/**
 * 获取每月的最后一天
 * @returns {Date}
 */
Date.prototype.getLastDateOfMonth = function () {
    return BI.getDate(this.getFullYear(), this.getMonth(), this.getMonthDays());
};

/** Returns the number of day in the year. */
Date.prototype.getDayOfYear = function () {
    var now = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0);
    var then = BI.getDate(this.getFullYear(), 0, 0, 0, 0, 0);
    var time = now - then;
    return Math.floor(time / Date.DAY);
};

/** Returns the number of the week in year, as defined in ISO 8601. */
Date.prototype.getWeekNumber = function () {
    var d = BI.getDate(this.getFullYear(), this.getMonth(), this.getDate(), 0, 0, 0);
    // 周一是一周第一天
    var week = d.getDay() === 0 ? 7 : d.getDay();
    // var week = d.getDay();
    if (this.getMonth() === 0 && this.getDate() <= week) {
        return 1;
    }
    d.setDate(this.getDate() - (week - 1));
    var ms = d.valueOf(); // GMT
    d.setMonth(0);
    d.setDate(1);
    var offset = Math.floor((ms - d.valueOf()) / (7 * 864e5)) + 1;
    if (d.getDay() !== 1) {
        offset++;
    }
    return offset;
};

Date.prototype.getQuarter = function () {
    return Math.floor(this.getMonth() / 3) + 1;
};

// 离当前时间多少天的时间
Date.prototype.getOffsetDate = function (offset) {
    return BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()) + offset * 864e5);
};

Date.prototype.getOffsetQuarter = function (n) {
    var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()));
    var day = dt.getDate();
    var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + BI.parseInt(n) * 3, 1).getMonthDays();
    if (day > monthDay) {
        day = monthDay;
    }
    dt.setDate(day);
    dt.setMonth(dt.getMonth() + parseInt(n) * 3);
    return dt;
};

// 得到本季度的起始月份
Date.prototype.getQuarterStartMonth = function () {
    var quarterStartMonth = 0;
    var nowMonth = this.getMonth();
    if (nowMonth < 3) {
        quarterStartMonth = 0;
    }
    if (2 < nowMonth && nowMonth < 6) {
        quarterStartMonth = 3;
    }
    if (5 < nowMonth && nowMonth < 9) {
        quarterStartMonth = 6;
    }
    if (nowMonth > 8) {
        quarterStartMonth = 9;
    }
    return quarterStartMonth;
};
// 获得本季度的起始日期
Date.prototype.getQuarterStartDate = function () {
    return BI.getDate(this.getFullYear(), this.getQuarterStartMonth(), 1);
};
// 得到本季度的结束日期
Date.prototype.getQuarterEndDate = function () {
    var quarterEndMonth = this.getQuarterStartMonth() + 2;
    return BI.getDate(this.getFullYear(), quarterEndMonth, this.getMonthDays(quarterEndMonth));
};

// 指定日期n个月之前或之后的日期
Date.prototype.getOffsetMonth = function (n) {
    var dt = BI.getDate(BI.getTime(this.getFullYear(), this.getMonth(), this.getDate(), this.getHours(), this.getMinutes(), this.getSeconds()));
    var day = dt.getDate();
    var monthDay = BI.getDate(dt.getFullYear(), dt.getMonth() + parseInt(n), 1).getMonthDays();
    if (day > monthDay) {
        day = monthDay;
    }
    dt.setDate(day);
    dt.setMonth(dt.getMonth() + parseInt(n));
    return dt;
};

// 获得本周的起始日期
Date.prototype.getWeekStartDate = function () {
    var w = this.getDay();
    return this.getOffsetDate(w === 0 ? -6 : 1 - w);
};
// 得到本周的结束日期
Date.prototype.getWeekEndDate = function () {
    var w = this.getDay();
    return this.getOffsetDate(w === 0 ? 0 : 7 - w);
};

/** Checks date and time equality */
Date.prototype.equalsTo = function (date) {
    return ((this.getFullYear() == date.getFullYear()) &&
    (this.getMonth() == date.getMonth()) &&
    (this.getDate() == date.getDate()) &&
    (this.getHours() == date.getHours()) &&
    (this.getMinutes() == date.getMinutes()) &&
    (this.getSeconds() == date.getSeconds()));
};

/** Set only the year, month, date parts (keep existing time) */
Date.prototype.setDateOnly = function (date) {
    var tmp = BI.getDate(date);
    this.setDate(1);
    this.setFullYear(tmp.getFullYear());
    this.setMonth(tmp.getMonth());
    this.setDate(tmp.getDate());
};
/** Prints the date in a string according to the given format. */
Date.prototype.print = function (str) {
    var m = this.getMonth();
    var d = this.getDate();
    var y = this.getFullYear();
    var yWith4number = y + "";
    while (yWith4number.length < 4) {
        yWith4number = "0" + yWith4number;
    }
    var wn = this.getWeekNumber();
    var qr = this.getQuarter();
    var w = this.getDay();
    var s = {};
    var hr = this.getHours();
    var pm = (hr >= 12);
    var ir = (pm) ? (hr - 12) : hr;
    var dy = this.getDayOfYear();
    if (ir == 0) {
        ir = 12;
    }
    var min = this.getMinutes();
    var sec = this.getSeconds();
    s["%a"] = Date._SDN[w]; // abbreviated weekday name [FIXME: I18N]
    s["%A"] = Date._DN[w]; // full weekday name
    s["%b"] = Date._SMN[m]; // abbreviated month name [FIXME: I18N]
    s["%B"] = Date._MN[m]; // full month name
    // FIXME: %c : preferred date and time representation for the current locale
    s["%C"] = 1 + Math.floor(y / 100); // the century number
    s["%d"] = (d < 10) ? ("0" + d) : d; // the day of the month (range 01 to 31)
    s["%e"] = d; // the day of the month (range 1 to 31)
    // FIXME: %D : american date style: %m/%d/%y
    // FIXME: %E, %F, %G, %g, %h (man strftime)
    s["%H"] = (hr < 10) ? ("0" + hr) : hr; // hour, range 00 to 23 (24h format)
    s["%I"] = (ir < 10) ? ("0" + ir) : ir; // hour, range 01 to 12 (12h format)
    s["%j"] = (dy < 100) ? ((dy < 10) ? ("00" + dy) : ("0" + dy)) : dy; // day of the year (range 001 to 366)
    s["%k"] = hr;		// hour, range 0 to 23 (24h format)
    s["%l"] = ir;		// hour, range 1 to 12 (12h format)
    s["%X"] = (m < 9) ? ("0" + (1 + m)) : (1 + m); // month, range 01 to 12
    s["%x"] = m + 1; // month, range 1 to 12
    s["%M"] = (min < 10) ? ("0" + min) : min; // minute, range 00 to 59
    s["%n"] = "\n";		// a newline character
    s["%p"] = pm ? "PM" : "AM";
    s["%P"] = pm ? "pm" : "am";
    // FIXME: %r : the time in am/pm notation %I:%M:%S %p
    // FIXME: %R : the time in 24-hour notation %H:%M
    s["%s"] = Math.floor(this.getTime() / 1000);
    s["%S"] = (sec < 10) ? ("0" + sec) : sec; // seconds, range 00 to 59
    s["%t"] = "\t";		// a tab character
    // FIXME: %T : the time in 24-hour notation (%H:%M:%S)
    s["%U"] = s["%W"] = s["%V"] = (wn < 10) ? ("0" + wn) : wn;
    s["%u"] = w + 1;	// the day of the week (range 1 to 7, 1 = MON)
    s["%w"] = w;		// the day of the week (range 0 to 6, 0 = SUN)
    // FIXME: %x : preferred date representation for the current locale without the time
    // FIXME: %X : preferred time representation for the current locale without the date
    s["%y"] = yWith4number.substr(2, 2); // year without the century (range 00 to 99)
    s["%Y"] = yWith4number;		// year with the century
    s["%%"] = "%";		// a literal '%' character
    s["%Q"] = qr;

    var re = /%./g;
    if (!BI.isKhtml()) {
        return str.replace(re, function (par) {
            return s[par] || par;
        });
    }

    var a = str.match(re);
    for (var i = 0; i < a.length; i++) {
        var tmp = s[a[i]];
        if (tmp) {
            re = new RegExp(a[i], "g");
            str = str.replace(re, tmp);
        }
    }

    return str;
};
/*
 * 给jQuery.Event对象添加的工具方法
 */
$.extend($.Event.prototype, {
    // event.stopEvent
    stopEvent: function () {
        this.stopPropagation();
        this.preventDefault();
    }
});Function.prototype.before = function (func) {
    var __self = this;
    return function () {
        if (func.apply(this, arguments) === false) {
            return false;
        }
        return __self.apply(this, arguments);
    };
};

Function.prototype.after = function (func) {
    var __self = this;
    return function () {
        var ret = __self.apply(this, arguments);
        if (ret === false) {
            return false;
        }
        func.apply(this, arguments);
        return ret;
    };
};if (jQuery) {
    (function ($) {
        // richer:容器在其各个边缘留出的空间
        if (!$.fn.insets) {
            $.fn.insets = function () {
                var p = this.padding(),
                    b = this.border();
                return {
                    top: p.top,
                    bottom: p.bottom + b.bottom + b.top,
                    left: p.left,
                    right: p.right + b.right + b.left
                };
            };
        }

        // richer:获取 && 设置jQuery元素的边界
        if (!$.fn.bounds) {
            $.fn.bounds = function (value) {
                var tmp = {hasIgnoredBounds: true};

                if (value) {
                    if (!isNaN(value.x)) {
                        tmp.left = value.x;
                    }
                    if (!isNaN(value.y)) {
                        tmp.top = value.y;
                    }
                    if (value.width != null) {
                        tmp.width = (value.width - (this.outerWidth(true) - this.width()));
                        tmp.width = (tmp.width >= 0) ? tmp.width : value.width;
                        // fix chrome
                        // tmp.width = (tmp.width >= 0) ? tmp.width : 0;
                    }
                    if (value.height != null) {
                        tmp.height = value.height - (this.outerHeight(true) - this.height());
                        tmp.height = (tmp.height >= 0) ? tmp.height : value.height;
                        // fix chrome
                        // tmp.height = (tmp.height >= 0) ? tmp.height : value.0;
                    }
                    this.css(tmp);
                    return this;
                }
                
                // richer:注意此方法只对可见元素有效
                tmp = this.position();
                return {
                    x: tmp.left,
                    y: tmp.top,
                    // richer:这里计算外部宽度和高度的时候,都不包括边框
                    width: this.outerWidth(),
                    height: this.outerHeight()
                };
                
            };
        }
    })(jQuery);
}
if (!Number.prototype.toFixed || (0.00008).toFixed(3) !== "0.000" ||
    (0.9).toFixed(0) === "0" || (1.255).toFixed(2) !== "1.25" ||
    (1000000000000000128).toFixed(0) !== "1000000000000000128") {
    (function () {
        var base, size, data, i;
        base = 1e7;
        size = 6;
        data = [0, 0, 0, 0, 0, 0];
        function multiply (n, c) {
            var i = -1;
            while (++i < size) {
                c += n * data[i];
                data[i] = c % base;
                c = Math.floor(c / base);
            }
        }

        function divide (n) {
            var i = size, c = 0;
            while (--i >= 0) {
                c += data[i];
                data[i] = Math.floor(c / n);
                c = (c % n) * base;
            }
        }

        function toString () {
            var i = size;
            var s = "";
            while (--i >= 0) {
                if (s !== "" || i === 0 || data[i] !== 0) {
                    var t = String(data[i]);
                    if (s === "") {
                        s = t;
                    } else {
                        s += "0000000".slice(0, 7 - t.length) + t;
                    }
                }
            }
            return s;
        }

        function pow (x, n, acc) {
            return (n === 0 ? acc : (n % 2 === 1 ? pow(x, n - 1, acc * x)
                : pow(x * x, n / 2, acc)));
        }

        function log (x) {
            var n = 0;
            while (x >= 4096) {
                n += 12;
                x /= 4096;
            }
            while (x >= 2) {
                n += 1;
                x /= 2;
            }
            return n;
        }

        Number.prototype.toFixed = function (fractionDigits) {
            var f, x, s, m, e, z, j, k;
            f = Number(fractionDigits);
            f = f !== f ? 0 : Math.floor(f);

            if (f < 0 || f > 20) {
                throw new RangeError("Number.toFixed called with invalid number of decimals");
            }

            x = Number(this);

            if (x !== x) {
                return "NaN";
            }

            if (x <= -1e21 || x > 1e21) {
                return String(x);
            }

            s = "";

            if (x < 0) {
                s = "-";
                x = -x;
            }

            m = "0";

            if (x > 1e-21) {
                // 1e-21<x<1e21
                // -70<log2(x)<70
                e = log(x * pow(2, 69, 1)) - 69;
                z = (e < 0 ? x * pow(2, -e, 1) : x / pow(2, e, 1));
                z *= 0x10000000000000;// Math.pow(2,52);
                e = 52 - e;

                // -18<e<122
                // x=z/2^e
                if (e > 0) {
                    multiply(0, z);
                    j = f;

                    while (j >= 7) {
                        multiply(1e7, 0);
                        j -= 7;
                    }

                    multiply(pow(10, j, 1), 0);
                    j = e - 1;

                    while (j >= 23) {
                        divide(1 << 23);
                        j -= 23;
                    }
                    divide(1 << j);
                    multiply(1, 1);
                    divide(2);
                    m = toString();
                } else {
                    multiply(0, z);
                    multiply(1 << (-e), 0);
                    m = toString() + "0.00000000000000000000".slice(2, 2 + f);
                }
            }

            if (f > 0) {
                k = m.length;

                if (k <= f) {
                    m = s + "0.0000000000000000000".slice(0, f - k + 2) + m;
                } else {
                    m = s + m.slice(0, k - f) + "." + m.slice(k - f);
                }
            } else {
                m = s + m;
            }

            return m;
        };

    })();
}


/**
 ** 加法函数,用来得到精确的加法结果
 ** 说明:javascript的加法结果会有误差,在两个浮点数相加的时候会比较明显。这个函数返回较为精确的加法结果。
 ** 调用:accAdd(arg1,arg2)
 ** 返回值:arg1加上arg2的精确结果
 **/
function accAdd (arg1, arg2) {
    var r1, r2, m, c;
    try {
        r1 = arg1.toString().split(".")[1].length;
    } catch (e) {
        r1 = 0;
    }
    try {
        r2 = arg2.toString().split(".")[1].length;
    } catch (e) {
        r2 = 0;
    }
    c = Math.abs(r1 - r2);
    m = Math.pow(10, Math.max(r1, r2));
    if (c > 0) {
        var cm = Math.pow(10, c);
        if (r1 > r2) {
            arg1 = Number(arg1.toString().replace(".", ""));
            arg2 = Number(arg2.toString().replace(".", "")) * cm;
        } else {
            arg1 = Number(arg1.toString().replace(".", "")) * cm;
            arg2 = Number(arg2.toString().replace(".", ""));
        }
    } else {
        arg1 = Number(arg1.toString().replace(".", ""));
        arg2 = Number(arg2.toString().replace(".", ""));
    }
    return (arg1 + arg2) / m;
}

// 给Number类型增加一个add方法,调用起来更加方便。
Number.prototype.add = function (arg) {
    return accAdd(arg, this);
};
/**
 ** 减法函数,用来得到精确的减法结果
 ** 说明:javascript的减法结果会有误差,在两个浮点数相减的时候会比较明显。这个函数返回较为精确的减法结果。
 ** 调用:accSub(arg1,arg2)
 ** 返回值:arg1加上arg2的精确结果
 **/
function accSub (arg1, arg2) {
    var r1, r2, m, n;
    try {
        r1 = arg1.toString().split(".")[1].length;
    } catch (e) {
        r1 = 0;
    }
    try {
        r2 = arg2.toString().split(".")[1].length;
    } catch (e) {
        r2 = 0;
    }
    m = Math.pow(10, Math.max(r1, r2)); // last modify by deeka //动态控制精度长度
    n = (r1 >= r2) ? r1 : r2;
    return ((arg1 * m - arg2 * m) / m).toFixed(n);
}

// 给Number类型增加一个mul方法,调用起来更加方便。
Number.prototype.sub = function (arg) {
    return accSub(this, arg);
};
/**
 ** 乘法函数,用来得到精确的乘法结果
 ** 说明:javascript的乘法结果会有误差,在两个浮点数相乘的时候会比较明显。这个函数返回较为精确的乘法结果。
 ** 调用:accMul(arg1,arg2)
 ** 返回值:arg1乘以 arg2的精确结果
 **/
function accMul (arg1, arg2) {
    var m = 0, s1 = arg1.toString(), s2 = arg2.toString();
    try {
        m += s1.split(".")[1].length;
    } catch (e) {
    }
    try {
        m += s2.split(".")[1].length;
    } catch (e) {
    }
    return Number(s1.replace(".", "")) * Number(s2.replace(".", "")) / Math.pow(10, m);
}

// 给Number类型增加一个mul方法,调用起来更加方便。
Number.prototype.mul = function (arg) {
    return accMul(arg, this);
};

/**
 * Return digits length of a number
 * @param {*number} num Input number
 */
function digitLength (num) {
    // Get digit length of e
    var eSplit = num.toString().split(/[eE]/);
    var len = (eSplit[0].split(".")[1] || "").length - (+(eSplit[1] || 0));
    return len > 0 ? len : 0;
}
/**
 * 把小数转成整数,支持科学计数法。如果是小数则放大成整数
 * @param {*number} num 输入数
 */
function float2Fixed (num) {
    if (num.toString().indexOf("e") === -1) {
        return Number(num.toString().replace(".", ""));
    }
    var dLen = digitLength(num);
    return dLen > 0 ? num * Math.pow(10, dLen) : num;
}

/**
 * 精确乘法
 */
function times (num1, num2) {
    var others = [];
    for (var _i = 2; _i < arguments.length; _i++) {
        others[_i - 2] = arguments[_i];
    }
    if (others.length > 0) {
        return times.apply(void 0, [times(num1, num2), others[0]].concat(others.slice(1)));
    }
    var num1Changed = float2Fixed(num1);
    var num2Changed = float2Fixed(num2);
    var baseNum = digitLength(num1) + digitLength(num2);
    var leftValue = num1Changed * num2Changed;
    return leftValue / Math.pow(10, baseNum);
}

/**
 * 精确除法
 */
function accDivide (num1, num2) {
    var others = [];
    for (var _i = 2; _i < arguments.length; _i++) {
        others[_i - 2] = arguments[_i];
    }
    if (others.length > 0) {
        return accDivide.apply(void 0, [accDivide(num1, num2), others[0]].concat(others.slice(1)));
    }
    var num1Changed = float2Fixed(num1);
    var num2Changed = float2Fixed(num2);
    return times((num1Changed / num2Changed), Math.pow(10, digitLength(num2) - digitLength(num1)));
}

// 给Number类型增加一个div方法,调用起来更加方便。
Number.prototype.div = function (arg) {
    return accDivide(this, arg);
};/**
 * 对字符串对象的扩展
 * @class String
 */
_.extend(String.prototype, {

    /**
     * 判断字符串是否已指定的字符串开始
     * @param {String} startTag   指定的开始字符串
     * @return {Boolean}  如果字符串以指定字符串开始则返回true,否则返回false
     */
    startWith: function (startTag) {
        if (startTag == null || startTag == "" || this.length === 0 || startTag.length > this.length) {
            return false;
        }
        return this.substr(0, startTag.length) == startTag;
    },
    /**
     * 判断字符串是否以指定的字符串结束
     * @param {String} endTag 指定的字符串
     * @return {Boolean}  如果字符串以指定字符串结束则返回true,否则返回false
     */
    endWith: function (endTag) {
        if (endTag == null || endTag == "" || this.length === 0 || endTag.length > this.length) {
            return false;
        }
        return this.substring(this.length - endTag.length) == endTag;
    },

    /**
     * 获取url中指定名字的参数
     * @param {String} name 参数的名字
     * @return {String} 参数的值
     */
    getQuery: function (name) {
        var reg = new RegExp("(^|&)" + name + "=([^&]*)(&|$)");
        var r = this.substr(this.indexOf("?") + 1).match(reg);
        if (r) {
            return unescape(r[2]);
        }
        return null;
    },

    /**
     * 给url加上给定的参数
     * @param {Object} paras 参数对象,是一个键值对对象
     * @return {String} 添加了给定参数的url
     */
    appendQuery: function (paras) {
        if (!paras) {
            return this;
        }
        var src = this;
        // 没有问号说明还没有参数
        if (src.indexOf("?") === -1) {
            src += "?";
        }
        // 如果以问号结尾,说明没有其他参数
        if (src.endWith("?") !== false) {
        } else {
            src += "&";
        }
        _.each(paras, function (value, name) {
            if (typeof(name) === "string") {
                src += name + "=" + value + "&";
            }
        });
        src = src.substr(0, src.length - 1);
        return src;
    },
    /**
     * 将所有符合第一个字符串所表示的字符串替换成为第二个字符串
     * @param {String} s1 要替换的字符串的正则表达式
     * @param {String} s2 替换的结果字符串
     * @returns {String} 替换后的字符串
     */
    replaceAll: function (s1, s2) {
        return this.replace(new RegExp(s1, "gm"), s2);
    },
    /**
     * 总是让字符串以指定的字符开头
     * @param {String} start 指定的字符
     * @returns {String} 以指定字符开头的字符串
     */
    perfectStart: function (start) {
        if (this.startWith(start)) {
            return this;
        }
        return start + this;

    },

    /**
     * 获取字符串中某字符串的所有项位置数组
     * @param {String} sub 子字符串
     * @return {Number[]} 子字符串在父字符串中出现的所有位置组成的数组
     */
    allIndexOf: function (sub) {
        if (typeof sub !== "string") {
            return [];
        }
        var str = this;
        var location = [];
        var offset = 0;
        while (str.length > 0) {
            var loc = str.indexOf(sub);
            if (loc === -1) {
                break;
            }
            location.push(offset + loc);
            str = str.substring(loc + sub.length, str.length);
            offset += loc + sub.length;
        }
        return location;
    }
});BI.EventListener = {
    listen: function listen (target, eventType, callback) {
        if (target.addEventListener) {
            target.addEventListener(eventType, callback, false);
            return {
                remove: function remove () {
                    target.removeEventListener(eventType, callback, false);
                }
            };
        } else if (target.attachEvent) {
            target.attachEvent("on" + eventType, callback);
            return {
                remove: function remove () {
                    target.detachEvent("on" + eventType, callback);
                }
            };
        }
    },

    capture: function capture (target, eventType, callback) {
        if (target.addEventListener) {
            target.addEventListener(eventType, callback, true);
            return {
                remove: function remove () {
                    target.removeEventListener(eventType, callback, true);
                }
            };
        }
        return {
            remove: BI.emptyFn
        };
        
    },

    registerDefault: function registerDefault () {
    }
};!(function () {
    var cancelAnimationFrame =
        window.cancelAnimationFrame ||
        window.webkitCancelAnimationFrame ||
        window.mozCancelAnimationFrame ||
        window.oCancelAnimationFrame ||
        window.msCancelAnimationFrame ||
        window.clearTimeout;

    var requestAnimationFrame = window.requestAnimationFrame || window.webkitRequestAnimationFrame || window.mozRequestAnimationFrame || window.oRequestAnimationFrame || window.msRequestAnimationFrame || window.setTimeout;


    BI.MouseMoveTracker = function (onMove, onMoveEnd, domNode) {
        this._isDragging = false;
        this._animationFrameID = null;
        this._domNode = domNode;
        this._onMove = onMove;
        this._onMoveEnd = onMoveEnd;

        this._onMouseMove = BI.bind(this._onMouseMove, this);
        this._onMouseUp = BI.bind(this._onMouseUp, this);
        this._didMouseMove = BI.bind(this._didMouseMove, this);
    };
    BI.MouseMoveTracker.prototype = {
        constructor: BI.MouseMoveTracker,
        captureMouseMoves: function (/* object*/ event) {
            if (!this._eventMoveToken && !this._eventUpToken) {
                this._eventMoveToken = BI.EventListener.listen(
                    this._domNode,
                    "mousemove",
                    this._onMouseMove
                );
                this._eventUpToken = BI.EventListener.listen(
                    this._domNode,
                    "mouseup",
                    this._onMouseUp
                );
            }

            if (!this._isDragging) {
                this._deltaX = 0;
                this._deltaY = 0;
                this._isDragging = true;
                this._x = event.clientX;
                this._y = event.clientY;
            }
            event.preventDefault ? event.preventDefault() : (event.returnValue = false);
        },

        releaseMouseMoves: function () {
            if (this._eventMoveToken && this._eventUpToken) {
                this._eventMoveToken.remove();
                this._eventMoveToken = null;
                this._eventUpToken.remove();
                this._eventUpToken = null;
            }

            if (this._animationFrameID !== null) {
                cancelAnimationFrame(this._animationFrameID);
                this._animationFrameID = null;
            }

            if (this._isDragging) {
                this._isDragging = false;
                this._x = null;
                this._y = null;
            }
        },

        isDragging: function () /* boolean*/ {
            return this._isDragging;
        },

        _onMouseMove: function (/* object*/ event) {
            var x = event.clientX;
            var y = event.clientY;

            this._deltaX += (x - this._x);
            this._deltaY += (y - this._y);

            if (this._animationFrameID === null) {
                // The mouse may move faster then the animation frame does.
                // Use `requestAnimationFrame` to avoid over-updating.
                this._animationFrameID =
                    requestAnimationFrame(this._didMouseMove);
            }

            this._x = x;
            this._y = y;
            event.preventDefault ? event.preventDefault() : (event.returnValue = false);
        },

        _didMouseMove: function () {
            this._animationFrameID = null;
            this._onMove(this._deltaX, this._deltaY);
            this._deltaX = 0;
            this._deltaY = 0;
        },

        _onMouseUp: function () {
            if (this._animationFrameID) {
                this._didMouseMove();
            }
            this._onMoveEnd();
        }
    };
})();!(function () {
    var PIXEL_STEP = 10;
    var LINE_HEIGHT = 40;
    var PAGE_HEIGHT = 800;
    var requestAnimationFrame = window.requestAnimationFrame || window.webkitRequestAnimationFrame || window.mozRequestAnimationFrame || window.oRequestAnimationFrame || window.msRequestAnimationFrame || window.setTimeout;

    function normalizeWheel (/* object*/event) /* object*/ {
        var sX = 0,
            sY = 0,
            // spinX, spinY
            pX = 0,
            pY = 0; // pixelX, pixelY

        // Legacy
        if ("detail" in event) {
            sY = event.detail;
        }
        if ("wheelDelta" in event) {
            sY = -event.wheelDelta / 120;
        }
        if ("wheelDeltaY" in event) {
            sY = -event.wheelDeltaY / 120;
        }
        if ("wheelDeltaX" in event) {
            sX = -event.wheelDeltaX / 120;
        }

        // side scrolling on FF with DOMMouseScroll
        if ("axis" in event && event.axis === event.HORIZONTAL_AXIS) {
            sX = sY;
            sY = 0;
        }

        pX = sX * PIXEL_STEP;
        pY = sY * PIXEL_STEP;

        if ("deltaY" in event) {
            pY = event.deltaY;
        }
        if ("deltaX" in event) {
            pX = event.deltaX;
        }

        if ((pX || pY) && event.deltaMode) {
            if (event.deltaMode === 1) {
                // delta in LINE units
                pX *= LINE_HEIGHT;
                pY *= LINE_HEIGHT;
            } else {
                // delta in PAGE units
                pX *= PAGE_HEIGHT;
                pY *= PAGE_HEIGHT;
            }
        }

        // Fall-back if spin cannot be determined
        if (pX && !sX) {
            sX = pX < 1 ? -1 : 1;
        }
        if (pY && !sY) {
            sY = pY < 1 ? -1 : 1;
        }

        return {
            spinX: sX,
            spinY: sY,
            pixelX: pX,
            pixelY: pY
        };
    }

    BI.WheelHandler = function (onWheel, handleScrollX, handleScrollY, stopPropagation) {
        this._animationFrameID = null;
        this._deltaX = 0;
        this._deltaY = 0;
        this._didWheel = BI.bind(this._didWheel, this);
        if (typeof handleScrollX !== "function") {
            handleScrollX = handleScrollX ?
                function () {
                    return true;
                } :
                function () {
                    return false;
                };
        }

        if (typeof handleScrollY !== "function") {
            handleScrollY = handleScrollY ?
                function () {
                    return true;
                } :
                function () {
                    return false;
                };
        }

        if (typeof stopPropagation !== "function") {
            stopPropagation = stopPropagation ?
                function () {
                    return true;
                } :
                function () {
                    return false;
                };
        }

        this._handleScrollX = handleScrollX;
        this._handleScrollY = handleScrollY;
        this._stopPropagation = stopPropagation;
        this._onWheelCallback = onWheel;
        this.onWheel = BI.bind(this.onWheel, this);
    };
    BI.WheelHandler.prototype = {
        constructor: BI.WheelHandler,
        onWheel: function (/* object*/ event) {
            var normalizedEvent = normalizeWheel(event);
            var deltaX = this._deltaX + normalizedEvent.pixelX;
            var deltaY = this._deltaY + normalizedEvent.pixelY;
            var handleScrollX = this._handleScrollX(deltaX, deltaY);
            var handleScrollY = this._handleScrollY(deltaY, deltaX);
            if (!handleScrollX && !handleScrollY) {
                return;
            }

            this._deltaX += handleScrollX ? normalizedEvent.pixelX : 0;
            this._deltaY += handleScrollY ? normalizedEvent.pixelY : 0;
            event.preventDefault ? event.preventDefault() : (event.returnValue = false);

            var changed;
            if (this._deltaX !== 0 || this._deltaY !== 0) {
                if (this._stopPropagation()) {
                    event.stopPropagation ? event.stopPropagation() : (event.cancelBubble = true);
                }
                changed = true;
            }

            if (changed === true && this._animationFrameID === null) {
                this._animationFrameID = requestAnimationFrame(this._didWheel);
            }
        },

        _didWheel: function () {
            this._animationFrameID = null;
            this._onWheelCallback(this._deltaX, this._deltaY);
            this._deltaX = 0;
            this._deltaY = 0;
        }
    };
})();/**
 * 常量
 */

_.extend(BI, {
    MAX: 0xfffffffffffffff,
    MIN: -0xfffffffffffffff,
    EVENT_RESPONSE_TIME: 200,
    zIndex_layer: 1e5,
    zIndex_popover: 1e6,
    zIndex_popup: 1e7,
    zIndex_masker: 1e8,
    zIndex_tip: 1e9,
    emptyStr: "",
    emptyFn: function () {
    },
    empty: null,
    Key: {
        48: "0",
        49: "1",
        50: "2",
        51: "3",
        52: "4",
        53: "5",
        54: "6",
        55: "7",
        56: "8",
        57: "9",
        65: "a",
        66: "b",
        67: "c",
        68: "d",
        69: "e",
        70: "f",
        71: "g",
        72: "h",
        73: "i",
        74: "j",
        75: "k",
        76: "l",
        77: "m",
        78: "n",
        79: "o",
        80: "p",
        81: "q",
        82: "r",
        83: "s",
        84: "t",
        85: "u",
        86: "v",
        87: "w",
        88: "x",
        89: "y",
        90: "z",
        96: "0",
        97: "1",
        98: "2",
        99: "3",
        100: "4",
        101: "5",
        102: "6",
        103: "7",
        104: "8",
        105: "9",
        106: "*",
        107: "+",
        109: "-",
        110: ".",
        111: "/"
    },
    KeyCode: {
        BACKSPACE: 8,
        COMMA: 188,
        DELETE: 46,
        DOWN: 40,
        END: 35,
        ENTER: 13,
        ESCAPE: 27,
        HOME: 36,
        LEFT: 37,
        NUMPAD_ADD: 107,
        NUMPAD_DECIMAL: 110,
        NUMPAD_DIVIDE: 111,
        NUMPAD_ENTER: 108,
        NUMPAD_MULTIPLY: 106,
        NUMPAD_SUBTRACT: 109,
        PAGE_DOWN: 34,
        PAGE_UP: 33,
        PERIOD: 190,
        RIGHT: 39,
        SPACE: 32,
        TAB: 9,
        UP: 38
    },
    Status: {
        SUCCESS: 1,
        WRONG: 2,
        START: 3,
        END: 4,
        WAITING: 5,
        READY: 6,
        RUNNING: 7,
        OUTOFBOUNDS: 8,
        NULL: -1
    },
    Direction: {
        Top: "top",
        Bottom: "bottom",
        Left: "left",
        Right: "right",
        Custom: "custom"
    },
    Axis: {
        Vertical: "vertical",
        Horizontal: "horizontal"
    },
    Selection: {
        Default: -2,
        None: -1,
        Single: 0,
        Multi: 1,
        All: 2
    },
    HorizontalAlign: {
        Left: "left",
        Right: "right",
        Center: "center",
        Stretch: "stretch"
    },
    VerticalAlign: {
        Middle: "middle",
        Top: "top",
        Bottom: "bottom",
        Stretch: "stretch"
    }
});BI.version = "2.0";/**
 * absolute实现的居中布局
 * @class BI.AbsoluteCenterLayout
 * @extends BI.Layout
 */
BI.AbsoluteCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.AbsoluteCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-absolute-center-layout",
            hgap: 0,
            lgap: 0,
            rgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.AbsoluteCenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.AbsoluteCenterLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "absolute",
            left: o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0),
            right: o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0),
            top: o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0),
            bottom: o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0),
            margin: "auto"
        });
        return w;
    },

    resize: function () {
        // console.log("absolute_center_adapt布局不需要resize");
    },

    populate: function (items) {
        BI.AbsoluteCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.absolute_center_adapt", BI.AbsoluteCenterLayout);/**
 * absolute实现的居中布局
 * @class BI.AbsoluteHorizontalLayout
 * @extends BI.Layout
 */
BI.AbsoluteHorizontalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.AbsoluteHorizontalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-absolute-horizontal-layout",
            hgap: 0,
            lgap: 0,
            rgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.AbsoluteHorizontalLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.AbsoluteHorizontalLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "absolute",
            left: o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0),
            right: o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0),
            margin: "auto"
        });
        if (o.vgap + o.tgap + (item.vgap || 0) + (item.tgap || 0) !== 0) {
            w.element.css("top", o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0));
        }
        if (o.vgap + o.bgap + (item.vgap || 0) + (item.bgap || 0) !== 0) {
            w.element.css("bottom", o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0));
        }
        return w;
    },

    resize: function () {
        // console.log("absolute_horizontal_adapt布局不需要resize");
    },

    populate: function (items) {
        BI.AbsoluteHorizontalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.absolute_horizontal_adapt", BI.AbsoluteHorizontalLayout);/**
 * absolute实现的居中布局
 * @class BI.AbsoluteVerticalLayout
 * @extends BI.Layout
 */
BI.AbsoluteVerticalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.AbsoluteVerticalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-absolute-vertical-layout",
            hgap: 0,
            lgap: 0,
            rgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.AbsoluteVerticalLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.AbsoluteVerticalLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "absolute",
            left: item.lgap,
            right: item.rgap,
            top: o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0),
            bottom: o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0),
            margin: "auto"
        });
        if (o.hgap + o.lgap + (item.hgap || 0) + (item.lgap || 0) !== 0) {
            w.element.css("left", o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0));
        }
        if (o.hgap + o.rgap + (item.hgap || 0) + (item.rgap || 0) !== 0) {
            w.element.css("right", o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0));
        }
        return w;
    },

    resize: function () {
        // console.log("absolute_vertical_adapt布局不需要resize");
    },

    populate: function (items) {
        BI.AbsoluteVerticalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.absolute_vertical_adapt", BI.AbsoluteVerticalLayout);/**
 * 自适应水平和垂直方向都居中容器
 * @class BI.CenterAdaptLayout
 * @extends BI.Layout
 */
BI.CenterAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.CenterAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-center-adapt-layout",
            columnSize: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.CenterAdaptLayout.superclass.render.apply(this, arguments);
        this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({
            position: "relative",
            width: "100%",
            height: "100%",
            "white-space": "nowrap",
            "border-spacing": "0px",
            border: "none",
            "border-collapse": "separate"
        });
        this.$tr = $("<tr>");
        this.$tr.appendTo(this.$table);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var td;
        var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i];
        if (!this.hasWidget(this._getChildName(i))) {
            var w = BI.createWidget(item);
            w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"});
            td = BI.createWidget({
                type: "bi.default",
                tagName: "td",
                attributes: {
                    width: width
                },
                items: [w]
            });
            this.addWidget(this._getChildName(i), td);
        } else {
            td = this.getWidgetByName(this._getChildName(i));
            td.element.attr("width", width);
        }
        td.element.css({"max-width": o.columnSize[i]});
        if (i === 0) {
            td.element.addClass("first-element");
        }
        td.element.css({
            position: "relative",
            height: "100%",
            "vertical-align": "middle",
            margin: "0",
            padding: "0",
            border: "none"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return td;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$tr.append(frag);
            this.element.append(this.$table);
        }
    },

    resize: function () {
        // console.log("center_adapt布局不需要resize");
    },

    _getWrapper: function () {
        return this.$tr;
    },

    populate: function (items) {
        BI.CenterAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.center_adapt", BI.CenterAdaptLayout);/**
 * 水平方向居中容器
 * @class BI.HorizontalAdaptLayout
 * @extends BI.Layout
 */
BI.HorizontalAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HorizontalAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-horizontal-adapt-layout",
            verticalAlign: BI.VerticalAlign.Top,
            columnSize: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.HorizontalAdaptLayout.superclass.render.apply(this, arguments);
        this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({
            position: "relative",
            width: "100%",
            "white-space": "nowrap",
            "border-spacing": "0px",
            border: "none",
            "border-collapse": "separate"
        });
        this.$tr = $("<tr>");
        this.$tr.appendTo(this.$table);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var td;
        var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i];
        if (!this.hasWidget(this._getChildName(i))) {
            var w = BI.createWidget(item);
            w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"});
            td = BI.createWidget({
                type: "bi.default",
                tagName: "td",
                attributes: {
                    width: width
                },
                items: [w]
            });
            this.addWidget(this._getChildName(i), td);
        } else {
            td = this.getWidgetByName(this._getChildName(i));
            td.element.attr("width", width);
        }
        td.element.css({"max-width": o.columnSize[i] + "px"});
        if (i === 0) {
            td.element.addClass("first-element");
        }
        td.element.css({
            position: "relative",
            "vertical-align": o.verticalAlign,
            margin: "0",
            padding: "0",
            border: "none"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return td;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$tr.append(frag);
            this.element.append(this.$table);
        }
    },

    resize: function () {
        // console.log("horizontal_adapt布局不需要resize");
    },

    _getWrapper: function () {
        return this.$tr;
    },

    populate: function (items) {
        BI.HorizontalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal_adapt", BI.HorizontalAdaptLayout);/**
 * 左右分离,垂直方向居中容器
 *          items:{
                left: [{el:{type:"bi.button"}}],
                right:[{el:{type:"bi.button"}}]
            }
 * @class BI.LeftRightVerticalAdaptLayout
 * @extends BI.Layout
 */
BI.LeftRightVerticalAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.LeftRightVerticalAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-left-right-vertical-adapt-layout",
            items: {},
            llgap: 0,
            lrgap: 0,
            lhgap: 0,
            rlgap: 0,
            rrgap: 0,
            rhgap: 0
        });
    },
    render: function () {
        BI.LeftRightVerticalAdaptLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("left_right_vertical_adapt布局不需要resize");
    },

    addItem: function () {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var o = this.options;
        if ("left" in items) {
            var left = BI.createWidget({
                type: "bi.vertical_adapt",
                items: items.left,
                hgap: o.lhgap,
                lgap: o.llgap,
                rgap: o.lrgap
            });
            left.element.css("height", "100%");
            BI.createWidget({
                type: "bi.left",
                element: this,
                items: [left]
            });
        }
        if ("right" in items) {
            var right = BI.createWidget({
                type: "bi.vertical_adapt",
                items: items.right,
                hgap: o.rhgap,
                lgap: o.rlgap,
                rgap: o.rrgap
            });
            right.element.css("height", "100%");
            BI.createWidget({
                type: "bi.right",
                element: this,
                items: [right]
            });
        }
    },

    populate: function (items) {
        BI.LeftRightVerticalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.left_right_vertical_adapt", BI.LeftRightVerticalAdaptLayout);


BI.LeftVerticalAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.LeftRightVerticalAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-left-vertical-adapt-layout",
            items: [],
            lgap: 0,
            rgap: 0,
            hgap: 0
        });
    },
    render: function () {
        BI.LeftVerticalAdaptLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("left_vertical_adapt布局不需要resize");
    },

    addItem: function () {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var o = this.options;
        var left = BI.createWidget({
            type: "bi.vertical_adapt",
            items: items,
            lgap: o.lgap,
            hgap: o.hgap,
            rgap: o.rgap
        });
        left.element.css("height", "100%");
        BI.createWidget({
            type: "bi.left",
            element: this,
            items: [left]
        });
    },

    populate: function (items) {
        BI.LeftVerticalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.left_vertical_adapt", BI.LeftVerticalAdaptLayout);

BI.RightVerticalAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.RightVerticalAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-right-vertical-adapt-layout",
            items: [],
            lgap: 0,
            rgap: 0,
            hgap: 0
        });
    },
    render: function () {
        BI.RightVerticalAdaptLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {

    },

    addItem: function () {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var o = this.options;
        var right = BI.createWidget({
            type: "bi.vertical_adapt",
            items: items,
            lgap: o.lgap,
            hgap: o.hgap,
            rgap: o.rgap
        });
        right.element.css("height", "100%");
        BI.createWidget({
            type: "bi.right",
            element: this,
            items: [right]
        });
    },

    populate: function (items) {
        BI.RightVerticalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.right_vertical_adapt", BI.RightVerticalAdaptLayout);/**
 * 垂直方向居中容器
 * @class BI.VerticalAdaptLayout
 * @extends BI.Layout
 */
BI.VerticalAdaptLayout = BI.inherit(BI.Layout, {
    props: {
        baseCls: "bi-vertical-adapt-layout",
        columnSize: [],
        horizontalAlign: BI.HorizontalAlign.Left,
        hgap: 0,
        vgap: 0,
        lgap: 0,
        rgap: 0,
        tgap: 0,
        bgap: 0
    },
    render: function () {
        BI.VerticalAdaptLayout.superclass.render.apply(this, arguments);
        var o = this.options;
        this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({
            position: "relative",
            width: o.horizontalAlign === BI.HorizontalAlign.Stretch ? "100%" : "auto",
            height: "100%",
            "white-space": "nowrap",
            "border-spacing": "0px",
            border: "none",
            "border-collapse": "separate"
        });
        this.$tr = $("<tr>");
        this.$tr.appendTo(this.$table);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var td;
        var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i];
        if (!this.hasWidget(this._getChildName(i))) {
            var w = BI.createWidget(item);
            w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"});
            td = BI.createWidget({
                type: "bi.default",
                tagName: "td",
                attributes: {
                    width: width
                },
                items: [w]
            });
            this.addWidget(this._getChildName(i), td);
        } else {
            td = this.getWidgetByName(this._getChildName(i));
            td.element.attr("width", width);
        }

        if (i === 0) {
            td.element.addClass("first-element");
        }
        td.element.css({
            position: "relative",
            height: "100%",
            "vertical-align": "middle",
            margin: "0",
            padding: "0",
            border: "none"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return td;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$tr.append(frag);
            this.element.append(this.$table);
        }
    },

    _getWrapper: function () {
        return this.$tr;
    },

    resize: function () {
        // console.log("vertical_adapt布局不需要resize");
    },

    populate: function (items) {
        BI.VerticalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.vertical_adapt", BI.VerticalAdaptLayout);/**
 * 水平方向居中自适应容器
 * @class BI.HorizontalAutoLayout
 * @extends BI.Layout
 */
BI.HorizontalAutoLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HorizontalAutoLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-horizon-auto-layout",
            hgap: 0,
            lgap: 0,
            rgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.HorizontalAutoLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.HorizontalAutoLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "relative",
            margin: "0px auto"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": (i === 0 ? o.vgap : 0) + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        // console.log("horizontal_adapt布局不需要resize");
    },

    populate: function (items) {
        BI.HorizontalAutoLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal_auto", BI.HorizontalAutoLayout);/**
 * 浮动的居中布局
 */
BI.FloatCenterAdaptLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FloatCenterAdaptLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-float-center-adapt-layout",
            items: [],
            hgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0,
            lgap: 0,
            rgap: 0
        });
    },
    render: function () {
        BI.FloatCenterAdaptLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("float_center_adapt布局不需要resize");
    },

    addItem: function () {
        // do nothing
        throw new Error("cannot be added");
    },

    mounted: function () {
        var self = this;
        var width = this.left.element.outerWidth(),
            height = this.left.element.outerHeight();
        this.left.element.width(width).height(height).css("float", "none");
        BI.remove(this._children, function (i, wi) {
            if (wi === self.container) {
                delete self._children[i];
            }
        });
        BI.createWidget({
            type: "bi.center_adapt",
            element: this,
            items: [this.left]
        });
    },

    stroke: function (items) {
        var self = this, o = this.options;
        this.left = BI.createWidget({
            type: "bi.vertical",
            items: items,
            hgap: o.hgap,
            vgap: o.vgap,
            tgap: o.tgap,
            bgap: o.bgap,
            lgap: o.lgap,
            rgap: o.rgap
        });

        this.container = BI.createWidget({
            type: "bi.left",
            element: this,
            items: [this.left]
        });

    },

    populate: function (items) {
        BI.FloatCenterAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.float_center_adapt", BI.FloatCenterAdaptLayout);/**
 * 浮动的水平居中布局
 */
BI.FloatHorizontalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FloatHorizontalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-float-horizontal-adapt-layout",
            items: [],
            hgap: 0,
            vgap: 0,
            tgap: 0,
            bgap: 0,
            lgap: 0,
            rgap: 0
        });
    },
    render: function () {
        BI.FloatHorizontalLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("float_horizontal_adapt布局不需要resize");
    },

    mounted: function () {
        var self = this;
        var width = this.left.element.width(),
            height = this.left.element.height();
        this.left.element.width(width).height(height).css("float", "none");
        BI.remove(this._children, function (i, wi) {
            if (wi === self.container) {
                delete self._children[i];
            }
        });
        BI.createWidget({
            type: "bi.horizontal_auto",
            element: this,
            items: [this.left]
        });
    },

    _addElement: function (i, item) {
        var self = this, o = this.options;
        this.left = BI.createWidget({
            type: "bi.vertical",
            items: [item],
            hgap: o.hgap,
            vgap: o.vgap,
            tgap: o.tgap,
            bgap: o.bgap,
            lgap: o.lgap,
            rgap: o.rgap
        });

        this.container = BI.createWidget({
            type: "bi.left",
            element: this,
            items: [this.left]
        });

        return this.left;
    },

    populate: function (items) {
        BI.HorizontalAutoLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal_float", BI.FloatHorizontalLayout);/**
 * 内联布局
 * @class BI.InlineCenterAdaptLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.InlineCenterAdaptLayout = BI.inherit(BI.Layout, {

    props: function () {
        return BI.extend(BI.InlineLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-inline-center-adapt-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.InlineCenterAdaptLayout.superclass.render.apply(this, arguments);
        this.element.css({
            whiteSpace: "nowrap"
        });
        this.populate(this.options.items);
    },

    _addElement: function (i, item, length) {
        var o = this.options;
        if (!this.hasWidget(this.getName() + i)) {
            var t = BI.createWidget(item);
            t.element.css({
                position: "relative"
            });
            var w = BI.createWidget({
                type: "bi.horizontal_auto",
                items: [t]
            });
            this.addWidget(this.getName() + i, w);
        } else {
            var w = this.getWidgetByName(this.getName() + i);
        }
        w.element.css({
            position: "relative",
            display: "inline-block",
            "vertical-align": "middle",
            "*display": "inline",
            "*zoom": 1,
            "min-width": 100 / length + "%"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    addItem: function (item) {
        throw new Error("不能添加元素");
    },

    stroke: function (items) {
        var self = this;
        BI.each(items, function (i, item) {
            if (item) {
                self._addElement(i, item, items.length);
            }
        });
    },

    populate: function (items) {
        BI.InlineCenterAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.inline_center_adapt", BI.InlineCenterAdaptLayout);/**
 * 内联布局
 * @class BI.InlineVerticalAdaptLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.InlineVerticalAdaptLayout = BI.inherit(BI.Layout, {

    props: function () {
        return BI.extend(BI.InlineLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-inline-vertical-adapt-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.InlineVerticalAdaptLayout.superclass.render.apply(this, arguments);
        this.element.css({
            whiteSpace: "nowrap"
        });
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.InlineVerticalAdaptLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "relative",
            display: "inline-block",
            "vertical-align": "middle",
            "*display": "inline",
            "*zoom": 1
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.InlineVerticalAdaptLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.inline_vertical_adapt", BI.InlineVerticalAdaptLayout);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexCenterLayout
 * @extends BI.Layout
 */
BI.FlexCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-center-layout"
        });
    },
    render: function () {
        BI.FlexCenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexCenterLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", "flex-shrink": "0"});
        return w;
    },

    resize: function () {
        // console.log("flex_center布局不需要resize");
    },

    populate: function (items) {
        BI.FlexCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_center", BI.FlexCenterLayout);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexHorizontalLayout
 * @extends BI.Layout
 */
BI.FlexHorizontalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexHorizontalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-horizontal-layout",
            verticalAlign: BI.VerticalAlign.Top,
            columnSize: [],
            scrollx: true,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FlexHorizontalLayout.superclass.render.apply(this, arguments);
        var o = this.options;
        this.element.addClass(o.verticalAlign);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexHorizontalLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", "flex-shrink": "0"});
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        // console.log("flex_horizontal布局不需要resize");
    },

    populate: function (items) {
        BI.FlexHorizontalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_horizontal", BI.FlexHorizontalLayout);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexVerticalCenter
 * @extends BI.Layout
 */
BI.FlexVerticalCenter = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexVerticalCenter.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-vertical-center",
            horizontalAlign: BI.HorizontalAlign.Left,
            columnSize: [],
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FlexVerticalCenter.superclass.render.apply(this, arguments);
        var o = this.options;
        this.element.addClass(o.horizontalAlign);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexVerticalCenter.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", "flex-shrink": "0"});
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        // console.log("flex_vertical_center布局不需要resize");
    },

    populate: function (items) {
        BI.FlexVerticalCenter.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_vertical_center", BI.FlexVerticalCenter);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexCenterLayout
 * @extends BI.Layout
 */
BI.FlexCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-wrapper-center-layout clearfix"
        });
    },
    render: function () {
        BI.FlexCenterLayout.superclass.render.apply(this, arguments);
        this.$wrapper = $("<div>").addClass("flex-wrapper-center-layout-wrapper");
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexCenterLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative"});
        return w;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$wrapper.append(frag);
            this.element.append(this.$wrapper);
        }
    },

    _getWrapper: function () {
        return this.$wrapper;
    },

    resize: function () {
        // console.log("flex_center布局不需要resize");
    },

    populate: function (items) {
        BI.FlexCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_wrapper_center", BI.FlexCenterLayout);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexHorizontalLayout
 * @extends BI.Layout
 */
BI.FlexHorizontalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexHorizontalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-wrapper-horizontal-layout clearfix",
            verticalAlign: BI.VerticalAlign.Middle,
            columnSize: [],
            // scrollable: true,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FlexHorizontalLayout.superclass.render.apply(this, arguments);
        var o = this.options;
        this.$wrapper = $("<div>").addClass("flex-wrapper-horizontal-layout-wrapper " + o.verticalAlign);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexHorizontalLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative"});
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$wrapper.append(frag);
            this.element.append(this.$wrapper);
        }
    },

    _getWrapper: function () {
        return this.$wrapper;
    },

    resize: function () {
        // console.log("flex_horizontal布局不需要resize");
    },

    populate: function (items) {
        BI.FlexHorizontalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_wrapper_horizontal", BI.FlexHorizontalLayout);/**
 *自适应水平和垂直方向都居中容器
 * Created by GUY on 2016/12/2.
 *
 * @class BI.FlexVerticalCenter
 * @extends BI.Layout
 */
BI.FlexVerticalCenter = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FlexVerticalCenter.superclass.props.apply(this, arguments), {
            baseCls: "bi-flex-wrapper-vertical-center clearfix",
            horizontalAlign: BI.HorizontalAlign.Middle,
            columnSize: [],
            // scrollable: true,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FlexVerticalCenter.superclass.render.apply(this, arguments);
        var o = this.options;
        this.$wrapper = $("<div>").addClass("flex-wrapper-vertical-center-wrapper " + o.horizontalAlign);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FlexVerticalCenter.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative"});
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$wrapper.append(frag);
            this.element.append(this.$wrapper);
        }
    },

    _getWrapper: function () {
        return this.$wrapper;
    },

    resize: function () {
        // console.log("flex_vertical_center布局不需要resize");
    },

    populate: function (items) {
        BI.FlexVerticalCenter.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.flex_wrapper_vertical_center", BI.FlexVerticalCenter);/**
 * 固定子组件上下左右的布局容器
 * @class BI.AbsoluteLayout
 * @extends BI.Layout
 */
BI.AbsoluteLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.AbsoluteLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-absolute-layout",
            hgap: null,
            vgap: null,
            lgap: null,
            rgap: null,
            tgap: null,
            bgap: null
        });
    },
    render: function () {
        BI.AbsoluteLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.AbsoluteLayout.superclass._addElement.apply(this, arguments);
        var left = 0, right = 0, top = 0, bottom = 0;
        if (BI.isNotNull(item.left)) {
            w.element.css({left: item.left});
            left += item.left;
        }
        if (BI.isNotNull(item.right)) {
            w.element.css({right: item.right});
            right += item.right;
        }
        if (BI.isNotNull(item.top)) {
            w.element.css({top: item.top});
            top += item.top;
        }
        if (BI.isNotNull(item.bottom)) {
            w.element.css({bottom: item.bottom});
            bottom += item.bottom;
        }

        if (BI.isNotNull(o.hgap)) {
            left += o.hgap;
            w.element.css({left: left});
            right += o.hgap;
            w.element.css({right: right});
        }
        if (BI.isNotNull(o.vgap)) {
            top += o.vgap;
            w.element.css({top: top});
            bottom += o.vgap;
            w.element.css({bottom: bottom});
        }

        if (BI.isNotNull(o.lgap)) {
            left += o.lgap;
            w.element.css({left: left});
        }
        if (BI.isNotNull(o.rgap)) {
            right += o.rgap;
            w.element.css({right: right});
        }
        if (BI.isNotNull(o.tgap)) {
            top += o.tgap;
            w.element.css({top: top});
        }
        if (BI.isNotNull(o.bgap)) {
            bottom += o.bgap;
            w.element.css({bottom: bottom});
        }


        if (BI.isNotNull(item.width)) {
            w.element.css({width: item.width});
        }
        if (BI.isNotNull(item.height)) {
            w.element.css({height: item.height});
        }
        w.element.css({position: "absolute"});
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    stroke: function (items) {
        this.options.items = items || [];
        var self = this;
        BI.each(items, function (i, item) {
            if (item) {
                if (!BI.isWidget(item) && !item.el) {
                    throw new Error("el must be exist");
                }
                self._addElement(i, item);
            }
        });
    },

    populate: function (items) {
        BI.AbsoluteLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.absolute", BI.AbsoluteLayout);BI.AdaptiveLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.AdaptiveLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-adaptive-layout",
            hgap: null,
            vgap: null,
            lgap: null,
            rgap: null,
            tgap: null,
            bgap: null
        });
    },
    render: function () {
        BI.AdaptiveLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.AdaptiveLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative"});
        var left = 0, right = 0, top = 0, bottom = 0;
        if (BI.isNotNull(item.left)) {
            w.element.css({
                "margin-left": item.left
            });
        }
        if (BI.isNotNull(item.right)) {
            w.element.css({
                "margin-right": item.right
            });
        }
        if (BI.isNotNull(item.top)) {
            w.element.css({
                "margin-top": item.top
            });
        }
        if (BI.isNotNull(item.bottom)) {
            w.element.css({
                "margin-bottom": item.bottom
            });
        }

        if (BI.isNotNull(o.hgap)) {
            left += o.hgap;
            w.element.css({left: left});
            right += o.hgap;
            w.element.css({right: right});
        }
        if (BI.isNotNull(o.vgap)) {
            top += o.vgap;
            w.element.css({top: top});
            bottom += o.vgap;
            w.element.css({bottom: bottom});
        }

        if (BI.isNotNull(o.lgap)) {
            left += o.lgap;
            w.element.css({left: left});
        }
        if (BI.isNotNull(o.rgap)) {
            right += o.rgap;
            w.element.css({right: right});
        }
        if (BI.isNotNull(o.tgap)) {
            top += o.tgap;
            w.element.css({top: top});
        }
        if (BI.isNotNull(o.bgap)) {
            bottom += o.bgap;
            w.element.css({bottom: bottom});
        }

        if (BI.isNotNull(item.width)) {
            w.element.css({width: item.width});
        }
        if (BI.isNotNull(item.height)) {
            w.element.css({height: item.height});
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.AbsoluteLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.adaptive", BI.AdaptiveLayout);/**
 * 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应
 *
 * @class BI.BorderLayout
 * @extends BI.Layout
 */
BI.BorderLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.BorderLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-border-layout",
            items: {}
        });
    },
    render: function () {
        BI.BorderLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (regions) {
        var item;
        var top = 0;
        var bottom = 0;
        var left = 0;
        var right = 0;
        if ("north" in regions) {
            item = regions["north"];
            if (item != null) {
                if (item.el) {
                    if (!this.hasWidget(this.getName() + "north")) {
                        var w = BI.createWidget(item);
                        this.addWidget(this.getName() + "north", w);
                    }
                    this.getWidgetByName(this.getName() + "north").element.height(item.height)
                        .css({
                            position: "absolute",
                            top: (item.top || 0),
                            left: (item.left || 0),
                            right: (item.right || 0),
                            bottom: "initial"
                        });
                }
                top = (item.height || 0) + (item.top || 0) + (item.bottom || 0);
            }
        }
        if ("south" in regions) {
            item = regions["south"];
            if (item != null) {
                if (item.el) {
                    if (!this.hasWidget(this.getName() + "south")) {
                        var w = BI.createWidget(item);
                        this.addWidget(this.getName() + "south", w);
                    }
                    this.getWidgetByName(this.getName() + "south").element.height(item.height)
                        .css({
                            position: "absolute",
                            bottom: (item.bottom || 0),
                            left: (item.left || 0),
                            right: (item.right || 0),
                            top: "initial"
                        });
                }
                bottom = (item.height || 0) + (item.top || 0) + (item.bottom || 0);
            }
        }
        if ("west" in regions) {
            item = regions["west"];
            if (item != null) {
                if (item.el) {
                    if (!this.hasWidget(this.getName() + "west")) {
                        var w = BI.createWidget(item);
                        this.addWidget(this.getName() + "west", w);
                    }
                    this.getWidgetByName(this.getName() + "west").element.width(item.width)
                        .css({
                            position: "absolute",
                            left: (item.left || 0),
                            top: top,
                            bottom: bottom,
                            right: "initial"
                        });
                }
                left = (item.width || 0) + (item.left || 0) + (item.right || 0);
            }
        }
        if ("east" in regions) {
            item = regions["east"];
            if (item != null) {
                if (item.el) {
                    if (!this.hasWidget(this.getName() + "east")) {
                        var w = BI.createWidget(item);
                        this.addWidget(this.getName() + "east", w);
                    }
                    this.getWidgetByName(this.getName() + "east").element.width(item.width)
                        .css({
                            position: "absolute",
                            right: (item.right || 0),
                            top: top,
                            bottom: bottom,
                            left: "initial"
                        });
                }
                right = (item.width || 0) + (item.left || 0) + (item.right || 0);
            }
        }
        if ("center" in regions) {
            item = regions["center"];
            if (item != null) {
                if (!this.hasWidget(this.getName() + "center")) {
                    var w = BI.createWidget(item);
                    this.addWidget(this.getName() + "center", w);
                }
                this.getWidgetByName(this.getName() + "center").element
                    .css({position: "absolute", top: top, bottom: bottom, left: left, right: right});
            }
        }
    },

    populate: function (items) {
        BI.BorderLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.border", BI.BorderLayout);/**
 * 卡片布局,可以做到当前只显示一个组件,其他的都隐藏
 * @class BI.CardLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {String} options.defaultShowName 默认展示的子组件名
 */
BI.CardLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.CardLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-card-layout",
            items: []
        });
    },
    render: function () {
        BI.CardLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("default布局不需要resize");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        this.showIndex = void 0;
        BI.each(items, function (i, item) {
            if (item) {
                if (!self.hasWidget(item.cardName)) {
                    var w = BI.createWidget(item);
                    w.on(BI.Events.DESTROY, function () {
                        var index = BI.findIndex(o.items, function (i, tItem) {
                            return tItem.cardName == item.cardName;
                        });
                        if (index > -1) {
                            o.items.splice(index, 1);
                        }
                    });
                    self.addWidget(item.cardName, w);
                } else {
                    var w = self.getWidgetByName(item.cardName);
                }
                w.element.css({position: "absolute", top: "0", right: "0", bottom: "0", left: "0"});
                w.setVisible(false);
            }
        });
    },

    update: function () {
    },

    empty: function () {
        BI.CardLayout.superclass.empty.apply(this, arguments);
        this.options.items = [];
    },

    populate: function (items) {
        BI.CardLayout.superclass.populate.apply(this, arguments);
        this._mount();
        this.options.defaultShowName && this.showCardByName(this.options.defaultShowName);
    },

    isCardExisted: function (cardName) {
        return BI.some(this.options.items, function (i, item) {
            return item.cardName == cardName && item.el;
        });
    },

    getCardByName: function (cardName) {
        if (!this.isCardExisted(cardName)) {
            throw new Error("cardName is not exist");
        }
        return this._children[cardName];
    },

    _deleteCardByName: function (cardName) {
        delete this._children[cardName];
        var index = BI.findIndex(this.options.items, function (i, item) {
            return item.cardName == cardName;
        });
        if (index > -1) {
            this.options.items.splice(index, 1);
        }
    },

    deleteCardByName: function (cardName) {
        if (!this.isCardExisted(cardName)) {
            throw new Error("cardName is not exist");
        }

        var child = this._children[cardName];
        this._deleteCardByName(cardName);
        child && child._destroy();
    },

    addCardByName: function (cardName, cardItem) {
        if (this.isCardExisted(cardName)) {
            throw new Error("cardName is already exist");
        }
        var widget = BI.createWidget(cardItem, this);
        widget.element.css({
            position: "relative",
            top: "0",
            left: "0",
            width: "100%",
            height: "100%"
        }).appendTo(this.element);
        widget.invisible();
        this.addWidget(cardName, widget);
        this.options.items.push({el: cardItem, cardName: cardName});
        return widget;
    },

    showCardByName: function (name, action, callback) {
        var self = this;
        // name不存在的时候全部隐藏
        var exist = this.isCardExisted(name);
        if (this.showIndex != null) {
            this.lastShowIndex = this.showIndex;
        }
        this.showIndex = name;
        var flag = false;
        BI.each(this.options.items, function (i, item) {
            var el = self._children[item.cardName];
            if (el) {
                if (name != item.cardName) {
                    // 动画效果只有在全部都隐藏的时候才有意义,且只要执行一次动画操作就够了
                    !flag && !exist && (BI.Action && action instanceof BI.Action) ? (action.actionBack(el), flag = true) : el.invisible();
                } else {
                    (BI.Action && action instanceof BI.Action) ? action.actionPerformed(void 0, el, callback) : (el.visible(), callback && callback());
                }
            }
        });
    },

    showLastCard: function () {
        var self = this;
        this.showIndex = this.lastShowIndex;
        BI.each(this.options.items, function (i, item) {
            self._children[item.cardName].setVisible(self.showIndex == i);
        });
    },

    setDefaultShowName: function (name) {
        this.options.defaultShowName = name;
        return this;
    },

    getDefaultShowName: function () {
        return this.options.defaultShowName;
    },

    getAllCardNames: function () {
        return BI.map(this.options.items, function (i, item) {
            return item.cardName;
        });
    },

    getShowingCard: function () {
        if (!BI.isKey(this.showIndex)) {
            return void 0;
        }
        return this.getWidgetByName(this.showIndex);
    },

    deleteAllCard: function () {
        var self = this;
        BI.each(this.getAllCardNames(), function (i, name) {
            self.deleteCardByName(name);
        });
    },

    hideAllCard: function () {
        var self = this;
        BI.each(this.options.items, function (i, item) {
            self._children[item.cardName].invisible();
        });
    },

    isAllCardHide: function () {
        var self = this;
        var flag = true;
        BI.some(this.options.items, function (i, item) {
            if (self._children[item.cardName].isVisible()) {
                flag = false;
                return false;
            }
        });
        return flag;
    },

    removeWidget: function (nameOrWidget) {
        var removeName;
        if (BI.isWidget(nameOrWidget)) {
            BI.each(this._children, function (name, child) {
                if (child === nameOrWidget) {
                    removeName = name;
                }
            });
        } else {
            removeName = nameOrWidget;
        }
        if (removeName) {
            this._deleteCardByName(removeName);
        }
    }
});
BI.shortcut("bi.card", BI.CardLayout);/**
 * 默认的布局方式
 *
 * @class BI.DefaultLayout
 * @extends BI.Layout
 */
BI.DefaultLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.DefaultLayout.superclass.props.apply(this, arguments), {
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0,
            items: []
        });
    },
    render: function () {
        BI.DefaultLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.DefaultLayout.superclass._addElement.apply(this, arguments);
        if (o.vgap + o.tgap + (item.tgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) !== 0) {
            w.element.css({
                "margin-left": o.hgap + o.lgap + (item.lgap || 0) + "px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        // console.log("default布局不需要resize")
    },

    populate: function (items) {
        BI.DefaultLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.default", BI.DefaultLayout);/**
 * 分隔容器的控件,按照宽度和高度所占比平分整个容器
 *
 * @class BI.DivisionLayout
 * @extends BI.Layout
 */
BI.DivisionLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.DivisionLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-division-layout",
            columns: null,
            rows: null,
            items: []
            //    [
            //    {
            //        column: 0,
            //        row: 0,
            //        width: 0.25,
            //        height: 0.33,
            //        el: {type: 'bi.button', text: 'button1'}
            //    },
            //    {
            //        column: 1,
            //        row: 1,
            //        width: 0.25,
            //        height: 0.33,
            //        el: {type: 'bi.button', text: 'button2'}
            //    },
            //    {
            //        column: 3,
            //        row: 2,
            //        width: 0.25,
            //        height: 0.33,
            //        el: {type: 'bi.button', text: 'button3'}
            //    }
            // ]
        });
    },
    render: function () {
        BI.DivisionLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        this.stroke(this.opitons.items);
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var o = this.options;
        var rows = o.rows || o.items.length, columns = o.columns || ((o.items[0] && o.items[0].length) | 0);
        var map = BI.makeArray(rows), widths = {}, heights = {};
        function firstElement (item, row, col) {
            if (row === 0) {
                item.addClass("first-row");
            }
            if (col === 0) {
                item.addClass("first-col");
            }
            item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row");
            item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col");
            item.addClass("center-element");
        }

        function firstObject (item, row, col) {
            var cls = "";
            if (row === 0) {
                cls += " first-row";
            }
            if (col === 0) {
                cls += " first-col";
            }
            BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row");
            BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col");
            item.cls = (item.cls || "") + cls + " center-element";
        }

        function first (item, row, col) {
            if (item instanceof BI.Widget) {
                firstElement(item.element, row, col);
            } else if (item.el instanceof BI.Widget) {
                firstElement(item.el.element, row, col);
            } else if (item.el) {
                firstObject(item.el, row, col);
            } else {
                firstObject(item, row, col);
            }
        }
        BI.each(map, function (i) {
            map[i] = BI.makeArray(columns);
        });
        BI.each(items, function (i, item) {
            if (BI.isArray(item)) {
                BI.each(item, function (j, el) {
                    widths[i] = (widths[i] || 0) + item.width;
                    heights[j] = (heights[j] || 0) + item.height;
                    map[i][j] = el;
                });
                return;
            }
            widths[item.row] = (widths[item.row] || 0) + item.width;
            heights[item.column] = (heights[item.column] || 0) + item.height;
            map[item.row][item.column] = item;
        });
        for (var i = 0; i < rows; i++) {
            var totalW = 0;
            for (var j = 0; j < columns; j++) {
                if (!map[i][j]) {
                    throw new Error("item be required");
                }
                if(!this.hasWidget(this.getName() + i + "_" + j)) {
                    var w = BI.createWidget(map[i][j]);
                    this.addWidget(this.getName() + i + "_" + j, w);
                } else {
                    w = this.getWidgetByName(this.getName() + i + "_" + j);
                }
                var left = totalW * 100 / widths[i];
                w.element.css({position: "absolute", left: left + "%"});
                if (j > 0) {
                    var lastW = this.getWidgetByName(this.getName() + i + "_" + (j - 1));
                    lastW.element.css({right: (100 - left) + "%"});
                }
                if (j == o.columns - 1) {
                    w.element.css({right: "0%"});
                }
                first(w, i, j);
                totalW += map[i][j].width;
            }
        }
        for (var j = 0; j < o.columns; j++) {
            var totalH = 0;
            for (var i = 0; i < o.rows; i++) {
                var w = this.getWidgetByName(this.getName() + i + "_" + j);
                var top = totalH * 100 / heights[j];
                w.element.css({top: top + "%"});
                if (i > 0) {
                    var lastW = this.getWidgetByName(this.getName() + (i - 1) + "_" + j);
                    lastW.element.css({bottom: (100 - top) + "%"});
                }
                if (i == o.rows - 1) {
                    w.element.css({bottom: "0%"});
                }
                totalH += map[i][j].height;
            }
        }
    },

    populate: function (items) {
        BI.DivisionLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.division", BI.DivisionLayout);/**
 * 靠左对齐的自由浮动布局
 * @class BI.FloatLeftLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.FloatLeftLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FloatLeftLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-float-left-layout clearfix",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FloatLeftLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FloatLeftLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", float: "left"});
        if (BI.isNotNull(item.left)) {
            w.element.css({left: item.left});
        }
        if (BI.isNotNull(item.right)) {
            w.element.css({right: item.right});
        }
        if (BI.isNotNull(item.top)) {
            w.element.css({top: item.top});
        }
        if (BI.isNotNull(item.bottom)) {
            w.element.css({bottom: item.bottom});
        }
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.FloatLeftLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.left", BI.FloatLeftLayout);

/**
 * 靠右对齐的自由浮动布局
 * @class BI.FloatRightLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.FloatRightLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FloatRightLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-float-right-layout clearfix",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FloatRightLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.FloatRightLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", float: "right"});
        if (BI.isNotNull(item.left)) {
            w.element.css({left: item.left});
        }
        if (BI.isNotNull(item.right)) {
            w.element.css({right: item.right});
        }
        if (BI.isNotNull(item.top)) {
            w.element.css({top: item.top});
        }
        if (BI.isNotNull(item.bottom)) {
            w.element.css({bottom: item.bottom});
        }
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": (i === 0 ? o.hgap : 0) + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.FloatRightLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.right", BI.FloatRightLayout);/**
 * 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应
 *
 * @class BI.BorderLayout
 * @extends BI.Layout
 */
BI.GridLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.GridLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-grid-layout",
            columns: null,
            rows: null,
            items: []
            /* [
             {
             column: 0,
             row: 0,
             el: {type: 'bi.button', text: 'button1'}
             },
             {
             column: 1,
             row: 1,
             el: {type: 'bi.button', text: 'button2'}
             },
             {
             column: 3,
             row: 2,
             el: {type: 'bi.button', text: 'button3'}
             }
             ]*/
        });
    },
    render: function () {
        BI.GridLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("grid布局不需要resize")
    },

    addItem: function () {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        var rows = o.rows || o.items.length, columns = o.columns || ((o.items[0] && o.items[0].length) | 0);
        var width = 100 / columns, height = 100 / rows;
        var els = [];
        for (var i = 0; i < rows; i++) {
            els[i] = [];
        }
        function firstElement (item, row, col) {
            if (row === 0) {
                item.addClass("first-row");
            }
            if (col === 0) {
                item.addClass("first-col");
            }
            item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row");
            item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col");
            item.addClass("center-element");
        }

        function firstObject (item, row, col) {
            var cls = "";
            if (row === 0) {
                cls += " first-row";
            }
            if (col === 0) {
                cls += " first-col";
            }
            BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row");
            BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col");
            item.cls = (item.cls || "") + cls + " center-element";
        }

        function first (item, row, col) {
            if (item instanceof BI.Widget) {
                firstElement(item.element, row, col);
            } else if (item.el instanceof BI.Widget) {
                firstElement(item.el.element, row, col);
            } else if (item.el) {
                firstObject(item.el, row, col);
            } else {
                firstObject(item, row, col);
            }
        }

        BI.each(items, function (i, item) {
            if (BI.isArray(item)) {
                BI.each(item, function (j, el) {
                    els[i][j] = BI.createWidget(el);
                });
                return;
            }
            els[item.row][item.column] = BI.createWidget(item);
        });
        for (var i = 0; i < rows; i++) {
            for (var j = 0; j < columns; j++) {
                if (!els[i][j]) {
                    els[i][j] = BI.createWidget({
                        type: "bi.layout"
                    });
                }
                first(els[i][j], i, j);
                els[i][j].element.css({
                    position: "absolute",
                    top: height * i + "%",
                    left: width * j + "%",
                    right: (100 - (width * (j + 1))) + "%",
                    bottom: (100 - (height * (i + 1))) + "%"
                });
                this.addWidget(els[i][j]);
            }
        }
    },

    populate: function (items) {
        BI.GridLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.grid", BI.GridLayout);/**
 * 水平布局
 * @class BI.HorizontalLayout
 * @extends BI.Layout
 */
BI.HorizontalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HorizontalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-horizontal-layout",
            verticalAlign: BI.VerticalAlign.Top,
            columnSize: [],
            scrollx: true,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.HorizontalLayout.superclass.render.apply(this, arguments);
        this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({
            position: "relative",
            "white-space": "nowrap",
            "border-spacing": "0px",
            border: "none",
            "border-collapse": "separate"
        });
        this.$tr = $("<tr>");
        this.$tr.appendTo(this.$table);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var td;
        var width = o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i];
        if (!this.hasWidget(this._getChildName(i))) {
            var w = BI.createWidget(item);
            w.element.css({position: "relative", margin: "0px auto"});
            td = BI.createWidget({
                type: "bi.default",
                tagName: "td",
                attributes: {
                    width: width
                },
                items: [w]
            });
            this.addWidget(this._getChildName(i), td);
        } else {
            td = this.getWidgetByName(this._getChildName(i));
            td.element.attr("width", width);
        }

        if (i === 0) {
            td.element.addClass("first-element");
        }
        td.element.css({
            position: "relative",
            "vertical-align": o.verticalAlign,
            margin: "0",
            padding: "0",
            border: "none"
        });

        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return td;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$tr.append(frag);
            this.element.append(this.$table);
        }
    },


    resize: function () {
        // console.log("horizontal layout do not need to resize");
    },

    _getWrapper: function () {
        return this.$tr;
    },

    populate: function (items) {
        BI.HorizontalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal", BI.HorizontalLayout);

/**
 * 水平布局
 * @class BI.HorizontalCellLayout
 * @extends BI.Layout
 */
BI.HorizontalCellLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HorizontalCellLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-horizontal-cell-layout",
            scrollable: true,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.HorizontalCellLayout.superclass.render.apply(this, arguments);
        this.element.css({display: "table", "vertical-align": "top"});
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.HorizontalCellLayout.superclass._addElement.apply(this, arguments);
        w.element.css({position: "relative", display: "table-cell", "vertical-align": "middle"});
        if (o.hgap + o.lgap > 0) {
            w.element.css({
                "margin-left": o.hgap + o.lgap + "px"
            });
        }
        if (o.hgap + o.rgap > 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + "px"
            });
        }
        if (o.vgap + o.tgap > 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + "px"
            });
        }
        if (o.vgap + o.bgap > 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + "px"
            });
        }
        return w;
    },

    resize: function () {
        // console.log("horizontal do not need to resize");
    },

    populate: function (items) {
        BI.HorizontalCellLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal_cell", BI.HorizontalCellLayout);/**
 * 内联布局
 * @class BI.InlineLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.InlineLayout = BI.inherit(BI.Layout, {

    props: function () {
        return BI.extend(BI.InlineLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-inline-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.InlineLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.InlineLayout.superclass._addElement.apply(this, arguments);
        w.element.css({"position": "relative", display: "inline-block", "*display": "inline", "*zoom": 1});
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": (i === 0 ? o.hgap : 0) + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.InlineLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.inline", BI.InlineLayout);/**
 * 靠左对齐的自由浮动布局
 * @class BI.LatticeLayout
 * @extends BI.Layout
 *
 * @cfg {JSON} options 配置属性
 * @cfg {Number} [hgap=0] 水平间隙
 * @cfg {Number} [vgap=0] 垂直间隙
 */
BI.LatticeLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.LatticeLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-lattice-layout clearfix"
            // columnSize: [0.2, 0.2, 0.6],
        });
    },
    render: function () {
        BI.LatticeLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.LatticeLayout.superclass._addElement.apply(this, arguments);
        if (o.columnSize && o.columnSize[i]) {
            var width = o.columnSize[i] / BI.sum(o.columnSize) * 100 + "%";
        } else {
            var width = 1 / this.options.items.length * 100 + "%";
        }
        w.element.css({position: "relative", float: "left", width: width});
        return w;
    },

    addItem: function (item) {
        var w = BI.LatticeLayout.superclass.addItem.apply(this, arguments);
        this.resize();
        return w;
    },

    addItemAt: function (item) {
        var w = BI.LatticeLayout.superclass.addItemAt.apply(this, arguments);
        this.resize();
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.LatticeLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.lattice", BI.LatticeLayout);/**
 * 上下的高度固定/左右的宽度固定,中间的高度/宽度自适应
 *
 * @class BI.TableLayout
 * @extends BI.Layout
 */
BI.TableLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.TableLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-table-layout",
            scrolly: true,
            columnSize: [200, 200, "fill"],
            rowSize: 30,  // or [30,30,30]
            hgap: 0,
            vgap: 0,
            items: [[
                {
                    el: {text: "label1"}
                },
                {
                    el: {text: "label2"}
                },
                {
                    el: {text: "label3"}
                }
            ]]
        });
    },
    render: function () {
        BI.TableLayout.superclass.render.apply(this, arguments);
        this.rows = 0;
        this.populate(this.options.items);
    },

    _addElement: function (idx, arr) {
        var o = this.options;
        var abs = [], left = 0, right = 0, i, j;

        function firstElement (item, row, col) {
            if (row === 0) {
                item.addClass("first-row");
            }
            if (col === 0) {
                item.addClass("first-col");
            }
            item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row");
            item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col");
            item.addClass("center-element");
        }

        function firstObject (item, row, col) {
            var cls = "";
            if (row === 0) {
                cls += " first-row";
            }
            if (col === 0) {
                cls += " first-col";
            }
            BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row");
            BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col");
            item.cls = (item.cls || "") + cls + " center-element";
        }

        function first (item, row, col) {
            if (item instanceof BI.Widget) {
                firstElement(item.element, row, col);
            } else if (item.el instanceof BI.Widget) {
                firstElement(item.el.element, row, col);
            } else if (item.el) {
                firstObject(item.el, row, col);
            } else {
                firstObject(item, row, col);
            }
        }

        for (i = 0; i < arr.length; i++) {
            if (BI.isNumber(o.columnSize[i])) {
                first(arr[i], this.rows, i);
                abs.push(BI.extend({
                    top: 0,
                    bottom: 0,
                    left: o.columnSize[i] <= 1 ? left * 100 + "%" : left,
                    width: o.columnSize[i] <= 1 ? o.columnSize[i] * 100 + "%" : o.columnSize[i]
                }, arr[i]));
                left += o.columnSize[i] + (o.columnSize[i] < 1 ? 0 : o.hgap);
            } else {
                break;
            }
        }
        for (j = arr.length - 1; j > i; j--) {
            if (BI.isNumber(o.columnSize[j])) {
                first(arr[j], this.rows, j);
                abs.push(BI.extend({
                    top: 0,
                    bottom: 0,
                    right: o.columnSize[j] <= 1 ? right * 100 + "%" : right,
                    width: o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j]
                }, arr[j]));
                right += o.columnSize[j] + (o.columnSize[j] < 1 ? 0 : o.hgap);
            } else {
                throw new Error("item with fill can only be one");
            }
        }
        if (i >= 0 && i < arr.length) {
            first(arr[i], this.rows, i);
            abs.push(BI.extend({
                top: 0,
                bottom: 0,
                left: left <= 1 ? left * 100 + "%" : left,
                right: right <= 1 ? right * 100 + "%" : right
            }, arr[i]));
        }
        var w = BI.createWidget({
            type: "bi.absolute",
            height: BI.isArray(o.rowSize) ? o.rowSize[this.rows] : o.rowSize,
            items: abs
        });
        if (this.rows > 0) {
            this.getWidgetByName(this.getName() + (this.rows - 1)).element.css({
                "margin-bottom": o.vgap
            });
        }
        w.element.css({
            position: "relative"
        });
        this.addWidget(this.getName() + (this.rows++), w);
        return w;
    },

    resize: function () {
        // console.log("table布局不需要resize");
    },

    addItem: function (arr) {
        if (!BI.isArray(arr)) {
            throw new Error("item must be array");
        }
        return BI.TableLayout.superclass.addItem.apply(this, arguments);
    },

    populate: function (items) {
        BI.TableLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.table", BI.TableLayout);/**
 * 水平tape布局
 * @class BI.HTapeLayout
 * @extends BI.Layout
 */
BI.HTapeLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HTapeLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-h-tape-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0,
            items: [
                {
                    width: 100,
                    el: {type: "bi.button", text: "button1"}
                },
                {
                    width: "fill",
                    el: {type: "bi.button", text: "button2"}
                },
                {
                    width: 200,
                    el: {type: "bi.button", text: "button3"}
                }
            ]
        });
    },
    render: function () {
        BI.HTapeLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        this.stroke(this.options.items);
    },
    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        items = BI.compact(items);
        BI.each(items, function (i, item) {
            if (!self.hasWidget(self.getName() + i + "")) {
                var w = BI.createWidget(item);
                self.addWidget(self.getName() + i + "", w);
            } else {
                w = self.getWidgetByName(self.getName() + i + "");
            }
            w.element.css({position: "absolute", top: (item.vgap || 0) + (item.tgap || 0) + o.vgap + o.tgap + "px", bottom: (item.bgap || 0) + (item.vgap || 0) + o.vgap + o.bgap + "px"});
        });

        var left = {}, right = {};
        left[0] = 0;
        right[items.length - 1] = 0;

        BI.any(items, function (i, item) {
            var w = self.getWidgetByName(self.getName() + i + "");
            if (BI.isNull(left[i])) {
                left[i] = left[i - 1] + items[i - 1].width + (items[i - 1].lgap || 0) + 2 * (items[i - 1].hgap || 0) + o.hgap + o.lgap + o.rgap;
            }
            if (item.width < 1 && item.width >= 0) {
                w.element.css({left: left[i] * 100 + "%", width: item.width * 100 + "%"});
            } else {
                w.element.css({
                    left: left[i] + (item.lgap || 0) + (item.hgap || 0) + o.hgap + o.lgap + "px",
                    width: BI.isNumber(item.width) ? item.width : ""
                });
            }
            if (!BI.isNumber(item.width)) {
                return true;
            }
        });
        BI.backAny(items, function (i, item) {
            var w = self.getWidgetByName(self.getName() + i + "");
            if (BI.isNull(right[i])) {
                right[i] = right[i + 1] + items[i + 1].width + (items[i + 1].rgap || 0) + 2 * (items[i + 1].hgap || 0) + o.hgap + o.lgap + o.rgap;
            }
            if (item.width < 1 && item.width >= 0) {
                w.element.css({right: right[i] * 100 + "%", width: item.width * 100 + "%"});
            } else {
                w.element.css({
                    right: right[i] + (item.rgap || 0) + (item.hgap || 0) + o.hgap + o.rgap + "px",
                    width: BI.isNumber(item.width) ? item.width : ""
                });
            }
            if (!BI.isNumber(item.width)) {
                return true;
            }
        });
    },

    populate: function (items) {
        BI.HTapeLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.htape", BI.HTapeLayout);

/**
 * 垂直tape布局
 * @class BI.VTapeLayout
 * @extends BI.Layout
 */
BI.VTapeLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.VTapeLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-v-tape-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0,
            items: [
                {
                    height: 100,
                    el: {type: "bi.button", text: "button1"}
                },
                {
                    height: "fill",
                    el: {type: "bi.button", text: "button2"}
                },
                {
                    height: 200,
                    el: {type: "bi.button", text: "button3"}
                }
            ]
        });
    },
    render: function () {
        BI.VTapeLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        items = BI.compact(items);
        BI.each(items, function (i, item) {
            if (!self.hasWidget(self.getName() + i + "")) {
                var w = BI.createWidget(item);
                self.addWidget(self.getName() + i + "", w);
            } else {
                w = self.getWidgetByName(self.getName() + i + "");
            }
            w.element.css({position: "absolute", left: (item.lgap || 0) + (item.hgap || 0) + o.hgap + o.lgap + "px", right: + (item.hgap || 0) + (item.rgap || 0) + o.hgap + o.rgap + "px"});
        });

        var top = {}, bottom = {};
        top[0] = 0;
        bottom[items.length - 1] = 0;

        BI.any(items, function (i, item) {
            var w = self.getWidgetByName(self.getName() + i + "");
            if (BI.isNull(top[i])) {
                top[i] = top[i - 1] + items[i - 1].height + (items[i - 1].tgap || 0) + 2 * (items[i - 1].vgap || 0) + o.vgap + o.tgap + o.bgap;
            }
            if (item.height < 1 && item.height >= 0) {
                w.element.css({top: top[i] * 100 + "%", height: item.height * 100 + "%"});
            } else {
                w.element.css({
                    top: top[i] + (item.vgap || 0) + (item.tgap || 0) + o.vgap + o.tgap + "px",
                    height: BI.isNumber(item.height) ? item.height : ""
                });
            }
            if (!BI.isNumber(item.height)) {
                return true;
            }
        });
        BI.backAny(items, function (i, item) {
            var w = self.getWidgetByName(self.getName() + i + "");
            if (BI.isNull(bottom[i])) {
                bottom[i] = bottom[i + 1] + items[i + 1].height + (items[i + 1].bgap || 0) + 2 * (items[i + 1].vgap || 0) + o.vgap + o.tgap + o.bgap;
            }
            if (item.height < 1 && item.height >= 0) {
                w.element.css({bottom: bottom[i] * 100 + "%", height: item.height * 100 + "%"});
            } else {
                w.element.css({
                    bottom: bottom[i] + (item.vgap || 0) + (item.bgap || 0) + o.vgap + o.bgap + "px",
                    height: BI.isNumber(item.height) ? item.height : ""
                });
            }
            if (!BI.isNumber(item.height)) {
                return true;
            }
        });
    },

    populate: function (items) {
        BI.VTapeLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.vtape", BI.VTapeLayout);/**
 * td布局
 * @class BI.TdLayout
 * @extends BI.Layout
 */
BI.TdLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.TdLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-td-layout",
            columnSize: [200, 200, 200],
            hgap: 0,
            vgap: 0,
            items: [[
                {
                    el: {text: "label1"}
                },
                {
                    el: {text: "label2"}
                },
                {
                    el: {text: "label3"}
                }
            ]]
        });
    },
    render: function () {
        BI.TdLayout.superclass.render.apply(this, arguments);
        this.$table = $("<table>").attr({cellspacing: 0, cellpadding: 0}).css({
            position: "relative",
            width: "100%",
            height: "100%",
            "border-spacing": "0px",
            border: "none",
            "border-collapse": "separate"
        });
        this.rows = 0;
        this.populate(this.options.items);
    },

    _addElement: function (idx, arr) {
        var o = this.options;

        function firstElement (item, row, col) {
            if (row === 0) {
                item.addClass("first-row");
            }
            if (col === 0) {
                item.addClass("first-col");
            }
            item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row");
            item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col");
            item.addClass("center-element");
        }

        function firstObject (item, row, col) {
            var cls = "";
            if (row === 0) {
                cls += " first-row";
            }
            if (col === 0) {
                cls += " first-col";
            }
            BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row");
            BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col");
            item.cls = (item.cls || "") + cls + " center-element";
        }

        function first (item, row, col) {
            if (item instanceof BI.Widget) {
                firstElement(item.element, row, col);
            } else if (item.el instanceof BI.Widget) {
                firstElement(item.el.element, row, col);
            } else if (item.el) {
                firstObject(item.el, row, col);
            } else {
                firstObject(item, row, col);
            }
        }

        var tr = BI.createWidget({
            type: "bi.default",
            tagName: "tr"
        });

        for (var i = 0; i < arr.length; i++) {
            var w = BI.createWidget(arr[i]);
            w.element.css({position: "relative", top: "0", left: "0", margin: "0px auto"});
            if (arr[i].lgap) {
                w.element.css({"margin-left": arr[i].lgap + "px"});
            }
            if (arr[i].rgap) {
                w.element.css({"margin-right": arr[i].rgap + "px"});
            }
            if (arr[i].tgap) {
                w.element.css({"margin-top": arr[i].tgap + "px"});
            }
            if (arr[i].bgap) {
                w.element.css({"margin-bottom": arr[i].bgap + "px"});
            }
            first(w, this.rows++, i);
            var td = BI.createWidget({
                type: "bi.default",
                attributes: {
                    width: o.columnSize[i] <= 1 ? (o.columnSize[i] * 100 + "%") : o.columnSize[i]
                },
                tagName: "td",
                items: [w]
            });
            td.element.css({
                position: "relative",
                "vertical-align": "middle",
                margin: "0",
                padding: "0",
                border: "none"
            });
            tr.addItem(td);
        }
        this.addWidget(this.getName() + idx, tr);
        return tr;
    },

    _mountChildren: function () {
        var self = this;
        var frag = document.createDocumentFragment();
        var hasChild = false;
        BI.each(this._children, function (i, widget) {
            if (widget.element !== self.element) {
                frag.appendChild(widget.element[0]);
                hasChild = true;
            }
        });
        if (hasChild === true) {
            this.$table.append(frag);
            this.element.append(this.$table);
        }
    },

    resize: function () {
        // console.log("td布局不需要resize");
    },

    addItem: function (arr) {
        if (!BI.isArray(arr)) {
            throw new Error("item must be array");
        }
        return BI.TdLayout.superclass.addItem.apply(this, arguments);
    },

    populate: function (items) {
        BI.TdLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.td", BI.TdLayout);/**
 * 垂直布局
 * @class BI.VerticalLayout
 * @extends BI.Layout
 */
BI.VerticalLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.VerticalLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-vertical-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0,
            scrolly: true
        });
    },
    render: function () {
        BI.VerticalLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    _addElement: function (i, item) {
        var o = this.options;
        var w = BI.VerticalLayout.superclass._addElement.apply(this, arguments);
        w.element.css({
            position: "relative"
        });
        if (o.vgap + o.tgap + (item.tgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-top": (i === 0 ? o.vgap : 0) + o.tgap + (item.tgap || 0) + (item.vgap || 0) + "px"
            });
        }
        if (o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-left": o.hgap + o.lgap + (item.lgap || 0) + (item.hgap || 0) +"px"
            });
        }
        if (o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) !== 0) {
            w.element.css({
                "margin-right": o.hgap + o.rgap + (item.rgap || 0) + (item.hgap || 0) + "px"
            });
        }
        if (o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) !== 0) {
            w.element.css({
                "margin-bottom": o.vgap + o.bgap + (item.bgap || 0) + (item.vgap || 0) + "px"
            });
        }
        return w;
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    populate: function (items) {
        BI.VerticalLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.vertical", BI.VerticalLayout);/**
 *
 * @class BI.WindowLayout
 * @extends BI.Layout
 */
BI.WindowLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.WindowLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-window-layout",
            columns: 3,
            rows: 2,
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0,
            columnSize: [100, "fill", 200],
            rowSize: [100, "fill"],
            items: [[
                {
                    el: {type: "bi.button", text: "button1"}
                },
                {
                    el: {type: "bi.button", text: "button2"}
                },
                {
                    el: {type: "bi.button", text: "button3"}
                }
            ]]
        });
    },
    render: function () {
        BI.WindowLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        this.stroke(this.options.items);
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var o = this.options;
        if (BI.isNumber(o.rowSize)) {
            o.rowSize = BI.makeArray(o.items.length, 1 / o.items.length);
        }
        if (BI.isNumber(o.columnSize)) {
            o.columnSize = BI.makeArray(o.items[0].length, 1 / o.items[0].length);
        }
        function firstElement (item, row, col) {
            if (row === 0) {
                item.addClass("first-row");
            }
            if (col === 0) {
                item.addClass("first-col");
            }
            item.addClass(BI.isOdd(row + 1) ? "odd-row" : "even-row");
            item.addClass(BI.isOdd(col + 1) ? "odd-col" : "even-col");
            item.addClass("center-element");
        }

        function firstObject (item, row, col) {
            var cls = "";
            if (row === 0) {
                cls += " first-row";
            }
            if (col === 0) {
                cls += " first-col";
            }
            BI.isOdd(row + 1) ? (cls += " odd-row") : (cls += " even-row");
            BI.isOdd(col + 1) ? (cls += " odd-col") : (cls += " even-col");
            item.cls = (item.cls || "") + cls + " center-element";
        }

        function first (item, row, col) {
            if (item instanceof BI.Widget) {
                firstElement(item.element, row, col);
            } else if (item.el instanceof BI.Widget) {
                firstElement(item.el.element, row, col);
            } else if (item.el) {
                firstObject(item.el, row, col);
            } else {
                firstObject(item, row, col);
            }
        }

        for (var i = 0; i < o.rows; i++) {
            for (var j = 0; j < o.columns; j++) {
                if (!o.items[i][j]) {
                    throw new Error("item be required");
                }
                if (!this.hasWidget(this.getName() + i + "_" + j)) {
                    var w = BI.createWidget(o.items[i][j]);
                    w.element.css({position: "absolute"});
                    this.addWidget(this.getName() + i + "_" + j, w);
                }
            }
        }
        var left = {}, right = {}, top = {}, bottom = {};
        left[0] = 0;
        top[0] = 0;
        right[o.columns - 1] = 0;
        bottom[o.rows - 1] = 0;
        // 从上到下
        for (var i = 0; i < o.rows; i++) {
            for (var j = 0; j < o.columns; j++) {
                var wi = this.getWidgetByName(this.getName() + i + "_" + j);
                if (BI.isNull(top[i])) {
                    top[i] = top[i - 1] + (o.rowSize[i - 1] < 1 ? o.rowSize[i - 1] : o.rowSize[i - 1] + o.vgap + o.bgap);
                }
                var t = top[i] <= 1 ? top[i] * 100 + "%" : top[i] + o.vgap + o.tgap + "px", h = "";
                if (BI.isNumber(o.rowSize[i])) {
                    h = o.rowSize[i] <= 1 ? o.rowSize[i] * 100 + "%" : o.rowSize[i] + "px";
                }
                wi.element.css({top: t, height: h});
                first(wi, i, j);
            }
            if (!BI.isNumber(o.rowSize[i])) {
                break;
            }
        }
        // 从下到上
        for (var i = o.rows - 1; i >= 0; i--) {
            for (var j = 0; j < o.columns; j++) {
                var wi = this.getWidgetByName(this.getName() + i + "_" + j);
                if (BI.isNull(bottom[i])) {
                    bottom[i] = bottom[i + 1] + (o.rowSize[i + 1] < 1 ? o.rowSize[i + 1] : o.rowSize[i + 1] + o.vgap + o.tgap);
                }
                var b = bottom[i] <= 1 ? bottom[i] * 100 + "%" : bottom[i] + o.vgap + o.bgap + "px", h = "";
                if (BI.isNumber(o.rowSize[i])) {
                    h = o.rowSize[i] <= 1 ? o.rowSize[i] * 100 + "%" : o.rowSize[i] + "px";
                }
                wi.element.css({bottom: b, height: h});
                first(wi, i, j);
            }
            if (!BI.isNumber(o.rowSize[i])) {
                break;
            }
        }
        // 从左到右
        for (var j = 0; j < o.columns; j++) {
            for (var i = 0; i < o.rows; i++) {
                var wi = this.getWidgetByName(this.getName() + i + "_" + j);
                if (BI.isNull(left[j])) {
                    left[j] = left[j - 1] + (o.columnSize[j - 1] < 1 ? o.columnSize[j - 1] : o.columnSize[j - 1] + o.hgap + o.rgap);
                }
                var l = left[j] <= 1 ? left[j] * 100 + "%" : left[j] + o.hgap + o.lgap + "px", w = "";
                if (BI.isNumber(o.columnSize[j])) {
                    w = o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j] + "px";
                }
                wi.element.css({left: l, width: w});
                first(wi, i, j);
            }
            if (!BI.isNumber(o.columnSize[j])) {
                break;
            }
        }
        // 从右到左
        for (var j = o.columns - 1; j >= 0; j--) {
            for (var i = 0; i < o.rows; i++) {
                var wi = this.getWidgetByName(this.getName() + i + "_" + j);
                if (BI.isNull(right[j])) {
                    right[j] = right[j + 1] + (o.columnSize[j + 1] < 1 ? o.columnSize[j + 1] : o.columnSize[j + 1] + o.hgap + o.lgap);
                }
                var r = right[j] <= 1 ? right[j] * 100 + "%" : right[j] + o.hgap + o.rgap + "px", w = "";
                if (BI.isNumber(o.columnSize[j])) {
                    w = o.columnSize[j] <= 1 ? o.columnSize[j] * 100 + "%" : o.columnSize[j] + "px";
                }
                wi.element.css({right: r, width: w});
                first(wi, i, j);
            }
            if (!BI.isNumber(o.columnSize[j])) {
                break;
            }
        }
    },

    populate: function (items) {
        BI.WindowLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.window", BI.WindowLayout);/**
 * 水平和垂直方向都居中容器, 非自适应,用于宽度高度固定的面板
 * @class BI.CenterLayout
 * @extends BI.Layout
 */
BI.CenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.CenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-center-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },

    render: function () {
        BI.CenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("center布局不需要resize");
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        var list = [];
        BI.each(items, function (i) {
            list.push({
                column: i,
                row: 0,
                el: BI.createWidget({
                    type: "bi.default",
                    cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "")
                })
            });
        });
        BI.each(items, function (i, item) {
            if (item) {
                var w = BI.createWidget(item);
                w.element.css({
                    position: "absolute",
                    left: o.hgap + o.lgap,
                    right: o.hgap + o.rgap,
                    top: o.vgap + o.tgap,
                    bottom: o.vgap + o.bgap,
                    width: "auto",
                    height: "auto"
                });
                list[i].el.addItem(w);
            }
        });
        BI.createWidget({
            type: "bi.grid",
            element: this,
            columns: list.length,
            rows: 1,
            items: list
        });
    },

    populate: function (items) {
        BI.CenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.center", BI.CenterLayout);/**
 * 浮动布局实现的居中容器
 * @class BI.FloatCenterLayout
 * @extends BI.Layout
 */
BI.FloatCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.FloatCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-float-center-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.FloatCenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("floatcenter布局不需要resize");
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        var list = [], width = 100 / items.length;
        BI.each(items, function (i) {
            var widget = BI.createWidget({
                type: "bi.default"
            });
            widget.element.addClass("center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "")).css({
                width: width + "%",
                height: "100%"
            });
            list.push({
                el: widget
            });
        });
        BI.each(items, function (i, item) {
            if (item) {
                var w = BI.createWidget(item);
                w.element.css({
                    position: "absolute",
                    left: o.hgap + o.lgap,
                    right: o.hgap + o.rgap,
                    top: o.vgap + o.tgap,
                    bottom: o.vgap + o.bgap,
                    width: "auto",
                    height: "auto"
                });
                list[i].el.addItem(w);
            }
        });
        BI.createWidget({
            type: "bi.left",
            element: this,
            items: list
        });
    },

    populate: function (items) {
        BI.FloatCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.float_center", BI.FloatCenterLayout);/**
 * 水平和垂直方向都居中容器, 非自适应,用于宽度高度固定的面板
 * @class BI.HorizontalCenterLayout
 * @extends BI.Layout
 */
BI.HorizontalCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.HorizontalCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-horizontal-center-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.HorizontalCenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("horizontal_center布局不需要resize");
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        var list = [];
        BI.each(items, function (i) {
            list.push({
                column: i,
                row: 0,
                el: BI.createWidget({
                    type: "bi.default",
                    cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "")
                })
            });
        });
        BI.each(items, function (i, item) {
            if (item) {
                var w = BI.createWidget(item);
                w.element.css({
                    position: "absolute",
                    left: o.hgap + o.lgap,
                    right: o.hgap + o.rgap,
                    top: o.vgap + o.tgap,
                    bottom: o.vgap + o.bgap,
                    width: "auto"
                });
                list[i].el.addItem(w);
            }
        });
        BI.createWidget({
            type: "bi.grid",
            element: this,
            columns: list.length,
            rows: 1,
            items: list
        });
    },

    populate: function (items) {
        BI.HorizontalCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.horizontal_center", BI.HorizontalCenterLayout);/**
 * 垂直方向都居中容器, 非自适应,用于高度不固定的面板
 * @class BI.VerticalCenterLayout
 * @extends BI.Layout
 */
BI.VerticalCenterLayout = BI.inherit(BI.Layout, {
    props: function () {
        return BI.extend(BI.VerticalCenterLayout.superclass.props.apply(this, arguments), {
            baseCls: "bi-vertical-center-layout",
            hgap: 0,
            vgap: 0,
            lgap: 0,
            rgap: 0,
            tgap: 0,
            bgap: 0
        });
    },
    render: function () {
        BI.VerticalCenterLayout.superclass.render.apply(this, arguments);
        this.populate(this.options.items);
    },

    resize: function () {
        // console.log("vertical_center布局不需要resize");
    },

    addItem: function (item) {
        // do nothing
        throw new Error("cannot be added");
    },

    stroke: function (items) {
        var self = this, o = this.options;
        var list = [];
        BI.each(items, function (i) {
            list.push({
                column: 0,
                row: i,
                el: BI.createWidget({
                    type: "bi.default",
                    cls: "center-element " + (i === 0 ? "first-element " : "") + (i === items.length - 1 ? "last-element" : "")
                })
            });
        });
        BI.each(items, function (i, item) {
            if (item) {
                var w = BI.createWidget(item);
                w.element.css({
                    position: "absolute",
                    left: o.hgap + o.lgap,
                    right: o.hgap + o.rgap,
                    top: o.vgap + o.tgap,
                    bottom: o.vgap + o.bgap,
                    height: "auto"
                });
                list[i].el.addItem(w);
            }
        });
        BI.createWidget({
            type: "bi.grid",
            element: this,
            columns: 1,
            rows: list.length,
            items: list
        });
    },

    populate: function (items) {
        BI.VerticalCenterLayout.superclass.populate.apply(this, arguments);
        this._mount();
    }
});
BI.shortcut("bi.vertical_center", BI.VerticalCenterLayout);/**
 * 缓冲池
 * @type {{Buffer: {}}}
 */

(function () {
    var Buffer = {};
    var MODE = false;// 设置缓存模式为关闭

    BI.BufferPool = {
        put: function (name, cache) {
            if (BI.isNotNull(Buffer[name])) {
                throw new Error("Buffer Pool has the key already!");
            }
            Buffer[name] = cache;
        },

        get: function (name) {
            return Buffer[name];
        }
    };
})();/**
 * 共享池
 * @type {{Shared: {}}}
 */

(function () {
    var _Shared = {};
    BI.SharingPool = {
        _Shared: _Shared,
        put: function (name, shared) {
            _Shared[name] = shared;
        },

        cat: function () {
            var args = Array.prototype.slice.call(arguments, 0),
                copy = _Shared;
            for (var i = 0; i < args.length; i++) {
                copy = copy && copy[args[i]];
            }
            return copy;
        },

        get: function () {
            return BI.deepClone(this.cat.apply(this, arguments));
        },

        remove: function (key) {
            delete _Shared[key];
        }
    };
})();BI.Req = {

};